BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787194 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs29412 171 4e-45 >Cs29412 Length = 180 Score = 171 bits (433), Expect = 4e-45, Method: Compositional matrix adjust. Identities = 81/127 (63%), Positives = 99/127 (77%) Query: 2 VKGVAVLGSSEGVKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTGP 61 VK VA++ + VKG+++FVQ +G T V G I+GLKPGLHGFH+HA GDTTNGC STGP Sbjct: 10 VKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGP 69 Query: 62 HFNPNGKEHGAPEDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHGD 121 HFNP K+HGAP D +RH GDLGN+ G DG A ++ D+ IPL+G HS++GRAVVVH D Sbjct: 70 HFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVVHAD 129 Query: 122 PDDLGKG 128 PDDLGKG Sbjct: 130 PDDLGKG 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5230 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14690 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19941 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27558 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226776838 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32014 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038911 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91030313 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10241 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48074 207 8e-56 >Cs48074 Length = 257 Score = 207 bits (528), Expect = 8e-56, Method: Compositional matrix adjust. Identities = 100/199 (50%), Positives = 134/199 (67%), Gaps = 2/199 (1%) Query: 94 EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVR 153 E +K F+ FK KY +N Y LAKGQ+PK+MV +C+DSRVCPS +L FQPGEAF+VR Sbjct: 51 ERIKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVR 110 Query: 154 NIANLVPSL-ESGPSETNAALEFSVNSLKVENILVVGHSCCGGIRALMSMD-DEIEKSSF 211 N+AN+VP ++ + AA+E++V LKV NI+V+GHS CGGI+ LMS D + F Sbjct: 111 NVANIVPPYDQTKYAGVGAAVEYAVLHLKVSNIVVIGHSACGGIKGLMSFPFDGNNSTDF 170 Query: 212 IQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLTYPWIEEKVKQGVLAV 271 I++WV +G A+S F QC +CEKE++N SL NLLTYP++ E + LA+ Sbjct: 171 IEDWVKIGIPAKSKVLTEHGDKPFGDQCTYCEKEAVNVSLSNLLTYPFVREGLVNKTLAL 230 Query: 272 HGGYYDFVECTFEKWTLDY 290 GGYYDFV +FE W LD+ Sbjct: 231 KGGYYDFVNGSFELWGLDF 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14919 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48074 94 4e-22 >Cs48074 Length = 257 Score = 93.6 bits (231), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 40/65 (61%), Positives = 51/65 (78%) Query: 1 MKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVRNI 60 +K F+ FK KY +N Y LAKGQ+PK+MV +C+DSRVCPS +L FQPGEAF+VRN+ Sbjct: 53 IKDGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNV 112 Query: 61 ANLVP 65 AN+VP Sbjct: 113 ANIVP 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18766 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13308 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3144 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823645 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23118 (290 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87691 417 e-119 >Cs87691 Length = 293 Score = 417 bits (1071), Expect = e-119, Method: Compositional matrix adjust. Identities = 211/276 (76%), Positives = 219/276 (79%), Gaps = 2/276 (0%) Query: 17 EVLGNSLGNFXXXXXXXXXXXXXXXFKTVALFSXXXXX--XXXXXXXXXXXDEELAKWYG 74 E+LGN L FK VALFS +EELAKWYG Sbjct: 18 EMLGNPLNVSSAVRTSAPGASNPSTFKPVALFSKKKAAPPAKSKPVAVSPVNEELAKWYG 77 Query: 75 PDRRIFLPSGLLDRSEIPEYLTGEVPGDYGYDPFGLGKKPEDFSKYQAYELIHARWAMLG 134 PDRRIFLP GLLDRSEIPEYLTGEVPGDYGYDPFGL KKP+DFSKYQAYELIHARWAMLG Sbjct: 78 PDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLG 137 Query: 135 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFXXXXXXXXXXX 194 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL+F Sbjct: 138 AAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGG 197 Query: 195 XXYYRITNGLELEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSMLGFFLQAY 254 YYRITNGL+LEDKLHPGGPFDPLGLAKDPDQ ALLKVKEIKNGRLAMF+MLGFFLQAY Sbjct: 198 AEYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAY 257 Query: 255 VTGEGPVENLSKHLSDPFGNNLLTVIGGSIERAPTL 290 VTGEGPVENL+KHLSDPF NNLLTVI G+ ERAPTL Sbjct: 258 VTGEGPVENLAKHLSDPFANNLLTVISGNAERAPTL 293 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748222 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9124 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7379 (589 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60255 333 3e-93 >Cs60255 Length = 235 Score = 333 bits (854), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 157/252 (62%), Positives = 188/252 (74%), Gaps = 17/252 (6%) Query: 316 MQPDWDMFHSLHPAAEYHGAARALGGCAIYVSDKPGHHNFDLLRKLVLPDGSVLRAKLPG 375 MQPDWDMFHSLHP AEYHGAARA+GGCAIYVSDKPG H+F+LLRKLVLPDGS+LRAKLPG Sbjct: 1 MQPDWDMFHSLHPMAEYHGAARAVGGCAIYVSDKPGQHDFNLLRKLVLPDGSILRAKLPG 60 Query: 376 RPTRDCLFADPARDRTSLLKIWNVNNLSGVVGVFNCQGAGWCKIEKKTRIHDYSPGTLSG 435 RPTRDCLF+DPARD SLLKIWN+N+ +GVVGVFNCQGAGWC++ KK IHD PGT +G Sbjct: 61 RPTRDCLFSDPARDGKSLLKIWNLNDFTGVVGVFNCQGAGWCRVGKKNLIHDEQPGTTTG 120 Query: 436 SVRAADVDAIAQVAGADWNGETAVYAHKSGEVLRLPKGASVPVTLKVLDYEVFHFCPLKE 495 +RA DVD + +VAG +W G+ Y+H GEV LPK A++P+TLK +YEV+ P+KE Sbjct: 121 FIRAKDVDYLPRVAGDEWTGDAIAYSHLGGEVAYLPKNATLPITLKSREYEVYTVVPVKE 180 Query: 496 ITSDVSFAPIGLLDMFNSSAAVEEVEIHLASDKKPELSNGEVSENRSPTATIGLKTRGCG 555 ++S FAPIGL+ MFNS A++EV S G TAT+ +K RGCG Sbjct: 181 LSSGTRFAPIGLVKMFNSGGAIKEVRYE---------SEG--------TATVDMKVRGCG 223 Query: 556 RFGAYCSRRPLK 567 GAY S RP + Sbjct: 224 ELGAYSSARPQR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17732 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60298 74 2e-15 >Cs60298 Length = 197 Score = 73.6 bits (179), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 3/184 (1%) Query: 30 LFLGGAGMRGLEIQGNFVKVTAIGVYLEDNAVPLLAVKWKGKTAEELSESVEFFRDIVTG 89 + L G+ +EI +K TAIGVYL+ + L +WKGK L++ +FF +V+ Sbjct: 11 VLLLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQ-QWKGKQGSSLAQDDDFFDALVSA 69 Query: 90 PFEKFIQVTMILPLTGQQYSEKVSENCVFFWKSVGIYTDLEGKAIEQFIDVFKDQNFPPG 149 P EKF+++ +I + G QY ++ Y + E A+E+ ++ F+ + F Sbjct: 70 PVEKFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYEEEEESALEKIVEFFQSKYFKKD 129 Query: 150 ASILFTQSPKGSLTISFSKDASMPEATNAVIENKLLSETVLESIV-GKHGVSPATKQSLA 208 + I + P S T + E + +EN + E + + + G GVSP T SLA Sbjct: 130 SVIAY-HFPATSPTAEIVXTSEGKEDSKIXVENANVVEMIKKWYLGGARGVSPTTTSSLA 188 Query: 209 ARLS 212 LS Sbjct: 189 HTLS 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7542 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9154 (270 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12568 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33140 108 7e-26 >Cs33140 Length = 153 Score = 108 bits (269), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 58/152 (38%), Positives = 85/152 (55%), Gaps = 4/152 (2%) Query: 4 NENLPPNVIKQLAKELKSLDESPPEGIKVGVNDDDFSIIYADIEGPAGTPYENGVFRMKL 63 N NLP +IK E + L P GI ++D+ I GP +PYE GVF+++L Sbjct: 3 NSNLPRRIIK----ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL 58 Query: 64 LLSWDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPF 123 L ++P + PK FLTKI+HPNI G IC++ LK W+P+L +R VL+ ++ LL P Sbjct: 59 FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 118 Query: 124 PESALNEQAGKMLLENYEEYARHARLYTGIHA 155 P+ L+E K N E A+ +T ++A Sbjct: 119 PDDPLSENIAKHWKTNEAEAVETAKEWTRLYA 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21036 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25724 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21854 (425 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13448 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414170 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12282 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58194 164 7e-43 >Cs58194 Length = 167 Score = 164 bits (416), Expect = 7e-43, Method: Compositional matrix adjust. Identities = 89/170 (52%), Positives = 105/170 (61%), Gaps = 6/170 (3%) Query: 99 MAEKDWLSLVAVHSDAWLVSVAFYFGARFGFDKADRKRLFNMINELPTIFEVVTGTAKKQ 158 M EKDWLSLVAVHSD+WL++VAFYFGARFGF K +RK+LF MIN+LPTIFEVVTG AK+ Sbjct: 1 MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQ- 59 Query: 159 VXXXXXXXXXXXXXXXXXXARGSELHGRHSEVVQP--KXXXXXXXXXXXXXXXXTCGACG 216 +R +E + ++ P TCGACG Sbjct: 60 -PKDQSANHNSSKSKSSGKSRPAESQTKAVKMSPPPKDDDDSGDEEEEDDEQGATCGACG 118 Query: 217 GGGPSSLDEPWIFCDFCETWFHMKCVKMTPARAKQIKQYKCPSCSNKRAR 266 DE WI CD CE WFH KCVK+TPA+A+ IKQYKCPSCS+KRAR Sbjct: 119 DN--YGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSSKRAR 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29681 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4715 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87016 223 9e-61 >Cs87016 Length = 154 Score = 223 bits (568), Expect = 9e-61, Method: Compositional matrix adjust. Identities = 105/150 (70%), Positives = 122/150 (81%) Query: 9 ERKKVMVAIDESEFSLYAFNWALENLRETIQSSQLVVFTAQPIDFASTYAASYGAAPAQL 68 ++KKVMVAIDESE YA WALENL + I S L++FTA+P +F A+ +GAAP L Sbjct: 2 DKKKVMVAIDESECRHYALQWALENLGDAISKSDLIIFTARPTEFIYVQASMFGAAPPDL 61 Query: 69 VTSLLENHKKVALALLERAKEICAKHGIVPETVTEVGDPKVVICEAVEKHNIQLLVLGSH 128 + S+ EN KK ALALL RAKEICAKHG+V ET+TE+GDPK+VICEA EKH IQLL++GSH Sbjct: 62 LMSIQENQKKAALALLGRAKEICAKHGVVAETMTEMGDPKIVICEAAEKHKIQLLIVGSH 121 Query: 129 GRGGIQRAFLGSVSNYCVHNAKCPVLVVRK 158 RG IQRAFLGSVSNYCVHNAKCPVLVVRK Sbjct: 122 SRGPIQRAFLGSVSNYCVHNAKCPVLVVRK 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25624 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10279 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs71989 115 1e-28 >Cs71989 Length = 234 Score = 115 bits (288), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 56/76 (73%), Positives = 66/76 (86%), Gaps = 1/76 (1%) Query: 1 MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLEQAECTIVSSLSN 60 MA+ SAIGFEGYEKRLE++FFEP +F DP GRGLRSLSK Q+DE L+ AECTIVSSLSN Sbjct: 1 MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN 60 Query: 61 DNVDSYVLXESSSLFI 76 +++DSYVL E SSLF+ Sbjct: 61 EHLDSYVLSE-SSLFV 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042338 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 67 1e-13 >Cs31373 Length = 293 Score = 66.6 bits (161), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Query: 22 RLKWTPELHQRFVEAVSQLGGADKATPKSLMRMMGIHGLTLYHLKSHLQKYR 73 ++ WTPELH+RFV+AV QLG DKA P ++ +MGI LT +++ SHLQKYR Sbjct: 87 KVDWTPELHRRFVQAVEQLG-VDKAVPSRILELMGIDCLTRHNIASHLQKYR 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8369 (469 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424661 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31777 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9947 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31437 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10162 (552 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3389 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78778 243 1e-66 >Cs78778 Length = 170 Score = 243 bits (621), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 115/145 (79%), Positives = 130/145 (89%), Gaps = 1/145 (0%) Query: 36 ATKASFFGGRKLRVRSFTATKGSSSSFTVRAAAADPDRPLWFPGSTPPPWLDGSLPGDFG 95 ATKASF GG+KL++R AT G+ S +V AAAADP+RPLWFPGSTPP WLDGSLPGDFG Sbjct: 27 ATKASFLGGKKLKLRKNGATAGTRS-VSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFG 85 Query: 96 FDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYF 155 FDPLGL SDP++L+WN Q+E+VHCRWAMLGAAGIFIPE LTK+GILNTPSWYTAGE EYF Sbjct: 86 FDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYF 145 Query: 156 TDTTTLFVVELVLIGWAEGRRWADI 180 TDTTTLF+VE++ IGWAEGRRWADI Sbjct: 146 TDTTTLFIVEMIFIGWAEGRRWADI 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91002989 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26624 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44556 164 6e-43 >Cs44556 Length = 185 Score = 164 bits (416), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 105/199 (52%), Positives = 131/199 (65%), Gaps = 27/199 (13%) Query: 1 MSRATVELDFFGMDQHHREAASYSSKSQFQKFLHRPRSVRGIHTAMSKINPEVFKSVIAS 60 MSRATVELDFFG++ + S+K QF+KFL R RS R I A+SKINPE+ KSVIAS Sbjct: 1 MSRATVELDFFGLENKE----NSSNKPQFKKFL-RQRSFRDIQGAISKINPEIIKSVIAS 55 Query: 61 GNASPSIPNPRKSFSVPSSPKVEQVLFPCLPLYXXXXXXXXXXXXXXXXXLQETTPMTIF 120 G+A SI S+PS+PK E + FP +PLY + ET P+TIF Sbjct: 56 GSAKSSI-------SLPSTPKEEPITFPDVPLYRHIPKSGSEN-------VSETAPLTIF 101 Query: 121 YNGTVSVFNVPLDKADSILKLALEGNSRKAAEAALPVDPKLALHPSEQQQQLVDPLSEY- 179 YNGTV+VF+V +KA+ ILKLA+EGNS K+ E+ D +A S+QQQQL++ L+ Sbjct: 102 YNGTVAVFDVHREKAEHILKLAVEGNS-KSFESN---DANVA---SDQQQQLLETLNTGD 154 Query: 180 LPITRSKSLQRFLEKRKER 198 LPI R KSLQRFLEKRKER Sbjct: 155 LPIARRKSLQRFLEKRKER 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19021 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16810 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9402 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15149 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26201 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21994 (571 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 218 1e-58 >Cs24180 Length = 294 Score = 218 bits (556), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 120/291 (41%), Positives = 182/291 (62%), Gaps = 9/291 (3%) Query: 118 DTFEKLDKIGQGTYSNVYKARDALSGKIVALKKVRFDNLEPESVKFMA-REILILRRLDH 176 D +EK++KIG+GTY VYKAR+ ++ + +ALKK+R + E E V A REI +L+ + H Sbjct: 2 DQYEKVEKIGEGTYGVVYKARNCVTNETIALKKIRLEQ-EDEGVPSTAIREISLLKEMQH 60 Query: 177 PNVVKLEGLVTSRMSCSLYLVFEYMEHDLAG-LAASPAIKFTEPQVKCYMNQLLSGLEHC 235 N+V+L+ +V S LYLVFEY++ DL + + P +K ++ Q+L G+ +C Sbjct: 61 GNIVRLQDVVHSEKK--LYLVFEYLDLDLKKHMDSCPDFANDPRLIKTFLYQILRGIAYC 118 Query: 236 HNRYVLHRDIKGSNLLIDN-GGVLKIADFGLASFFDPNYKQPMTSRVVTLWYRPPELLLG 294 H+ VLHRD+K NLLID LK+ADFGLA F + T VVTLWYR PE+LLG Sbjct: 119 HSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRT-FTHEVVTLWYRAPEILLG 177 Query: 295 ATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIFKLCGSPSDDYW-KKSKLPHA 353 + Y VD+WS GCI AE++ +P+ PG +E+++L KIF++ G+P++D W + LP Sbjct: 178 SRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEDTWPGVTSLPDF 237 Query: 354 TIFKPQQSYKRCIAETFKDFPPSSLPLIETLLAIDPAERRTATAALRNEFF 404 P+ K + ++ P+ + L+ +L +DP+ R TA +AL +E+F Sbjct: 238 KSAFPKWPSKE-LGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYF 287 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13025 (290 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9578 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25993 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14204 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88183 136 2e-34 >Cs88183 Length = 323 Score = 136 bits (342), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 69/160 (43%), Positives = 100/160 (62%), Gaps = 17/160 (10%) Query: 76 HSYKRTFNGFAAKLTEEEAQKLAGMDGVVSVFPSETKKLQTTRSWDFIGFPE-------M 128 H+Y F+GF+AKLT EA +L + V++VF + + L TTRS F+G + Sbjct: 68 HTYDTVFHGFSAKLTPSEALRLKTLPHVLAVFSEQVRHLHTTRSPQFLGLKSSSDSAGLL 127 Query: 129 VKRSAIETDIIVGVIDSGIWPESASFSDAGFGPPPKRWKGACKGEGNF---TCNNKIIGA 185 +K S +D+++GVID+G+WPE SF+D GP P++WKG C +F +CN K+IGA Sbjct: 128 LKESDFGSDLVIGVIDTGVWPERQSFNDRDLGPVPRKWKGQCVTTNDFPATSCNRKLIGA 187 Query: 186 RYYRSQPYP------QNSSDIMSPRDTEGHGTHTASTAAG 219 R++ SQ Y +++ SPRD++GHGTHTAS AAG Sbjct: 188 RFF-SQGYESTNGKMNETTEFRSPRDSDGHGTHTASIAAG 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20845 (357 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28074 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48415811 (61 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27514 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20836 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5849 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49630969 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21241 (531 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990436 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29054 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs40321 64 3e-12 >Cs40321 Length = 204 Score = 63.5 bits (153), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 44/119 (36%), Positives = 62/119 (52%), Gaps = 8/119 (6%) Query: 243 ASVGDVEGLKAALASGADKDEEDSEGR-TALHFACGYGEVKCAQALLEAGARVDALDKNK 301 A +GDV L+ AL + + +E E R TALH C YG + C Q LLE GA ++A D++ Sbjct: 45 AQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDG 104 Query: 302 NTALHYAAGYGRKECVALLLENGAAV-----TLQNMD--GKTPIDVAKLNNQNDVLKLL 353 LH A G E V LL+ + + L+ +D G TP+ A DV++LL Sbjct: 105 AIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLL 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4678 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14885 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33047 350 8e-99 >Cs33047 Length = 275 Score = 350 bits (899), Expect = 8e-99, Method: Compositional matrix adjust. Identities = 163/218 (74%), Positives = 176/218 (80%) Query: 41 FDYFNLALQWPGTFCQRTRYCCSSNACCRGSNGPTVFTIHGLWPDYNDGTWPACCTQKTF 100 FDYFN ALQWPGT CQ TR+CC SN CCRGSN PT FTIHGLWPDYNDGTWP+CC + F Sbjct: 36 FDYFNFALQWPGTQCQHTRHCCPSNGCCRGSNAPTEFTIHGLWPDYNDGTWPSCCKKSKF 95 Query: 101 DEKEISTLHDALEKYWPSLSCGKPSSCRGGKGSFWGHEWEKHGTCSSPVVGDEYNYFLTT 160 DEKEISTL D LEKYWPS CG S+C G+G FW HEWEKHGTCS PV DEY+YFLTT Sbjct: 96 DEKEISTLLDTLEKYWPSYRCGSTSTCYSGEGLFWAHEWEKHGTCSFPVFRDEYSYFLTT 155 Query: 161 LNVYFKYNVTQILNEAGYVPSNTEKYPLGGIVSAIQNVFRATPKLVCKKGAVEELHLCFY 220 LN+YFKYNVT++LNEAGY+PSNTEKYPL GIVSAIQN F ATPKL C K AV ELHLCFY Sbjct: 156 LNLYFKYNVTRVLNEAGYLPSNTEKYPLRGIVSAIQNAFHATPKLDCSKDAVNELHLCFY 215 Query: 221 KDFKPRDCLVGSGNLNDKLASSSSCPNYVSIPAYASLG 258 KDFKPRDC++ NDK SSSCP YVS+P Y S G Sbjct: 216 KDFKPRDCIIERSPENDKYXLSSSCPKYVSLPVYTSSG 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18640 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990659 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925542 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22158 (438 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3256 (523 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819132 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21057 (446 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25765 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4294 90 2e-20 >Cs4294 Length = 251 Score = 90.1 bits (222), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 41/53 (77%), Positives = 48/53 (90%) Query: 137 GKQFSIADAEYFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAGKEKLASVS 189 GKQFS+++A+YFVFHSPYNKLVQKSFARL+FND +RNASS+DEA KEKL S Sbjct: 19 GKQFSLSNADYFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEATKEKLGPFS 71 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2984 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4294 143 3e-37 >Cs4294 Length = 251 Score = 143 bits (361), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 66/85 (77%), Positives = 74/85 (87%) Query: 1 MFSLRLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFVTNQD 60 MFSL+L+ G+ PFSL NI +VMNV KLK+RHEFPPE FVEVMK+MEHRYG KDFVT++D Sbjct: 151 MFSLKLSEGRHPFSLSNILSVMNVAGKLKSRHEFPPENFVEVMKLMEHRYGAKDFVTSKD 210 Query: 61 ISLLLPGTYYLTEVDSKYRRFYAKK 85 SLL PGTYYLTEVDS YRRFYAKK Sbjct: 211 SSLLAPGTYYLTEVDSMYRRFYAKK 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30550 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30199 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29839 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9815 (530 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6578 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48281431 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs38944 258 2e-71 >Cs38944 Length = 281 Score = 258 bits (660), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 119/141 (84%), Positives = 133/141 (94%) Query: 38 GPVLLEDYHLVEKLANFDRERIPKRVVHARGASAKGFFDVTHDISHLSCADFLRAPGVQT 97 GP+LLEDYHLVEKLANFDRERIP+RVVHARGASAKGFF+VTHD+S+L+CADFLRAPGVQT Sbjct: 7 GPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQT 66 Query: 98 PVIVRYSTVIHERGSPETIRDPRGFAAKFYTGEGNWDLVGNNLPAFFVRDAVKFPDVIHA 157 PVIVR+STVIHERGSPET+RDPRGFA KFYT EGN+DLVGNN P FFVRD +KFPD++HA Sbjct: 67 PVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHA 126 Query: 158 FKPNPKSHIQEYWRVLDFLSH 178 KPNPKSHIQE WR++DF SH Sbjct: 127 LKPNPKSHIQENWRIVDFFSH 147 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18747 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2535 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265691 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs43967 68 8e-14 >Cs43967 Length = 202 Score = 68.2 bits (165), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 11/138 (7%) Query: 50 SKRTTLLFFRGRLKRNAGGKIRSQLVAELSGS-----EGVAIEEGTAGEAGKSAAQNGMR 104 SKR L + GR A GK+ + EL+ E ++ + GK +R Sbjct: 2 SKRKHLANYLGR----AQGKVARLQLIELANQYPDKLESPDLKFKGPEKLGKIEYFQHLR 57 Query: 105 KSVFCLSPAGDTPSSARLFDAIVSGCIPVIVSDELELPFEGILDYRKIALFISSSDAVRP 164 + FCL+P G++ + R +++ C+PVI+SDE E PF+ ++DY +I++ SS R Sbjct: 58 NAKFCLAPRGESSWTLRFYESFFVECVPVILSDEAEFPFQNVIDYTQISIKWPSSRIGRQ 117 Query: 165 GWLVTFLRNISHAQIEEM 182 L+ +L I IE+M Sbjct: 118 --LLDYLATIPDEHIEQM 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31509 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418557 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21116 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486818 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8716 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7708 86 4e-19 >Cs7708 Length = 215 Score = 85.5 bits (210), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 57/211 (27%), Positives = 98/211 (46%), Gaps = 33/211 (15%) Query: 37 LILIGPPGSGKGTQSPIIKDDYCLCHLATGDMLRAAVSAKTPLGVKAKEAMDKGELVSDD 96 + ++G PGSGKGTQ I + + HL+ GD+LRA + + + G + + +G++V + Sbjct: 24 VFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSE 83 Query: 97 LVVGIIDEAMKKPSCQKGFILDGFPRTVVQAEKLDEMLKKQGAKIDKVLNFAVDDAILEE 156 + + ++ +AM++ K F++DGFPR + + K + + VL F + +E Sbjct: 84 VTIKLLQKAMEESGNDK-FLIDGFPRNEENRAAFEAVTKIEP---EFVLFFDCSEEEMER 139 Query: 157 RITGRWIHPSSGRSYHTKFAPPKAPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPV 216 RI R + G R+DD ++ R + F + + PV Sbjct: 140 RILNR----NQG-------------------------REDDNVETIRKRFKVFLESSLPV 170 Query: 217 IGYYSQKGIVANLQAEKPPQEVTSKVHKVLS 247 + YY KG V + A KP EV V V + Sbjct: 171 VQYYEAKGKVRKIDAAKPVAEVFDAVKAVFT 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32739 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797885 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11372 (541 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78136 164 2e-42 >Cs78136 Length = 347 Score = 164 bits (416), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 76/157 (48%), Positives = 103/157 (65%), Gaps = 2/157 (1%) Query: 4 LSMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTT 63 LS +LP GFRF PTD EL+ YL K+ G H + +I EID+ K +PW LP ++ Sbjct: 9 LSQLNLPPGFRFYPTDEELLVQYLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIF--G 66 Query: 64 DPEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDKILIGMKKTLVFHIGRAPK 123 + EW+FF P+DRKYPNG R NR GYWKATG D+ I ++ +G+KK LVF++G+APK Sbjct: 67 EKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPK 126 Query: 124 GKRTNWVMHEYRATQKELDGTNPGQSSFVLCRLFKKQ 160 G +TNW+MHEYR + + +VLCR++KK Sbjct: 127 GTKTNWIMHEYRLFEPSRKNGSSKLDDWVLCRIYKKH 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48694241 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48402402 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275638 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21155 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5847 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25185 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71923032 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3769 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82708 163 1e-42 >Cs82708 Length = 301 Score = 163 bits (413), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 96/160 (60%), Positives = 106/160 (66%), Gaps = 24/160 (15%) Query: 25 GCGGPIAENG----IMLFGVRVTEGNAFRKSVSMNNLSQYERPQQ--------------- 65 G G A NG IMLFGVRV ++ RKSVS+NNLSQYE+PQ Sbjct: 3 GTGDSSAVNGGGGEIMLFGVRVVV-DSMRKSVSLNNLSQYEQPQDNSSHCNNNNNNNNNN 61 Query: 66 -ADTNAEAGYAS-DEVVHASGHR--RERRRGVAWTEEEHKLFLVGLQMVGRGDWRGISRN 121 D A AGYAS D+ VH + R RER+RGV WTEEEHKLFL+GLQ VG+GDWRGISRN Sbjct: 62 NKDDVAAAGYASADDAVHNNSSRASRERKRGVPWTEEEHKLFLLGLQKVGKGDWRGISRN 121 Query: 122 FVKTRTPTQVASHAQKYFLXXXXXXXXXXXSSLFDITTDT 161 FVKTRTPTQVASHAQKYFL SSLFDITTD+ Sbjct: 122 FVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTDS 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7018 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3034 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24077 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16052 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17893 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28515 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22665 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10941 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21867 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7890 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6285 (393 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 149780162 (363 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5998 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18122 120 6e-30 >Cs18122 Length = 107 Score = 120 bits (300), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 69/107 (64%), Positives = 77/107 (71%), Gaps = 2/107 (1%) Query: 3 MAK-LVCFXXXXXXGISMAATQVMAKE-QARNQLDSGGYGPGSLKSYQCPSQCTRRCSQT 60 MAK F ISM T V+A Q DS YGPG++KSYQCP +C RCSQT Sbjct: 1 MAKSFAIFILAALFAISMLQTMVVAANGQGGRHYDSKHYGPGTVKSYQCPGKCDTRCSQT 60 Query: 61 QYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP 107 QY KPC+FFC KCC KCLCVPPG+YGNKAVCPCYNNWKT++GGPKCP Sbjct: 61 QYRKPCLFFCNKCCKKCLCVPPGYYGNKAVCPCYNNWKTKEGGPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20464 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9001 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23297 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147015 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12065 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 81 1e-17 >Cs31373 Length = 293 Score = 81.3 bits (199), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 36/60 (60%), Positives = 47/60 (78%) Query: 5 KKPRVVWSVELHQQFVTAVNQLGLDKAVPKRILEMMNVPGLTRENVASHLQKFRLYLKRL 64 +K +V W+ ELH++FV AV QLG+DKAVP RILE+M + LTR N+ASHLQK+R + K L Sbjct: 84 RKMKVDWTPELHRRFVQAVEQLGVDKAVPSRILELMGIDCLTRHNIASHLQKYRSHRKHL 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20463 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279518 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20450 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 302 1e-84 >Cs46148 Length = 148 Score = 302 bits (773), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 144/148 (97%), Positives = 146/148 (98%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 PEIAHMYK+D+ KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYEATARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263392 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6519 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2426 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18072 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24889 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93789 359 e-101 >Cs93789 Length = 294 Score = 359 bits (922), Expect = e-101, Method: Compositional matrix adjust. Identities = 173/248 (69%), Positives = 201/248 (81%), Gaps = 1/248 (0%) Query: 54 MHCHGWRSVYCMPKRPAFKGSAPINLSDRLHQVLRWALGSVEILLSRHCPIWYGYGCGLK 113 MH GWRS+YCMPKRPAFKGSAPINLSDRL+QVLRWALGSVEIL SRHCPIWYGYG LK Sbjct: 1 MHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLK 60 Query: 114 WLERFSYINSVVYPLTSIPLLAYCSLPAVCLLTGKFIVPEISNYASILFMALFLSIAATS 173 +LERF+Y+N+ +YPLT+IPLL YC+LPAVCLLT KFI+P+ISN ASI+F++LFLSI AT Sbjct: 61 FLERFAYVNTTIYPLTAIPLLMYCTLPAVCLLTNKFIMPQISNLASIVFISLFLSIFATG 120 Query: 174 ILEMQWGHVGIHDWWRNEQFWVIGGASSHFFALIQGLLKVLGGVNTNFTVTSKAAD-DGE 232 ILEM+W VGI +WWRNEQFWVIGG SSH FA+ QGLLKVL G++TNFTVTSKA+D DG+ Sbjct: 121 ILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFAVFQGLLKVLAGIDTNFTVTSKASDEDGD 180 Query: 233 FSDLYLFKWTXXXXXXXXXXXXXXXXXXXXXSDAINNGYQTWGPPFGTLFPATWVILHLY 292 F++LY+FKWT S AIN+GYQ+WGP FG LF A WVI+HLY Sbjct: 181 FTELYMFKWTTLLIPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLY 240 Query: 293 PSPKGLVG 300 P KGL+G Sbjct: 241 PFLKGLMG 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24501 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16036 (366 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750975 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44142 121 5e-30 >Cs44142 Length = 180 Score = 121 bits (304), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 57/104 (54%), Positives = 74/104 (71%) Query: 111 MIAARALSIVWADTPQYWKWISIPDSRFEEVAELVDVCWLEIHGRIETRMLSPSTLYKAY 170 MI+AR L I+W+ T YW+WISIP++RF EVAEL+ VCWLEI G+I TR LSP TLY AY Sbjct: 1 MISARDLLIIWSSTSAYWRWISIPEARFPEVAELIRVCWLEIRGKISTRSLSPGTLYTAY 60 Query: 171 LVFKTTAQAYGFEHRAAEVTVCLIGEQRTNQNVFLGARRVQTRG 214 LV+K TA +YGFE++ V+V L+ + Q V+L R +G Sbjct: 61 LVYKLTAGSYGFEYQPVSVSVGLVNGETQTQTVYLHEERGLRQG 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783651 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23338 (512 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91045015 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743793 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9842 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15008 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59461 302 2e-84 >Cs59461 Length = 248 Score = 302 bits (774), Expect = 2e-84, Method: Compositional matrix adjust. Identities = 153/220 (69%), Positives = 176/220 (80%), Gaps = 3/220 (1%) Query: 1 MAS-ASPMASQLKSNFTSPITTRPALLSPKGLSASPLKLFPSKRLSSFSIKAVQSDKQNF 59 MAS +SPMASQLKS+FTSP++ +LL+P+G+S SP ++ PSKR F +KA+QS+K + Sbjct: 1 MASVSSPMASQLKSSFTSPVSR--SLLTPRGISGSPFRVVPSKRSPRFIVKAIQSEKPTY 58 Query: 60 QVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGPF 119 QVIQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSPLLRG+EVGLAHGFLLVGPF Sbjct: 59 QVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPLLRGVEVGLAHGFLLVGPF 118 Query: 120 VKTGPLRNTPYXXXXXXXXXXXXVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEPD 179 VK GPLRNT VVIL++CLTIYGI+SF EGEPS+AP LTLTGRKKEPD Sbjct: 119 VKAGPLRNTEIAGPAGSLAAGGLVVILSICLTIYGIASFNEGEPSTAPGLTLTGRKKEPD 178 Query: 180 QLQTAEGWSKXXXXXXXXXISGVTWAYFLLYVVNLPYFFK 219 QLQTA+GW+K ISGV WAYFLLYV+N Y F Sbjct: 179 QLQTADGWAKFTGGFFFGGISGVIWAYFLLYVLNXXYSFN 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15454 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48262700 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8371 (374 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 65 1e-12 >Cs36939 Length = 275 Score = 64.7 bits (156), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 26/40 (65%), Positives = 32/40 (80%) Query: 109 LILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLSKKL 148 +I+ L LLGNRW+ IA +P RTDN+IKNYWNTHL KK+ Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKV 40 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6945 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7236 (346 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs132106182 90 3e-20 >Cs132106182 Length = 183 Score = 90.1 bits (222), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 53/132 (40%), Positives = 69/132 (52%), Gaps = 16/132 (12%) Query: 231 KPPLLKRMIEDCDGCYFMSALRSFKRRVVYSNVGYDHIVGWKTSCIRRNSELPKWENTVD 290 KPPLL RM DC+ F+SAL +F+ R+VY+NV YDH+VGW+TS IRR +EL K Sbjct: 7 KPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSL 66 Query: 291 EKYPHIVYEEHC---------------KAYDAEQCEP-AXXXXXXXXXXXXXXXXXXXXX 334 + Y H+V E+C KA +A Q EP A Sbjct: 67 DGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRL 126 Query: 335 XWEKIDVSFHSS 346 W+K+DVSFHS+ Sbjct: 127 GWKKVDVSFHSA 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418713 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9355 (475 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18180 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601413 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27745 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283987 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6570 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7083 (374 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7180 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs72108 351 3e-99 >Cs72108 Length = 189 Score = 351 bits (901), Expect = 3e-99, Method: Compositional matrix adjust. Identities = 171/199 (85%), Positives = 181/199 (90%), Gaps = 10/199 (5%) Query: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 MSFIGTQQKCK CEKTVYPVE+LSADGI YHKSCFKC+HCKGTLKLSNYSSMEGVLYCKP Sbjct: 1 MSFIGTQQKCKVCEKTVYPVEQLSADGIVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK 120 HFEQLFKE+GNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQ+KCA+C KT YPLEK Sbjct: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEK 120 Query: 121 VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK 180 V VE+QAYHK+CFKCSHGGC I+PSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSAS+K Sbjct: 121 VAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASMK 180 Query: 181 RTXXXXXXXXXTVASIPEA 199 R AS+PEA Sbjct: 181 R----------AAASVPEA 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31401 (310 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64106189 96 4e-22 >Cs64106189 Length = 288 Score = 96.3 bits (238), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 72/232 (31%), Positives = 113/232 (48%), Gaps = 11/232 (4%) Query: 19 VHPLVLLSIVDNYNRVAKDSRKRVVGVLLGSSFK-GTVDVTNSYAVPFEEDDKDPSIWFL 77 VHPLV+ +I D Y R D +RV+G LLGS GTVD+ NSY VP E + L Sbjct: 25 VHPLVIFNISDCYVR-RPDQAERVIGTLLGSVLPDGTVDIRNSYVVPHNEFSDQVA---L 80 Query: 78 DHNYHEAMYSMAKRINAKEHVVGWYSTGPKLRENDLDIHGLFYDYVPNPVLVIIDVQPKE 137 D YH M ++N +E +VGW+STG + IH + VPNPV + +D + Sbjct: 81 DIEYHHTMLKSHLKVNPQEVIVGWFSTGLGVTGGSALIHEFYCREVPNPVHLTVDTGFRN 140 Query: 138 LGIPTKAYCAVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLAT 197 KAY +V + +Q F +P ++ E E +G + L K T++ L + Sbjct: 141 GEGTVKAYVSVNLSLGDRQLAAQ--FQEIPLDLRMIEAERVGFDIL----KSTSVDKLPS 194 Query: 198 EVTGKLTGLKGLEARLKEIRGYLDLVIDGKLPLNHEILYHLQDVFNLLPNLN 249 ++ G ++ L + +I Y+D ++G ++ + L + LP L+ Sbjct: 195 DLEGMEVLMERLLTLINDIYKYVDDTVEGHAVPDNSVGRILSETVASLPKLS 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23254 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 374 e-106 >Cs36106190 Length = 283 Score = 374 bits (959), Expect = e-106, Method: Compositional matrix adjust. Identities = 184/263 (69%), Positives = 205/263 (77%), Gaps = 1/263 (0%) Query: 26 QTQDEGKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIATFLFLYITILTVMGVVKSKSKC 85 GKDY +PPPAPL + EL WSFYRA IAEF+AT LFLY+++ TV+G K C Sbjct: 12 HRHHHGKDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDAC 71 Query: 86 TTVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQTLG 145 VG+ GIAWAFGG IF LVY TAGISGGHINPAVTFGLFLARK+SL RAV Y+V Q LG Sbjct: 72 GGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLG 131 Query: 146 AIAGAAVVKGFEKSSTFELLGGGANSVNHGYTKGQGLGAEIIGTFVLVYTVFSATDAKRS 205 AI G +VK F K + LGGGAN+V GY KG LGAEIIGTFVLVYTVFSATD KRS Sbjct: 132 AICGVGLVKAFMKHE-YNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRS 190 Query: 206 ARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPARSLGAAIIYNKRHAWDDHWIFWVG 265 ARDSHVP+LAPLPIGFAVF+VHLATIP+TGTGINPARS GAA+IYN AWDDHWIFWVG Sbjct: 191 ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVG 250 Query: 266 PFIGAALAALYHVVVIRAIPFKS 288 PF+GA AA YH ++RA K+ Sbjct: 251 PFVGALAAAAYHQYILRAAAIKA 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6839 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 376 e-106 >Cs36106190 Length = 283 Score = 376 bits (965), Expect = e-106, Method: Compositional matrix adjust. Identities = 185/263 (70%), Positives = 206/263 (78%), Gaps = 1/263 (0%) Query: 26 QSQDDGKDYKEPPPAPLFEPGELTSWSFYRAGIAEFIATFLFLYITILTVMGVVKSKSKC 85 GKDY +PPPAPL + EL WSFYRA IAEF+AT LFLY+++ TV+G K C Sbjct: 12 HRHHHGKDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIGHKKQSDAC 71 Query: 86 TTVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQTLG 145 VG+ GIAWAFGG IF LVY TAGISGGHINPAVTFGLFLARK+SL RAV Y+V Q LG Sbjct: 72 GGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVAYMVAQCLG 131 Query: 146 AIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQGLGAEIIGTFVLVYTVFSATDAKRS 205 AI G +VK F K + LGGGAN+VA GY KG LGAEIIGTFVLVYTVFSATD KRS Sbjct: 132 AICGVGLVKAFMKHE-YNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTVFSATDPKRS 190 Query: 206 ARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPARSLGAAIIYNKKHAWDDHWIFWVG 265 ARDSHVP+LAPLPIGFAVF+VHLATIP+TGTGINPARS GAA+IYN AWDDHWIFWVG Sbjct: 191 ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAWDDHWIFWVG 250 Query: 266 PFIGAALAALYHVVVIRAIPFKS 288 PF+GA AA YH ++RA K+ Sbjct: 251 PFVGALAAAAYHQYILRAAAIKA 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51237933 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs162106182 123 5e-31 >Cs162106182 Length = 107 Score = 123 bits (309), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 67/103 (65%), Positives = 80/103 (77%) Query: 16 MALTKVKNIVNSNPVVVFSKTYCGYCKRVKQLLTQLGATFKVIELDEGIDGGEMQAALAQ 75 MAL K + V+SN VVVFSKT C +C VK+L QLG TFK IELD+ DG ++Q+ALA+ Sbjct: 1 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAE 60 Query: 76 WTGQTTVPSVFIGGKHVGGCDSVLEKHNAGQLVPLLTEAGALA 118 WTGQ TVP+VFIGGKH+GGCDS H G+LVPLLTEAGA+A Sbjct: 61 WTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVA 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28629 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48016 257 9e-71 >Cs48016 Length = 254 Score = 257 bits (657), Expect = 9e-71, Method: Compositional matrix adjust. Identities = 119/182 (65%), Positives = 145/182 (79%), Gaps = 2/182 (1%) Query: 53 LSVDFLGKPMTLSDHKGLENCRVRKPSNFSVHAQASVCISRAMRWWEKTLHPNMVEIHSA 112 L+ DF G + ++K + + S FS+ AQ + I +A RWWEK L PNM E+ SA Sbjct: 14 LTSDFHGHGVVFQENKAIP--KRGSSSKFSISAQTGLRIGKAQRWWEKGLQPNMREVASA 71 Query: 113 QELVDSLKNAGDRLVVVDFYSPGCGGCRALHPKICQLAESNPNAIFLKVNYEEHKTMCHA 172 Q+LV+SL +AGD+LVVVDF+SPGCGGC+ALHPKICQLAE NP+ FL+VNYEEHK+MC++ Sbjct: 72 QDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEEHKSMCYS 131 Query: 173 LNIHVLPFFRFYRGADGRVCSFSCTNATIKKFKDALAKHGSDRCNLGPAKGLDESEILKL 232 LN+HVLPFFRFYRGA GR+CSFSCTNATIKKFKDALAKH DRC LGP KGL+E E+L L Sbjct: 132 LNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRCGLGPTKGLEEKELLAL 191 Query: 233 AS 234 A+ Sbjct: 192 AA 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22077 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14587 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31573 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 112 2e-27 >Cs25776 Length = 104 Score = 112 bits (280), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 54/93 (58%), Positives = 60/93 (64%) Query: 65 MAPEVLRNEPSDEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQHRRXXXXXXXX 124 MAPE LR EPS+EK DVYS+GVILWEL TMQQPW G++P QVVGAV FQ+RR Sbjct: 1 MAPEFLRGEPSNEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQNTS 60 Query: 125 XXXXXXXRKCWQTDPKLRPSFAEIMAILKPLQK 157 CW DP RPSFA I+ LK L K Sbjct: 61 PVLASLMESCWADDPAQRPSFANIVESLKKLLK 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20380 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9938 (492 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6257 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121299 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25959 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55768772 (77 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 102 6e-25 >Cs81333 Length = 370 Score = 102 bits (255), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 50/71 (70%), Positives = 54/71 (76%) Query: 7 QDVQWLQTITSLPILVKGVLTAEDXXXXXXXXXXXXXXSNHGARQLDYVPSTIMALEKVV 66 +DV+WLQTIT LPILVKGVLTAED SNHGARQLDYVP+TIMALE+VV Sbjct: 215 KDVKWLQTITKLPILVKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVV 274 Query: 67 KAAQGRIPCFL 77 KA QGRIP FL Sbjct: 275 KATQGRIPVFL 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12111 (588 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95758 127 4e-31 >Cs95758 Length = 103 Score = 127 bits (318), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 57/80 (71%), Positives = 67/80 (83%), Gaps = 1/80 (1%) Query: 374 NSGSDLYYPSINSEDRPFAVDFYYHSHIEYRWGGEGLRKTLLRWATSVNDKKTGS-EAIV 432 + GSDLYY ++NSED PF VDFYYHSHIEYRWGGEGLRKTL+RWA+ V DKK S E ++ Sbjct: 3 SGGSDLYYSTLNSEDGPFVVDFYYHSHIEYRWGGEGLRKTLVRWASQVTDKKAESGEKVL 62 Query: 433 SAADQLSTDYCYAFKVQAPG 452 + A+QLST+YCYAF VQ PG Sbjct: 63 TPAEQLSTNYCYAFSVQKPG 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226782354 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32000 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12644 65 4e-13 >Cs12644 Length = 127 Score = 64.7 bits (156), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 37/109 (33%), Positives = 57/109 (52%) Query: 35 VTGIHSARELETXXXXXXXXXXXXILYFTATWCGPCRFISPLYTSLAGKYKKVVFLKVDI 94 V + S ET +++FTA WC P ++PL+ LA Y V+FL VD+ Sbjct: 14 VVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPDVLFLSVDV 73 Query: 95 DEARDVAANWNISGVPAFFFVRNGKEVDKMVGADKAALERKIAQHAGSI 143 D+ +DVA+ + +P F +R G VDK+VGA+ + ++I SI Sbjct: 74 DDVKDVASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSI 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9071 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29838 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11853 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7031 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226786909 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74790 110 4e-27 >Cs74790 Length = 135 Score = 110 bits (276), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 59/102 (57%), Positives = 65/102 (63%), Gaps = 3/102 (2%) Query: 20 HKPSAGAPSSTVLALPSLARKGRVSCSME---GKKESNSNMAKGGXXXXXXXXXXXXXXX 76 HKPS A SS VL LP+ A KG+V CSME K+ES +N+ Sbjct: 20 HKPSIVASSSPVLGLPAKAVKGKVRCSMEEKPSKQESKTNVGMSASLLAAACAATMSSPA 79 Query: 77 XXLVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFIY 118 LVDDR+STEGTGLPFGLSNNLLGWIL GVFGLIWALY Y Sbjct: 80 MALVDDRMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIPY 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5682 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 242 3e-66 >Cs101477 Length = 242 Score = 242 bits (617), Expect = 3e-66, Method: Compositional matrix adjust. Identities = 132/216 (61%), Positives = 148/216 (68%), Gaps = 23/216 (10%) Query: 31 KRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSAXXXXXXXXXXXXLDFRAS 90 KRGF A T VDLKLNLS T +GG D D Sbjct: 39 KRGF----------ADTVVDLKLNLS-----TKESGGIDVIEKTKGKSASATGATDLSKP 83 Query: 91 DXXXXXXXXXQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAP 150 QVVGWPPVRSFRKN+ AVQK +G+++ + S+N A VKVSMDGAP Sbjct: 84 ------PAKSQVVGWPPVRSFRKNIM-AVQKDNEEGDNKASSSSSSNVA-FVKVSMDGAP 135 Query: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYQ 210 YLRKVDLK+YKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNE KL+D+LNGSDY+PTY+ Sbjct: 136 YLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE 195 Query: 211 DKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 DKDGDWMLVGDVPW+MFV+SCKRLRIMK EA+GL Sbjct: 196 DKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLA 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5936 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58068 204 6e-55 >Cs58068 Length = 194 Score = 204 bits (518), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 112/191 (58%), Positives = 130/191 (68%), Gaps = 35/191 (18%) Query: 6 NFKATELRLGLPGSSEEPENKKAAPSPPMAKNNKRASPDSAAEECSTSS-------DPID 58 + KATELRLGLPGS ++P + A NNKRAS + + E S S D D Sbjct: 11 HLKATELRLGLPGS-DKPSVR--------ANNNKRASSEISQESKSNSCAFNAGDDDERD 61 Query: 59 -VPPTKTQVVGWPPIRSYRKNSLQL----------REAYVKVSVDGAPYLRKIDLKVYNS 107 PP K QVVGWPPIRSYRKN+LQ+ R YVKVS+DGAPYLRKIDLKVY Sbjct: 62 SAPPAKAQVVGWPPIRSYRKNTLQVQAKTSESELCRGMYVKVSMDGAPYLRKIDLKVYTC 121 Query: 108 YPELIKALEKMFNLA--------NINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLR 159 YPEL+ ALE MF L NGSD+APTYEDKDGDWMLVGDVPW+MF+++CKRLR Sbjct: 122 YPELLNALENMFQLTIGKYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWDMFITTCKRLR 181 Query: 160 IMKGSEARGLS 170 IM+GSEA+GL+ Sbjct: 182 IMRGSEAKGLA 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18903 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9966 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5588 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27904 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95552 113 1e-27 >Cs95552 Length = 262 Score = 113 bits (283), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 79/198 (39%), Positives = 94/198 (47%), Gaps = 12/198 (6%) Query: 2 KKMKGVVSDA----------VEDQRTRFKHQSLMQDYEEXXXXXXXXXXXXXXXXXXXST 51 KKMKGV + +D R R +HQSL QDYEE T Sbjct: 4 KKMKGVAASVEIAPAPACSVYDDPRVRLRHQSLKQDYEELLKEMEAKKKKLQMMKQKKLT 63 Query: 52 LVAEVRFLRRRYNYLMGNQSTHTRPKQDVVKTHNLDT-QRVTYLXXXXXXXXXXXXRCPL 110 L +EVRFLRRR+ YL N+ + + Q+ VK R R PL Sbjct: 64 LQSEVRFLRRRHQYLTANKPSTSTMGQNSVKAQQKPIPSRKMAKERNYGRKAAALCRPPL 123 Query: 111 PALDLNKKEKVKHGMEDIVRKPPPKFDLNLNARALGGKEATLRTPTPNFDLNKKERVQSG 170 DLNKK K + E +R P P FDLN +A GKE+T P DLN+KERV S Sbjct: 124 -GFDLNKKGKAYNEKEATLRNPIPVFDLNQKLKAYNGKESTSLHSLPVLDLNQKERVYSR 182 Query: 171 KDTAKRKSTPVFDLNQIS 188 KD A + TPVFDLNQIS Sbjct: 183 KDAAIQNMTPVFDLNQIS 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814098 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6322 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7295 (679 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12743 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274494 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263551 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2557 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93807 227 9e-62 >Cs93807 Length = 194 Score = 227 bits (578), Expect = 9e-62, Method: Compositional matrix adjust. Identities = 105/137 (76%), Positives = 122/137 (89%) Query: 27 DLPFIVAHKKASLNRLKSGVERVLVSIDIYNQGSSTAYDVSLSDDSWPQDIFEVVSGNTS 86 D+PFIVAHKKASL RLKSG ERV VS+DIYNQG+STAYDVSL+DDSWPQD F+V+SGN S Sbjct: 27 DVPFIVAHKKASLKRLKSGAERVSVSVDIYNQGTSTAYDVSLTDDSWPQDKFDVISGNIS 86 Query: 87 KSWERLDAGAIISHSFELEAKEKLLFNGAPALITFRIPTKAALQESYSTPIFPLDVLADR 146 +SWERLDAG I+SHSFEL+AK K +F+G+PALITFRIPTKAALQE+YSTP+ PLDVLA++ Sbjct: 87 QSWERLDAGGILSHSFELDAKVKGMFHGSPALITFRIPTKAALQEAYSTPMLPLDVLAEK 146 Query: 147 PPEKKFQWVKRFLAKYG 163 P E K + KR LAKYG Sbjct: 147 PTENKLELAKRLLAKYG 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24866 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14336 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51095885 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19309 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20162 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28141 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs143106181 70 1e-14 >Cs143106181 Length = 380 Score = 70.1 bits (170), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 30/71 (42%), Positives = 48/71 (67%) Query: 101 VTRPRPVYLVNFSCYKPEESRKCTKKIFMEQSQMTGTFTEDNLQFQRRILERSGLGDSTY 160 ++RPR VYLV+F+CY+P + K T++ F+E + E +L FQRRI++ SG+GD TY Sbjct: 1 MSRPRSVYLVDFACYRPSDDLKVTREQFIEVAGKWSKSDEASLDFQRRIMKSSGIGDETY 60 Query: 161 LPEAGLNIPPN 171 +P+ ++ N Sbjct: 61 IPKVVMSAEEN 71 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10364 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65961 94 1e-21 >Cs65961 Length = 210 Score = 93.6 bits (231), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 66/199 (33%), Positives = 100/199 (50%), Gaps = 14/199 (7%) Query: 4 PNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIR 63 +QQ DY FKL+++GD G GK++ + + FE+ PTIGV+ K++ Sbjct: 6 ASQQEFDYL-FKLLMIGDSGVGKSSLLLSFTSDNFEE-LSPTIGVDFKVKYVDVGGKKLK 63 Query: 64 FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVP-TWHR--DLCRVCENIPI 120 WDTAGQE+F L YY Q I+++DVT R T+ N+ W + DL ++ Sbjct: 64 LAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIK 123 Query: 121 VLCGNKVDVKNRQVKAKQ--VTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLH 178 +L GNKVD ++ +V K+ + F R+ + E SAK+ N ++ F L K+ +L Sbjct: 124 LLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLL 183 Query: 179 FVESPAL-------APPEV 190 S L PPE Sbjct: 184 AEGSKGLKKNIFKQKPPEA 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26030 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99914 169 3e-44 >Cs99914 Length = 157 Score = 169 bits (428), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 2/144 (1%) Query: 6 SSSLSIGEKICAAFIPFVAMVEALVFAVSGCCSHRSRRPINRGFACGYMSHLADETRFTV 65 SSSL IG K+C+AF PF+ VE L+F+++GC H P + + LA+ + FT+ Sbjct: 12 SSSLQIGSKLCSAFSPFIGFVEDLIFSLTGCFDHHC--PPKLRYTFNDLVRLANNSPFTI 69 Query: 66 NELEALYELFKKLSSSIIDDGSIHKEELQLALFQTPQGENLFLDRVFDLFDEKKNGVIEF 125 NE+EALYELFK+LSSS+IDDG IHKEEL+LAL +T GENLF DRVFDLFDEKKNGVIE Sbjct: 70 NEVEALYELFKELSSSLIDDGLIHKEELRLALLKTTSGENLFPDRVFDLFDEKKNGVIEI 129 Query: 126 DEFVHALNIFHPYAPIDDKIDFAF 149 +EFV AL+IFHP P++ ++ F Sbjct: 130 EEFVRALSIFHPSTPLEGQMTLHF 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24831 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs5901 231 9e-63 >Cs5901 Length = 407 Score = 231 bits (589), Expect = 9e-63, Method: Compositional matrix adjust. Identities = 111/276 (40%), Positives = 165/276 (59%), Gaps = 6/276 (2%) Query: 42 TVGICASSVVVYGYPCQEFEVTTQDGYILSLQRIPEXXXXXXXXXXXXIKKPPVLIQHGV 101 T +C+ + GYPC E V T+DGY+L+LQR+ PPVL+ HG+ Sbjct: 41 TRSLCSHLIRPNGYPCTEHTVQTKDGYLLALQRVSSRNGNLRVQC-----GPPVLLVHGL 95 Query: 102 LVDGVTWLLNSPDRNLPLILADNGFDVWIANTRGTRFSRQHTSMDPDDPKFWNWSWDELV 161 + G W L+S + +L ILAD+GFDVW+AN RGT +S H ++ FW+WSW +L Sbjct: 96 FMGGDAWFLDSTEESLGFILADHGFDVWVANVRGTHWSHGHVTLSEKSKGFWDWSWQDLA 155 Query: 162 AFDLPAVFDFVYGKAGQKINYVGHSQGTLIVLASLSEGKLVDQMKSAALLSPIAYLSHMK 221 +DL + F+ K KI VGHSQGT++ LA+L++ +V+ +++AALLSPI+YL H+ Sbjct: 156 LYDLAEMICFINLKTSSKIFLVGHSQGTIVSLAALTQPDVVEMVEAAALLSPISYLDHIT 215 Query: 222 TALGVAAAKTFVGEITTLFGLAEFNPKGDPETQYLDALCAYPGVDCYDLLQAVTGKNCCL 281 L + ++ G+ + N + + +D+LC +DC DLL A+TGKNCC Sbjct: 216 APLVRRMVSMHLDQMVLALGIHQLNFRSNVLIDLIDSLCD-GHLDCNDLLTAITGKNCCF 274 Query: 282 NSSTIDLFLENEPQSTSTKNMVHLAQTVRGGKLAKY 317 N+S +D +LENEP +S KN+ HL Q +R G ++Y Sbjct: 275 NNSRVDFYLENEPHPSSAKNIHHLFQMIRQGTFSQY 310 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487983 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29853 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5564 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30951 70 1e-14 >Cs30951 Length = 59 Score = 70.1 bits (170), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 31/44 (70%), Positives = 38/44 (86%) Query: 13 NKGLLQSDELYQYILETSVYPREPEPLKELRAATASHPRAALAT 56 +KGLLQS++LY+YILETSVYPREPEPLK++R TA HP A + T Sbjct: 16 SKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGT 59 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10437 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3021 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8738 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39205 322 2e-90 >Cs39205 Length = 206 Score = 322 bits (825), Expect = 2e-90, Method: Compositional matrix adjust. Identities = 146/199 (73%), Positives = 169/199 (84%) Query: 50 MGKGQVWINGQSIGRYWMAYAKGDCSSCSYIGTFRPTKCQLHCGRPTQRWYHVPRSWLKP 109 MGKGQVWINGQSIGRYWMAYAKGDC +CSY GTFRP CQ CG PTQRWYHVPRSWLKP Sbjct: 1 MGKGQVWINGQSIGRYWMAYAKGDCKTCSYAGTFRPINCQRRCGHPTQRWYHVPRSWLKP 60 Query: 110 TQNLVVVFEELGGDPSKITLVRRSVTGVCGDLHENHPNAENFDVEGNEDSKTLHQAQVHL 169 T+NL+VVFEELGGD S+I+LV+RSV VC D HE+HP +N+D+E +S + A+V L Sbjct: 61 TKNLLVVFEELGGDASRISLVKRSVARVCADAHEHHPTTDNYDIENKGNSNSTGNAKVLL 120 Query: 170 HCAPGQSISSIKFASFGTPSGTCGSFQQGTCHATNSHAVVEKNCIGRESCSVAVSNSAFE 229 CAPGQSI+SI+FASFGTPSGTCGSFQ+GTCHA NSHA++EK CIG+ESCS+ +S+ F Sbjct: 121 QCAPGQSITSIEFASFGTPSGTCGSFQKGTCHAPNSHAMLEKECIGQESCSIFISSGVFG 180 Query: 230 TDPCPNVLKRLSVEAVCST 248 DPCPNVLKRLSV+AVCST Sbjct: 181 KDPCPNVLKRLSVQAVCST 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612315 (5 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25680 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922057 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819131 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12866 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41088 272 2e-75 >Cs41088 Length = 299 Score = 272 bits (696), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 136/188 (72%), Positives = 149/188 (79%) Query: 1 MSSRSSRTIYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADD 60 MSSR+SRT+YVGNLPGDIR REVEDLF KYGPI IDLKIPPRPPGYAFVE+E+ RDA+D Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEEARDAED 60 Query: 61 AIYGRDGYDFDGFRLRVELAXXXXXXXXXXXXXXXXXXXXXXXXXXXDYRVLVTGLPPAA 120 AI GRDGYDFDG RLRVELA +YRVLVTGLP +A Sbjct: 61 AIRGRDGYDFDGHRLRVELAHGGRGRSSSDRHSSHSSGRGRGVSRRSEYRVLVTGLPSSA 120 Query: 121 SWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTNYEDMKYAIRKLDDSEFRNAFARSYI 180 SWQDLKDHMRRAGDVCFSQVFRD G TGIVDYTNY+DMK+AI+KLDDSEFRNAF+R+Y+ Sbjct: 121 SWQDLKDHMRRAGDVCFSQVFRDGSGTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYV 180 Query: 181 RVREYDSR 188 RVREYD R Sbjct: 181 RVREYDHR 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591577 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25121 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6749 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7864 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8054 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6913 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9656 (171 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 144 6e-37 >Cs60106184 Length = 168 Score = 144 bits (363), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 68/85 (80%), Positives = 76/85 (89%) Query: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 MAS ++EFRCFVGGLAWAT + +L AF YG+I+ESKIINDRETGRSRGFGFVTF E+ Sbjct: 1 MASGDVEFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEK 60 Query: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQNLDGRNITVNEAQ Sbjct: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25486 (460 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14063 (580 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7708 96 7e-22 >Cs7708 Length = 215 Score = 96.3 bits (238), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 62/221 (28%), Positives = 110/221 (49%), Gaps = 32/221 (14%) Query: 70 SLKEPLKVMISGAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNA 129 ++K+P V + G P SGKGTQC IV FG H+S GDLLRAE+ SG+E G + + Sbjct: 17 TVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKE 76 Query: 130 GRLVPDEVVTAMVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQKL-KIIPDVYIVLDVPD 188 G++VP EV ++ + +++ +L+DG+PR+ + + + KI P+ + D + Sbjct: 77 GKIVPSEVTIKLLQKAM--EESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSE 134 Query: 189 ETLIDRCVGRRLDPVTGKIYHIKSFPPENQEIKARLITRPDDTEEKVKSRLEIYKKNADS 248 E + R + R NQ R DD E ++ R +++ +++ Sbjct: 135 EEMERRILNR------------------NQ-------GREDDNVETIRKRFKVFLESSLP 169 Query: 249 ISAAYS--NIMKKIDGNHSKDVVFEVIDSILSQVQKDKEMK 287 + Y ++KID VF+ + ++ + KD+++K Sbjct: 170 VVQYYEAKGKVRKIDAAKPVAEVFDAVKAVFT--PKDEKVK 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11077 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106190 543 e-156 >Cs169106190 Length = 361 Score = 543 bits (1399), Expect = e-156, Method: Compositional matrix adjust. Identities = 255/317 (80%), Positives = 280/317 (88%) Query: 1 MEEQVVQVLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYT 60 E V+QV+G + H LSFARFA RYGK YESVEEMKLR+ F +N LIRSTN KGLSY Sbjct: 45 FETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYR 104 Query: 61 LAVNRFADWSWEEFARHRLGAAQNCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGH 120 L +N+FADWSWEEF RHRLGAAQNCSATTKGNHKLT VLPE+K+W+E GIV+PVKDQGH Sbjct: 105 LGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLTADVLPETKDWRESGIVSPVKDQGH 164 Query: 121 CGSCWTFSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFNNNGCNGGLPSQAFEYIKYNG 180 CGSCWTFSTTG+LEAAY QAFGK ISLSEQQLVDCA FNN GCNGGLPSQAFEYIKYNG Sbjct: 165 CGSCWTFSTTGSLEAAYHQAFGKGISLSEQQLVDCAQAFNNQGCNGGLPSQAFEYIKYNG 224 Query: 181 GLDTEAAYPYVGVDGACKFSSENVGVQVVDSVNITLGAEEELKHAVAFVRPVSVAFQVVQ 240 GLDTE AYPY G DG CKFSSENVGVQV+DSVNITLGAE+EL+HAV VRPVSVAF+VV Sbjct: 225 GLDTEEAYPYTGKDGVCKFSSENVGVQVLDSVNITLGAEDELQHAVGLVRPVSVAFEVVD 284 Query: 241 SFRFYKSGVYTSDTCGSSSMDVNHAVLAVGYGVEDGVPFWLIKNSWGQSWGDNGYFKMEY 300 FRFYKSGVY+S CG++ MDVNHAV+AVGYGVEDGVP+WLIKNSWG++WGD+GYFKME Sbjct: 285 GFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEM 344 Query: 301 GKNMCGVATCASYPVVA 317 GKNMCG+ATCASYPVVA Sbjct: 345 GKNMCGIATCASYPVVA 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16441 (288 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754158 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12583 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76629 222 4e-60 >Cs76629 Length = 283 Score = 222 bits (565), Expect = 4e-60, Method: Compositional matrix adjust. Identities = 146/305 (47%), Positives = 176/305 (57%), Gaps = 47/305 (15%) Query: 1 MSSSSETAEVSGQRGMRTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQSNGG 60 M+SSSE + + EK S+F+QTCS+L QYLKE GSFGDL+L + N ++NG Sbjct: 1 MASSSEMS-------VNLPEK-SSFSQTCSLLSQYLKEGGSFGDLSLGISSN--IEANG- 49 Query: 61 TPEMFRQ-KAPPMNFFPFVENS------RNMPTAVRDFKSMDLFPQQAGFGPSAPTPREE 113 PE+ R+ A MN FP +NS RNM A R+++SM+LFPQQAGF P + + Sbjct: 50 VPEIPRRPAATTMNLFPVSDNSGQDVSVRNM-VAPRNWESMNLFPQQAGFAP-----KND 103 Query: 114 VPMTADSSVKKSAPGEPQKAQMTIFYGGQVIVFNDFPADKAKEVMLLASKESSQSHTAPA 173 P DSS+ K AP Q AQMTIFYGGQVI FNDFPADKA E+M LAS SS SH Sbjct: 104 TPNMIDSSLNKPAP---QTAQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSLSHGTAY 160 Query: 174 SP---PAKTNNAFASHLGKXXXXX---------------XXXXXXXXXMFPNFGNQAIQE 215 P PA+ N+FA+ L K PNFGN I E Sbjct: 161 PPMQLPAQGYNSFAASLPKSPVESTPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPE 220 Query: 216 GVKPSPRPVVCDLPIARKASLHRFLEKRKDRLNTLAPYQTXXXXXXXXKPTENKSWLGLA 275 +P RP CDLPIAR+ SLHRFLEKRKDR+ APYQ KP ++KSWLGLA Sbjct: 221 CAQPPSRP--CDLPIARRNSLHRFLEKRKDRIVARAPYQVNGSAGAPDKPADSKSWLGLA 278 Query: 276 AQQTQ 280 AQ +Q Sbjct: 279 AQTSQ 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2805 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2685 (53 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21182 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389866 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595856 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265189 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3052 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101205 121 8e-30 >Cs101205 Length = 220 Score = 121 bits (304), Expect = 8e-30, Method: Compositional matrix adjust. Identities = 67/196 (34%), Positives = 105/196 (53%), Gaps = 15/196 (7%) Query: 93 HESVVGDVSWHPKNENLFGSVGDDCQLMIWDLR--TNQTQHCVKAHEKEVNYLSFNPYNE 150 HE V DV++ P + F SVGDD L++WD R T+ KAH+ +++ + +NP ++ Sbjct: 1 HEDTVEDVTFCPSSAQEFCSVGDDSCLILWDARVGTSPVIKVEKAHDADLHCVDWNPLDD 60 Query: 151 WILATASSDTTVGLFDMRNLTV-----PLHVLSTHGEEVFQVEWDPSHETVLASYADDRR 205 ++ T S+D +V +FD RNLT P++ H V V+W P +V S A+D Sbjct: 61 NLILTGSADNSVRMFDRRNLTSNGVGSPINKFEGHSAAVLCVQWSPDKSSVFGSSAEDGL 120 Query: 206 LMVWDLNRIXXXXXXXXXXXXX-XXLLFVHGGHKAKISDFSWNKNEPWVISSVSED---- 260 L +WD ++ L F H GH+ K+ DF WN ++PW + SVS+D Sbjct: 121 LNIWDYEKVGKKVEQGPRTTNYPAGLFFQHAGHRDKVVDFHWNASDPWTVVSVSDDCDST 180 Query: 261 ---NTLQVWQIADSIF 273 TLQ+W+++D I+ Sbjct: 181 GGGGTLQIWRMSDLIY 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13812 (394 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32343 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10663 (212 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76629 66 2e-13 >Cs76629 Length = 283 Score = 66.2 bits (160), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 58/192 (30%), Positives = 84/192 (43%), Gaps = 37/192 (19%) Query: 8 GCDVKVKLSEMEEEMVAQNK-PNQTEDDLQNTSARKVPSALNITGPAPAQLTIFYAGSVS 66 G DV V+ + N P Q +N + + S+LN P AQ+TIFY G V Sbjct: 72 GQDVSVRNMVAPRNWESMNLFPQQAGFAPKNDTPNMIDSSLNKPAPQTAQMTIFYGGQVI 131 Query: 67 VFDAITAEKVRELMLIXXXXXXDKKTSDVKNSATSCPPSPLIRTGSSTLQKS-------S 119 F+ A+K E+M + + T+ PP L G ++ S S Sbjct: 132 AFNDFPADKANEIMQLA-------SNGSSLSHGTAYPPMQLPAQGYNSFAASLPKSPVES 184 Query: 120 TAPGSP-----VVQP---FPEQNSSICKLQ--------------AEFPIARRHSLQRFLE 157 T P SP + +P P +++SI + PIARR+SL RFLE Sbjct: 185 TPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPECAQPPSRPCDLPIARRNSLHRFLE 244 Query: 158 KRRDRMVSNSPY 169 KR+DR+V+ +PY Sbjct: 245 KRKDRIVARAPY 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3173 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424042 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11014 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6023 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20776 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16666 426 e-121 >Cs16666 Length = 253 Score = 426 bits (1095), Expect = e-121, Method: Compositional matrix adjust. Identities = 211/258 (81%), Positives = 231/258 (89%), Gaps = 7/258 (2%) Query: 2 AATTGAVLNGLNSAAFLCGGKRSQALLSAATVGSKVGGASPTPKRFIVVAAAAKKSWIPA 61 AAT+GAVLNGL S+ F+ GGK+SQALL+ + + K +V A KKSWIPA Sbjct: 3 AATSGAVLNGLGSS-FINGGKKSQALLAGTNR------VTSSKKSVVVAALPPKKSWIPA 55 Query: 62 VKGGGNFIDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ 121 VKGGGN I+PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ Sbjct: 56 VKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQ 115 Query: 122 AWSGIPWFEAGADPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQSVEWATPWSK 181 WSGIPWFEAGADP AI+PFSFGSLLGTQLLLMGWVESKRWVDF+NPESQSVEWATPWS+ Sbjct: 116 TWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSR 175 Query: 182 TSENFANSTGEQGYPGGKFFDPLGFAGSIQDGVYVPDSEKLERLKLAEIKHARLAMVAML 241 T+ENFAN+TGEQGYPGGKFFDPL AG+I+DGVY+PD+EKL+RLK+AEIKHARLAMVAML Sbjct: 176 TAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAML 235 Query: 242 IFYFEAGQGKTPLGALGL 259 IFYFEAGQGKTPLGALGL Sbjct: 236 IFYFEAGQGKTPLGALGL 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14244 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 60 3e-11 >Cs17782 Length = 216 Score = 60.5 bits (145), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 7/70 (10%) Query: 83 ADFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPG-------AETKFKEISNAYEVL 135 ++FY+VLG+++ + +E+++AY+KLA +HPD G A+ KF+ I +AY VL Sbjct: 9 SNFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVL 68 Query: 136 SDDEKRSLYD 145 SD KR LYD Sbjct: 69 SDANKRLLYD 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7194 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 201 7e-54 >Cs66175 Length = 260 Score = 201 bits (510), Expect = 7e-54, Method: Compositional matrix adjust. Identities = 93/107 (86%), Positives = 98/107 (91%) Query: 110 MGTYLSTPKTEKLSEDGENGRVRYGLSSMQGWRTTMEDAHAAYPDLDASTSFFGVYDGHG 169 MG YLSTPKTEK SEDG+N VRYGLSSMQGWR TMEDAHAAYPDLD+STSFFGVYDGHG Sbjct: 1 MGVYLSTPKTEKFSEDGQNENVRYGLSSMQGWRATMEDAHAAYPDLDSSTSFFGVYDGHG 60 Query: 170 GKVVAKFCAKYLHQQVLKNEAYAAGDIGTSVQKAFFRMDEMMRGQRG 216 GK VAKFCAKYLHQQVLK+EAY+AGD+ TS QKAF RMDEMMRGQRG Sbjct: 61 GKAVAKFCAKYLHQQVLKHEAYSAGDLVTSAQKAFLRMDEMMRGQRG 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6720 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52149 181 5e-48 >Cs52149 Length = 129 Score = 181 bits (459), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 83/99 (83%), Positives = 92/99 (92%) Query: 81 MEFKQNKFLPDEKQIITACPDINTVELCDDDEFIVLACDGIWDCMSSQQVVDFVREQLLS 140 MEFKQNKFL EKQI+TA PDIN+VELCDDD+F+VLACDGIWDCMSSQQ+VDF+ EQL S Sbjct: 1 MEFKQNKFLSAEKQIVTANPDINSVELCDDDDFVVLACDGIWDCMSSQQLVDFIHEQLHS 60 Query: 141 ESKLSVVCERALDRCLAPSTAGGEGCDNMTMIVVQFKKP 179 ESK+S VCER L+RCLAPSTAGGEGCDNMTMI+VQFKKP Sbjct: 61 ESKISAVCERVLERCLAPSTAGGEGCDNMTMIIVQFKKP 99 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5669 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027352 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15697 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16106183 281 3e-78 >Cs16106183 Length = 166 Score = 281 bits (719), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 134/165 (81%), Positives = 150/165 (90%) Query: 1 MIMDTLGALALATEPPTDDLMKRAPVGRKGNFITNVMWRNILGQSLYQFVIIWFLQTRGK 60 MIMDTLGALALATEPP DLMKR+PVGRKGNFI+NVMWRNILGQSLYQF+IIW+LQTRGK Sbjct: 1 MIMDTLGALALATEPPNGDLMKRSPVGRKGNFISNVMWRNILGQSLYQFLIIWYLQTRGK 60 Query: 61 EAFQLVGPDSDLILNTLIFNSFVFCQVFNEISSREMEKVNVFKGIMQNYVFVTVLSATVI 120 F+L GPD DLILNTLIFN+FVFCQVFNEISSREMEK+NVFKGI++NYVFV VL+ TV+ Sbjct: 61 AVFRLDGPDPDLILNTLIFNTFVFCQVFNEISSREMEKINVFKGILKNYVFVAVLTCTVL 120 Query: 121 FQIIIIEFLGTFANTHPLSWKQWFASVALGFLGMPVSAVLKFIPV 165 FQIIIIE LGTFANT PL+ +QWF S+ LGFLGMP++AVLK I V Sbjct: 121 FQIIIIELLGTFANTTPLNLQQWFVSILLGFLGMPIAAVLKLIQV 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11006 (402 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21532 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14904 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226751914 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380225 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31677 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17858 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13301 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32324 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5754 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9724 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8623 (321 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12008 (392 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8291 (342 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7292 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26979 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19649 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5090 (224 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20048 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22793 (406 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32840 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24696 114 3e-28 >Cs24696 Length = 218 Score = 114 bits (285), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 52/70 (74%), Positives = 57/70 (81%) Query: 4 DVRNHPVLIHCKRGKHRTGCLVGCLRKFQNWCLSSVFEEYQRFAGVKSRPTDLRFIEGFD 63 DVRNHPVLIHCKRGKHRTGCLVGCLRK Q WCLSSVF+EYQRFA K+R +D RF+E FD Sbjct: 143 DVRNHPVLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDEYQRFAAAKARVSDQRFMELFD 202 Query: 64 IMLLRQCLYS 73 I L+ S Sbjct: 203 ISSLKHLPMS 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743283 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32423 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12536 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60298 288 3e-80 >Cs60298 Length = 197 Score = 288 bits (737), Expect = 3e-80, Method: Compositional matrix adjust. Identities = 141/185 (76%), Positives = 154/185 (83%) Query: 25 LLGQGITDIEIHFLQIKFTAIGVYLDAEIVSHLQQWKAKKANELAEDDDFFDALVSAPVE 84 LL G+TDIEIHFLQIKFTAIGVYLD EI+SHLQQWK K+ + LA+DDDFFDALVSAPVE Sbjct: 13 LLATGLTDIEIHFLQIKFTAIGVYLDPEILSHLQQWKGKQGSSLAQDDDFFDALVSAPVE 72 Query: 85 KFIRVVVIKEIKGSQYGVQLESAVRDRLAADDKYXXXXXXXXXXXXXFFQSKYFKKDSVI 144 KF+R+VVIKEIKGSQYGVQLESAVRDRLA DKY FFQSKYFKKDSVI Sbjct: 73 KFLRIVVIKEIKGSQYGVQLESAVRDRLAGADKYEEEEESALEKIVEFFQSKYFKKDSVI 132 Query: 145 TFHFPATSNTAEIVFSTEGKEESKIKVENANVVENIKKWYLGGTRGVSPSTISSLANTLS 204 +HFPATS TAEIV ++EGKE+SKI VENANVVE IKKWYLGG RGVSP+T SSLA+TLS Sbjct: 133 AYHFPATSPTAEIVXTSEGKEDSKIXVENANVVEMIKKWYLGGARGVSPTTTSSLAHTLS 192 Query: 205 AELTK 209 E K Sbjct: 193 XEFIK 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18148 (365 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59703 404 e-114 >Cs59703 Length = 424 Score = 404 bits (1037), Expect = e-114, Method: Compositional matrix adjust. Identities = 183/367 (49%), Positives = 253/367 (68%), Gaps = 3/367 (0%) Query: 1 MVGLTLINGAAAKGAVCLDGTLPAYHIHRGYGSGANSWLVQLEGGGWCDTIRNCVYRKKT 60 +V LTL++ A +GA+CLDG+LP YH +G+GSG+N+WL+ +EGGGWC+TI +C RK T Sbjct: 55 LVDLTLLHNAKDRGALCLDGSLPGYHFQKGFGSGSNNWLLHIEGGGWCNTIESCSTRKTT 114 Query: 61 RRGCSVYMEKQIPFSGILSNKAGENPDFYNWNRVKVRYCDGASFSGDSQNE---AARLHF 117 G S +ME+Q+ FSGILS+ +NPDF++WN+VK+ YCDGASF+G ++E L F Sbjct: 115 ALGSSNFMERQVSFSGILSSDPSQNPDFFSWNKVKIHYCDGASFAGRPESEFKNGTNLFF 174 Query: 118 RGQRIWKAAMEDLMSKGMRYANQALLSGCSAGGVATVLHCDGFRGMFPSTTKVKCLSDGG 177 RGQ IW+A M++L+S GM A QA L+GCSAGG+A V+HCD FR P VKCL+D Sbjct: 175 RGQLIWEALMDELLSVGMSNAKQAFLTGCSAGGLAAVIHCDDFRERLPQHATVKCLADAS 234 Query: 178 LFLDAIDVSGTRTLRSMFTRVVSLQGVQKNLPWSCTNRLNPTLCFFPQHLIASVKTPLFL 237 FLD DV G RT+RS + V LQGV K+L +C +R+ + C FP+ I +++TP+F+ Sbjct: 235 FFLDESDVQGNRTMRSFYDDVFHLQGVAKSLDKNCLSRMGNSSCLFPREFIKNIRTPVFI 294 Query: 238 VNAAYDTWQIQASLAPRTADPNGLWHXXXXXXXXXXXWLIKFLQGFRNQMLKAVSGFSRA 297 VN AYD WQI+ L P +DP G W ++ L+GFRN +L A+S F + Sbjct: 295 VNPAYDFWQIRNILVPDVSDPQGYWQTCRLNIHSCNPNQLEILKGFRNSLLNALSEFQQK 354 Query: 298 GKNGLFINSCFSHCQTERQDTWFSQNPPLIGNKGIAKSVGNWYFDRYSIKAIDCPYPCDK 357 + G+F+NSC+ HCQT +TW S + P I +K IA+SVG+WYF+R ++K IDCPYPC+ Sbjct: 355 NEAGMFVNSCYIHCQTWMAETWHSPSSPRINSKTIAESVGDWYFNRGAVKLIDCPYPCNP 414 Query: 358 TCHNLVF 364 TC+N+ F Sbjct: 415 TCYNMDF 421 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2897 (435 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8750 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 307 9e-86 >Cs76516 Length = 291 Score = 307 bits (786), Expect = 9e-86, Method: Compositional matrix adjust. Identities = 145/264 (54%), Positives = 188/264 (71%), Gaps = 10/264 (3%) Query: 37 YMPTWAFDHIKYFNGGKEIQLHLDKYTGTGFQSKGNYLFGHFHMQIKMVPGDSAGTVTAY 96 Y +WAFDH++Y G ++L+LD Y+G GF SK YLFG +QIK+V GDSAGTVTA+ Sbjct: 29 YQTSWAFDHVQY--DGDTLKLNLDNYSGAGFASKSKYLFGKVSIQIKLVGGDSAGTVTAF 86 Query: 97 YLSSQNNEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIFLWFDPTAAYHSYAVLW 156 Y+SS H+E DFEFLGN TG+PY++QTNV+ G G+REQR+ LWFDPT +H+Y++LW Sbjct: 87 YMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNGVGNREQRLDLWFDPTKEFHTYSLLW 146 Query: 157 NLYQIVFLVDDIPIRVFKNSKDLGVKFPFNQPMKLYSSLWNADDWATRGGLEKTDWSKAP 216 N Q+VFLVD+ PIRV N + G+ FP +Q M +YSS+WNADDWAT+GG KTDWS AP Sbjct: 147 NQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGVYSSIWNADDWATQGGRVKTDWSHAP 206 Query: 217 FIASYRGFHIDGCE--ASV----EAKYCATQGKR--WWDQKEFQDLDAQQWRRLRWVRKK 268 FIASY+GF ID CE ASV AK C++ ++ WWD+ +L+ Q +L WVR Sbjct: 207 FIASYKGFDIDACECPASVAGADNAKKCSSSAEKRFWWDEPTLSELNVHQSHQLMWVRAN 266 Query: 269 FTIYNYCTDRVRYPSMPPECKRDR 292 IY+YCTD R+P++P EC R Sbjct: 267 HLIYDYCTDTSRFPAIPTECVHHR 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992109 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4475 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29010 (295 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51912285 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41343 209 1e-56 >Cs41343 Length = 166 Score = 209 bits (532), Expect = 1e-56, Method: Compositional matrix adjust. Identities = 103/150 (68%), Positives = 120/150 (80%) Query: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 +DFSK SK AL+WAI NL +KGDTLYIIHIK ESR+ LW+ +GSPLIPL EFR+ + Sbjct: 12 LDFSKGSKLALKWAIDNLLEKGDTLYIIHIKLPQDDESRNLLWSDTGSPLIPLEEFRDQE 71 Query: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 +MK Y V D +VLD LD S+QK V VV KLYWGDAR+KL +AVE +KLDSLVMGSRGL Sbjct: 72 VMKQYEVDLDQDVLDMLDAASKQKHVSVVAKLYWGDARDKLCEAVEAMKLDSLVMGSRGL 131 Query: 121 STIKRIVLGSVSNFVLTNASIPVTIVKDPS 150 TI+R++LGSVSN VL NAS PVTIVKDPS Sbjct: 132 GTIQRVLLGSVSNHVLANASCPVTIVKDPS 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264770 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7407 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034055 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59973 119 1e-29 >Cs59973 Length = 197 Score = 119 bits (299), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 69/178 (38%), Positives = 106/178 (59%), Gaps = 19/178 (10%) Query: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAG--------QNSKDTLVLLHAKPP--R 50 MTD + + +++VA+DE ES++AL W L N+ G L ++H + P R Sbjct: 25 MTD-GKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQR 83 Query: 51 AVFTALDGTGRREDPSAYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKV 110 V AL + SA+ +S ++ + K + + ++ +A +MCKD +KAE+ V Sbjct: 84 FVLPALSTS------SAFYATSSMVESVRKSQEENSAALLSRALQMCKDKM--VKAESLV 135 Query: 111 ESGDPRDVICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPK 168 GDP+D+ICQ E++ D+LV+GS G G IKRAFLGSVS++CA + CP++IVK PK Sbjct: 136 LEGDPKDMICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKPPK 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8855 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59973 120 7e-30 >Cs59973 Length = 197 Score = 120 bits (302), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 68/172 (39%), Positives = 105/172 (61%), Gaps = 14/172 (8%) Query: 1 MTDVAESERRILVAVDEGEESMHALSWCLKNVAG--------QNSKDTLVLLHAKPP--R 50 MTD + + +++VA+DE ES++AL W L N+ G L ++H + P R Sbjct: 25 MTD-GKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGGGILTIVHVQQPFQR 83 Query: 51 AVFTALD-GTAYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPR 109 V AL +A+ +S ++ + K + + ++ +A +MCKD +KAE+ V GDP+ Sbjct: 84 FVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKM--VKAESLVLEGDPK 141 Query: 110 DVICQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPK 161 D+ICQ E++ D+LV+GS G G IKRAFLGSVS++CA + CP++IVK PK Sbjct: 142 DMICQSAEQMHIDLLVVGSRGLGKIKRAFLGSVSDYCAHHAVCPIIIVKPPK 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19391 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5492 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71921177 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21748 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27169 83 2e-18 >Cs27169 Length = 201 Score = 82.8 bits (203), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 49/67 (73%), Gaps = 1/67 (1%) Query: 107 LHPIHKLLHPHFRDNMNVNALARQVLINAGGILEATLFPAKFSMEWSSAMY-KNWVFPEQ 165 +HPI++LL PHFR M +N LARQ L+NA GI+E++ P K+SME+SS Y K W F + Sbjct: 1 MHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHE 60 Query: 166 ALPVDLI 172 ALP DLI Sbjct: 61 ALPKDLI 67 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8501 (517 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26973 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19383 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8507 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21722 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50889568 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54621652 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10848 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70492 90 2e-20 >Cs70492 Length = 156 Score = 89.7 bits (221), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 44/114 (38%), Positives = 76/114 (66%), Gaps = 2/114 (1%) Query: 48 NNPDFVVEVVSLFFQDTERLVNELAKAL-DQQCVDYKFVDKSVHQLKGSSSSIGAQRVQR 106 ++P+FV EVV+++F ++E+L+ L L D++ DYK + ++Q+ GSSSSIGA+RV Sbjct: 40 SSPNFVSEVVNIYFHESEKLLRNLRSLLMDKEFSDYKKLGIHLNQMMGSSSSIGAKRVSN 99 Query: 107 ACISFRNFCDEQNVEWCIKCLQQVKHEYLLVKNKLENLFELQRQV-VAAGGSLP 159 C++FR ++ N C++ L+ ++HEY + NK LF++++Q +AAG P Sbjct: 100 VCVAFRAASEQNNRAGCLRALELLEHEYCYLNNKFHELFQIEQQRELAAGVRYP 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3802 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4196 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32983 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31477 (475 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21169 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32577 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23685 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69106190 187 2e-49 >Cs69106190 Length = 396 Score = 187 bits (474), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 106/314 (33%), Positives = 174/314 (55%), Gaps = 17/314 (5%) Query: 2 ESRVLSRATAFAPLPCQRKPSHRENGAVSFVSARPIGAVSEGGNLIWGRQLRPALLLEAS 61 + R L+ F+PLP + F S +P+ +S NL + + + Sbjct: 19 KKRFLTPTLKFSPLPIIQNSIFNNK----FSSEKPLH-ISSTQNLTFSPKEQ-------- 65 Query: 62 PIKREILKPCLAAASSPAQGDSAGDAKVAPIGFFDKYPFILTGFFFFMWYFLNVIFNIMN 121 ++E+ C A + ++ + F+ + G +F W+ LNV+FNI N Sbjct: 66 --QKELKTQCNAYEADRSRPLDINIEVLDEQARFEAAQRLKIGIYFATWWALNVVFNIYN 123 Query: 122 KKIYNYFPYPYFXXXXXXXXXXXYCLISWAVGLPKRAPIDANLLKLLIPVAVCHALGHVT 181 KK+ N FPYP+ L+SWA + + D K L PVAV H +GHV Sbjct: 124 KKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKTDLEFWKSLFPVAVAHTIGHVA 183 Query: 182 SNVSFAAVAVSFTHTIKALEPFFNASASQFVLGQSIPLSLWLSLAPVVIGVSMASLTELS 241 + VS + VAVSFTH IK+ EP F+ S+F+ G+++P+ +++SL P++ G ++A++TEL+ Sbjct: 184 ATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMPVYMSLLPIIGGCALAAVTELN 243 Query: 242 FNWLGFISAMISNISFTYRSIYSKKAM--TDMDSTNLYAYISIIALIVCIPPALILEGPQ 299 FN +GF+ AMISN++F +R+I+SKK M + N YA +S+++L++ P A+ +EGPQ Sbjct: 244 FNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYACLSMMSLLILTPFAIAVEGPQ 303 Query: 300 LIKYGFNDAIAKVG 313 + G+ AIA++G Sbjct: 304 MWAAGWQKAIAQIG 317 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12258 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17701 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs32345 138 3e-35 >Cs32345 Length = 190 Score = 138 bits (347), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 63/85 (74%), Positives = 74/85 (87%) Query: 82 CQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS 141 CQVD C ADLSD KQY+RRHKVC+VHAKA +++GG RQRFCQQCSRFH LSEFD++KRS Sbjct: 66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDETKRS 125 Query: 142 CRRRLAGHNERRRKTSSEYHGHGGT 166 CRRRLAGHNERRRK ++E +G G + Sbjct: 126 CRRRLAGHNERRRKNAAESNGEGSS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20850 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6580 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs173106183 236 3e-64 >Cs173106183 Length = 286 Score = 236 bits (601), Expect = 3e-64, Method: Compositional matrix adjust. Identities = 113/178 (63%), Positives = 131/178 (73%), Gaps = 17/178 (9%) Query: 14 QLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWELPSKATFGEQEWYF 73 +LPPGFRFHPTDEEL+VHYL+ +A S P PV+II EVD+YKFDPW+LP KA FGE+EWYF Sbjct: 8 ELPPGFRFHPTDEELIVHYLRNQATSRPCPVSIIPEVDIYKFDPWQLPEKAEFGEKEWYF 67 Query: 74 FSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKALVFYGGKPPKGTKT 133 FSPRDRKYPNG RPNRA SGYWKATGTDK + G+ +GVKKALVFY G+PPKG KT Sbjct: 68 FSPRDRKYPNGTRPNRATVSGYWKATGTDKAIYG--GSKYLGVKKALVFYKGRPPKGIKT 125 Query: 134 NWIMHEYRLVXXXXXXXXXXXXXXKPSDAANK-KPSLRLDDWVLCRIYKKNKGPVMSI 190 +WIMHEYRL P+ K S++LDDWVLCRIYKK + S+ Sbjct: 126 DWIMHEYRL--------------NDPTRQPYKHNGSMKLDDWVLCRIYKKRQTGSRSV 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2839 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28943 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27411 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7970 176 3e-46 >Cs7970 Length = 119 Score = 176 bits (445), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 81/114 (71%), Positives = 98/114 (85%) Query: 125 MKGDYYRYLAEFKSGDDRKQAADHSLKAYLTAVDTAASELPPTHPIRLGLALNFSVFYYE 184 MKGDYYRYLAEFK GD+RK AA++++ +Y A D A ++L PTHPIRLGLALNFSVFYYE Sbjct: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 Query: 185 ILNSPERACHLAKKAFDETFAELDSIDQESSKDSTLIMQLLKDNLTLWTSDLPE 238 ILNS E+AC +AK+AF+E AELD++ +ES KDSTLIMQLL+DNLTLWTSD+ E Sbjct: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800151 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3273 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 75 3e-16 >Cs30681 Length = 257 Score = 74.7 bits (182), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 36/90 (40%), Positives = 51/90 (56%) Query: 1 MLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVI 60 + EL+TGR+PLD +R +SEQ L+ W P L D ++DP L G Y K + A V Sbjct: 116 LYELITGRRPLDRNRPKSEQKLLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVA 175 Query: 61 ALCVQPEPEFRPPMSEVVQALVRLVQRASV 90 C+ + + RP MSEVV+ L ++V A Sbjct: 176 NKCLARQAKGRPKMSEVVEVLNKIVDAAET 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787059 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26793 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16520 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13319 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig495 (44 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12748 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37779 252 1e-69 >Cs37779 Length = 250 Score = 252 bits (643), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 119/136 (87%), Positives = 125/136 (91%) Query: 3 RCCRHSKTLGSFGAWNRCLNHLLTLAESHIESVILAKFVEAVQKCPDPSSRAALKLVCDL 62 R +HSKTLGSFGAWNRCLNHLLTLAESHIESVILAKF+EAVQ CPDPSSRAALKLVCDL Sbjct: 115 RLRKHSKTLGSFGAWNRCLNHLLTLAESHIESVILAKFIEAVQNCPDPSSRAALKLVCDL 174 Query: 63 YALERIWKDIGTYRNVDYVAPNKAKAIHKLMEYLSFQVRNIAKELVDAFDIPDYVTRAPI 122 YAL RIW DIGTYRNVDYVAPNKAKAIHKL EYLSFQVRNIA EL+DAFD+PDYVTRAPI Sbjct: 175 YALNRIWNDIGTYRNVDYVAPNKAKAIHKLTEYLSFQVRNIAGELIDAFDLPDYVTRAPI 234 Query: 123 AMQSGAYSHYTHYVGF 138 A QS AY++YT VGF Sbjct: 235 ARQSDAYAYYTQIVGF 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11602 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55091 206 2e-55 >Cs55091 Length = 151 Score = 206 bits (525), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 103/156 (66%), Positives = 122/156 (78%), Gaps = 5/156 (3%) Query: 1 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLALFDTEI 60 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYL LFDTE+ Sbjct: 1 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEV 60 Query: 61 DAARAYDKAAIKCNGKEAVTNFDPSIYENELNPSESSGVNAADHDLDLSLGXXXXXXXXQ 120 +AARAYD+AA+KCNGK+AVTNFDPS+Y++EL ++SG + DH+LDLSLG Sbjct: 61 EAARAYDRAAVKCNGKDAVTNFDPSLYQDEL---KASG-HGVDHNLDLSLGSSASNQQSS 116 Query: 121 ALGNDNNSQNGALEHQHSVSMQFDADWRSQGFRPKL 156 A N Q +E S+ + DW ++G+RPK+ Sbjct: 117 A-DFANRMQYTVMERPAPASLPNEVDWHNRGYRPKV 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27013 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824050 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25288 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28895 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6390 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16106183 149 2e-38 >Cs16106183 Length = 166 Score = 149 bits (376), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 68/87 (78%), Positives = 77/87 (88%) Query: 141 MIMDTLGALALATEPPNNDLMKRPPVGKRQNFINNVMWRNILGQSFYQFTMIWFLQAKGE 200 MIMDTLGALALATEPPN DLMKR PVG++ NFI+NVMWRNILGQS YQF +IW+LQ +G+ Sbjct: 1 MIMDTLGALALATEPPNGDLMKRSPVGRKGNFISNVMWRNILGQSLYQFLIIWYLQTRGK 60 Query: 201 AMFGLYGPDSHVILNTLIFNTFVFCQV 227 A+F L GPD +ILNTLIFNTFVFCQV Sbjct: 61 AVFRLDGPDPDLILNTLIFNTFVFCQV 87 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9090 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32643 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95088 116 5e-29 >Cs95088 Length = 212 Score = 116 bits (290), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 56/69 (81%), Positives = 61/69 (88%) Query: 1 ESENKALKNRKPYLHESRHQHALRRARGCGGRFLNAKKNGNQPDEMTSGDKSQSNINLNT 60 ESENK LK+RKPYLHESRH HALRRARGCGGRFLN+KKN NQ M S DKSQSN+NLN+ Sbjct: 141 ESENKVLKSRKPYLHESRHLHALRRARGCGGRFLNSKKNENQQKGMASDDKSQSNLNLNS 200 Query: 61 DKNELASSD 69 DKNE+ASSD Sbjct: 201 DKNEIASSD 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26167 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815213 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14342 (372 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780398 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32495 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4062 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9739 192 4e-51 >Cs9739 Length = 198 Score = 192 bits (487), Expect = 4e-51, Method: Compositional matrix adjust. Identities = 101/187 (54%), Positives = 132/187 (70%), Gaps = 15/187 (8%) Query: 85 LKTIFGEAGKIKDLCILDPHALEASTKGGKTEKLISNKLHALVEYDTVEAADKAVTTLRN 144 ++ IF EAGKIK +CI DP+ +E S K K E L+SNKLHA VEY+TVEAA+KAV TL + Sbjct: 1 MQRIFAEAGKIKSICIRDPNVVEESKKSSKYEYLVSNKLHAFVEYETVEAAEKAVATLND 60 Query: 145 EGDWRNGMRVKLLKQVGKYGQRKQPWRGFDSEKSSGNRSNDQTGDEENHTVSEKHNDART 204 E DWRNG+RVKLLK++G YGQR+Q WRG D EK++ R++D G+EE+ +++++D T Sbjct: 61 EQDWRNGLRVKLLKRMGNYGQRRQAWRGSDYEKNNSGRTSDPAGNEEHQNSNDRYDD--T 118 Query: 205 TDEEDGERVPKEKTGHRGRNRGQSGRQKYRGT--------NGFGHGTTSANHGIEPSKPP 256 DEE+GE + K +N GQ GR + R NG GHGTTS+ H +EP+KPP Sbjct: 119 PDEEEGEHLSNSKE----KNDGQKGRNRGRSRRQRYRGGPNGLGHGTTSS-HALEPTKPP 173 Query: 257 PGPRMPD 263 PGPRMPD Sbjct: 174 PGPRMPD 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9914 (643 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4630 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67555 146 2e-37 >Cs67555 Length = 246 Score = 146 bits (369), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 80/133 (60%), Positives = 90/133 (67%), Gaps = 1/133 (0%) Query: 1 MGYWQTKVLPKIKKVFXXXXXXXXXXXXXXXXXFDDSXXXXXXXXXXXXXXLQAKVIELY 60 MGYW++KVLP+IKKVF FDDS LQ KV+E+Y Sbjct: 1 MGYWKSKVLPRIKKVFEKNGTKKAAAAEACKS-FDDSKEEINKEFEEKKPELQPKVVEIY 59 Query: 61 EACSAEIKTLVKERKESGLKKYSAAVLKFLEELAKIEFPGSKPVSDASSKYGPAYVSGPV 120 EA SAEIKTLVK+RKE GLKK+S AV K LEEL KIEFPGSK VS+ASSK+G A V GPV Sbjct: 60 EASSAEIKTLVKDRKEDGLKKHSTAVHKLLEELVKIEFPGSKAVSEASSKFGAASVPGPV 119 Query: 121 FFVFEKVSTFTVT 133 FF+FEKVSTF VT Sbjct: 120 FFIFEKVSTFIVT 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25232 (273 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 147 1e-37 >Cs99541 Length = 211 Score = 147 bits (370), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 65/157 (41%), Positives = 100/157 (63%) Query: 85 KLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 144 K +++GD G GKS L+L+F +F + TIG F ++ + +++ +K +IWDTAGQE Sbjct: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67 Query: 145 YHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMALAGNKADLVEAR 204 + S+ YYRGAA A++VYD+T + +F W+ + + N NM + L GNK DL R Sbjct: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR 127 Query: 205 KVAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIA 241 V+ E+ + +A+E+GL F+E SAKTA NV + F + A Sbjct: 128 AVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTA 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9192 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54681722 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs63107 131 2e-33 >Cs63107 Length = 342 Score = 131 bits (330), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 62/98 (63%), Positives = 74/98 (75%), Gaps = 1/98 (1%) Query: 1 MGGFWTLWEADDWVTRGGLGKINWSKAPFFSYYKDFDIEGCSVPGPASCASSTNNWWEGA 60 MG + TLWEADDW TRGGL KI+WSKAPF++YY+DFDIEGC VPGPA+CAS+ NWWE Sbjct: 185 MGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEAN 244 Query: 61 SYQALSALDYRRYRWVRINHMIYDYCTDRSRYPVAPPE 98 +YQ S + + +HMIYDYCTD+S YPV P E Sbjct: 245 NYQP-SPHGNKEIQMGSSHHMIYDYCTDKSGYPVPPTE 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3874 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1749 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39715 71 3e-15 >Cs39715 Length = 158 Score = 70.9 bits (172), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 34/82 (41%), Positives = 47/82 (57%) Query: 14 MDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAKNNAAFNQAFITAMTK 73 +D TP FDN YF+NLV KGL SDQ L+ + VRT++ N + F+ F+ M K Sbjct: 77 LDLQTPTSFDNNYFKNLVNRKGLLHSDQQLFNGGSTDSQVRTYSNNPSTFSSDFVAGMIK 136 Query: 74 LGRVGMKTGKNGNIRRDCSVFN 95 +G + TG G IR++C N Sbjct: 137 MGDISPLTGSRGEIRKNCRRIN 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7893 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104090 215 1e-58 >Cs104090 Length = 227 Score = 215 bits (548), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 95/116 (81%), Positives = 107/116 (92%) Query: 1 MQENLKRELFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIFEAASFGGTNFDPSAWED 60 MQE+LKR+LFGLPPRYRDSVRAITPGLPLFLYNY+THQLHGIFEA FGG+N DP+AWED Sbjct: 104 MQEDLKRQLFGLPPRYRDSVRAITPGLPLFLYNYTTHQLHGIFEATGFGGSNIDPTAWED 163 Query: 61 KKCPGESRFPAQVRVFTRKVCEPLEEDSFRPILHHYDGPKFRLELSVPEALSLLDI 116 KKC GESRFPAQVR+ RK+C+ LEED+FRP+LHHYDGPKFRLELSVPE L L+D+ Sbjct: 164 KKCKGESRFPAQVRIRVRKLCKALEEDAFRPVLHHYDGPKFRLELSVPETLDLMDL 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10742 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29083 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239951 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21497 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7970 191 6e-51 >Cs7970 Length = 119 Score = 191 bits (485), Expect = 6e-51, Method: Compositional matrix adjust. Identities = 90/114 (78%), Positives = 100/114 (87%) Query: 127 MKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFYYE 186 MKGDYYRYLAEFK GD+RK A+ +M +Y+AA A TDL PTHPIRLGLALNFSVFYYE Sbjct: 1 MKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYE 60 Query: 187 ILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPE 240 ILNS E+AC +AKQAF+EAI+ELDTL EESYKDSTLIMQLLRDNLTLWTSD+ E Sbjct: 61 ILNSSEKACTMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18341 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11362 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25473 (444 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11952 (360 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74261 162 6e-42 >Cs74261 Length = 193 Score = 162 bits (409), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 86/194 (44%), Positives = 121/194 (62%), Gaps = 5/194 (2%) Query: 1 MSFRS--IVRDVRDGFGSLSRRSFEVRLPGHHRGKSHGSVHEVHDQPSVIQNSR--WASL 56 MS R+ + R + FG + S E L + D + +S WA L Sbjct: 1 MSLRNSCLSRRISRSFGEAHKSSKETGLGAADDSVVSSTTSASMDSGAAAAHSSGSWAGL 60 Query: 57 PPELLRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVRSPEFCGKITFPVALKQ 116 PELL ++I+R+E +E +WP R++VVACA VC+ WRE+ K+IV+SP GKITFP LKQ Sbjct: 61 LPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPSCLKQ 120 Query: 117 PGSRDGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRTRRTTCTEYVISTDAD 176 PG R+ QC I+R+K T++L+L L+P+ E GKFLL+A+R RR +EY+IS DA Sbjct: 121 PGPREFPHQCLIRRNKKTSTFYLYLALTPS-FSEKGKFLLAARRYRRGAHSEYIISLDAG 179 Query: 177 NISRSSNKYIGKLR 190 ++S+ SN Y+GKLR Sbjct: 180 DLSQGSNAYVGKLR 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23011 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6792 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15251 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5349 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20536 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30219 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8592 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8706 (404 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9954 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51564940 (67 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17453 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752406 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86870 97 8e-23 >Cs86870 Length = 272 Score = 97.1 bits (240), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 50/128 (39%), Positives = 74/128 (57%), Gaps = 5/128 (3%) Query: 2 RPKIYLFGDSITEESFGDGGWGASLAHHFSRTVDVVLRGYSGYNTRWPLKVLERVFXXXX 61 RP+ LFG SI + F +GGWGA L+ ++R D++LRGY G+N+R L+VL++VF Sbjct: 6 RPQFVLFGSSIVQLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDA 65 Query: 62 XXXXXXXXXLAVTIFFGANDACLPDRCSAFQHVPLDEYKQNLLSIVSFLKKRWPSTHILL 121 V ++FG ND+ P HVPL EY +N+ I + LK +T I+ Sbjct: 66 PIQPSL-----VIVYFGGNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIF 120 Query: 122 ITPPPIDE 129 ++ PP+DE Sbjct: 121 LSTPPVDE 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8189 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 197 4e-53 >Cs45360 Length = 378 Score = 197 bits (501), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 2/135 (1%) Query: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEWNSPKKTCSGELGPLSG 60 M+RL A+YKGL+TWARWV+ NVD ++TKVFFQGISPTHY+G++WN P K+CSG+ P G Sbjct: 245 MNRLVAFYKGLTTWARWVNFNVDPTKTKVFFQGISPTHYEGRDWNEPSKSCSGQTKPYFG 304 Query: 61 STYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLP 120 YPAG P V+ KV S ++ PVYLLDIT LSQ RKDAHPS Y G HS +DCSHWCLP Sbjct: 305 YKYPAGTPMPWVVLQKVFSRLRKPVYLLDITRLSQYRKDAHPSEYGG-HS-DDCSHWCLP 362 Query: 121 GLPDTWNQLLYAALI 135 GLPDTWNQL+YAAL Sbjct: 363 GLPDTWNQLMYAALF 377 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28412 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs43708 575 e-166 >Cs43708 Length = 321 Score = 575 bits (1482), Expect = e-166, Method: Compositional matrix adjust. Identities = 277/321 (86%), Positives = 299/321 (93%) Query: 41 MGGVSESTFQIDRNGGENGGPTGLFKGVVSTANNGGFSSIRTKNLPTAEDLSGYDGLELR 100 MGGVSESTFQIDR GGENG PTGLFKGVVSTANNGGF+SIRT+N EDLS YDGL+LR Sbjct: 1 MGGVSESTFQIDRTGGENGAPTGLFKGVVSTANNGGFTSIRTRNFAEPEDLSAYDGLKLR 60 Query: 101 LKGDGRRYKLIVRTSSDWDTVGYTAGFDTVGNQWQTVRIPFSSLKPIFRARTVSDAPPFD 160 LKGDGRRYK +VRTSSDWDTVGYTA FDTVG QWQ++R+PFSSL+PIF+ARTV DAPPFD Sbjct: 61 LKGDGRRYKFVVRTSSDWDTVGYTASFDTVGGQWQSIRLPFSSLRPIFQARTVLDAPPFD 120 Query: 161 PSNVVSLQLMFSKFEYDGKLNPTFVEGPFQLPLSSIRAYLKEPITPRFVHVGSAGVTRPE 220 PSN+VSLQLMFSKFEYDGKLNPTFVEG FQLP+SSI++Y+K+P+TPRFVHV SAGVTRPE Sbjct: 121 PSNIVSLQLMFSKFEYDGKLNPTFVEGAFQLPVSSIQSYIKDPVTPRFVHVSSAGVTRPE 180 Query: 221 RPGLDLSKQPPAVRLNKELDFILTYKLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD 280 RPGLDLSKQPPAVRLNKEL FILT+KLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD Sbjct: 181 RPGLDLSKQPPAVRLNKELGFILTFKLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFD 240 Query: 281 QGDNITGKISREEVAQICVAALESPYATGKTFEVKSVIPFSQPFTVDPENPPPEKDYDVY 340 QGDNITGKISREEVA+ICVAALESP+A KTFEVKS IPFS+ FTVDPENPP EKDY++Y Sbjct: 241 QGDNITGKISREEVARICVAALESPFALDKTFEVKSTIPFSESFTVDPENPPQEKDYNIY 300 Query: 341 FKTLKDGITGKEILEQDPVPV 361 FK LKDGITGKE LEQ PVPV Sbjct: 301 FKGLKDGITGKESLEQSPVPV 321 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51241402 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92249 75 2e-16 >Cs92249 Length = 171 Score = 75.1 bits (183), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/66 (53%), Positives = 46/66 (69%) Query: 2 PKKPPTAFFYFLEDYRKELQEQNPGIKQMREIGKVCGEKWKTMTYEEKVQYYDIATEKRA 61 PK+PPTAFF F++D+RKE +E +P K + + K GEKWK MT EEK Y D A E +A Sbjct: 56 PKRPPTAFFLFMDDFRKEYKEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLDKAAELKA 115 Query: 62 EFEKAM 67 ++ KAM Sbjct: 116 DYSKAM 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21695 (895 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25190 (328 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26435 94 2e-21 >Cs26435 Length = 278 Score = 94.0 bits (232), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 65/220 (29%), Positives = 109/220 (49%), Gaps = 17/220 (7%) Query: 90 EFWREAEILSKLHHPNVVAFYG--VVQNGPGGTLATVAEFMVNGSLRHVLLSKERHLDRR 147 + +E ++L L H N+V +YG VV + L E++ GS+ + R + Sbjct: 31 QLEQEIKVLGHLKHENIVQYYGSEVVDD----HLYIYLEYVHPGSINRYVREHCRDITES 86 Query: 148 KRLIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLKDPQRPICKVADFGLSKIKRNTLVT 207 G+ YLHS N +H D+K NLLV+ + K+ADFG++K Sbjct: 87 IVRNFTRHILNGLAYLHSTNTIHRDIKGANLLVDASG----VVKLADFGMAKHLTGLSYE 142 Query: 208 GGVRGTLPWMAPELLNG-----GSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIG 262 ++G+ WMAPE++ G+ K++ VD++S G + E+LTG+ P++ + Sbjct: 143 LSLKGSPNWMAPEVIKAVMQKDGNPKLALAVDIWSLGCTVIEMLTGKPPWSEFEGPQAMF 202 Query: 263 GIVNNTLRPHVPPFCDSEWKLLMEQCWAADPVVRPSFTEI 302 ++N T P +P SE K + +C+ +PV RPS E+ Sbjct: 203 KVLNRT--PPIPEMLSSEGKDFLLRCFLRNPVERPSAVEL 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417954 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765933 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13466 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 154 2e-39 >Cs30681 Length = 257 Score = 154 bits (388), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 80/177 (45%), Positives = 108/177 (61%), Gaps = 2/177 (1%) Query: 171 TLDWMQRVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD 230 TL W R++IA +AARGL YLHE + II RD +SSN+LL E + AK++DF L+ P Sbjct: 17 TLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQWNAKLSDFGLARLGPS 76 Query: 231 MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS 290 ST V+GT GY APEY TG+LT KSD++SFGV L EL+TGR+P+D P+ +Q Sbjct: 77 DGLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYELITGRRPLDRNRPKSEQK 136 Query: 291 LVTWATPRLSE-DKVKQCVDPKLK-DYPXXXXXXXXXXXXXCVQYESEFRPNMSIVV 345 L+ W P L++ K +DPKL+ Y C+ +++ RP MS VV Sbjct: 137 LLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKCLARQAKGRPKMSEVV 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5790 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15232 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs183106187 65 1e-12 >Cs183106187 Length = 300 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 62/231 (26%), Positives = 104/231 (45%), Gaps = 28/231 (12%) Query: 57 VLSRVNHKNFVNLIGYCEEDEPFTRMMVFEYAPNGNLFEHLHIEE-MEHLDWNSRIRIVM 115 VLS++ H + V L+G C E +V+EY PNG+L + L + + L W R RI Sbjct: 2 VLSKLQHPHLVTLLGACPE----AWSLVYEYLPNGSLQDRLFRKSNVSPLLWKDRARIAA 57 Query: 116 GTAYCLQYMHHELNPPVSHPNLTSASIFLTDDYAAKIAE--ICFWA--ESIRKPKNSGDD 171 A L ++H + H +L +I L + ++KI + IC +++ P Sbjct: 58 EIASGLCFLHSSKPEKIVHGDLKPQNILLDSELSSKICDFGICRLVTEDTLYLPSFHRST 117 Query: 172 DKEHSVLPPLADPE----------TNVYSFGVMLLEIITGKLQNSEEHGSLLYWASAYLN 221 + S P ADPE ++ YSFG+++L+++TG+L G A Sbjct: 118 APKGSF--PYADPEYHRTGVLTPKSDSYSFGLIILQLLTGRLPV----GLAGEVRRAVSC 171 Query: 222 ENRSDMVDPTLKSFKNEELDVLCEVIKDCIQQDPRQRPTMKDVTNKLREEI 272 S ++DP + L ++ C + R+RP D+T L +E+ Sbjct: 172 GKLSSILDPLAGDWPTFVARRLVDLGLQCCELYGRERP---DITPSLVKEL 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13680 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29208 (288 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101535 170 1e-44 >Cs101535 Length = 297 Score = 170 bits (431), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 108/281 (38%), Positives = 141/281 (50%), Gaps = 41/281 (14%) Query: 41 DYGVEYVVESSGIFTTLEXXXXXXXXXXXXVVISAP-SADAPMFVVGVNENTYKPNMDIV 99 D G++ V+E +G+F E V+I+AP D P +VVGVN + YKP+ I+ Sbjct: 2 DLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPII 61 Query: 100 SNASCTTNCLAPLAKVIHEEFG-------------------------------------- 121 SNASCTTNCLAP KV+ ++FG Sbjct: 62 SNASCTTNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIHLRKRQKVTQLDDRIFPMCA 121 Query: 122 -ILEGLMXXXXXXXXXXXXXDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 180 I++G M D S +D R R A NI+P+STGAAKAV VLP L GKL Sbjct: 122 GIIKGTMTTTHSYTGDQRLLDA-SHRDLRRARSAALNIVPTSTGAAKAVALVLPALKGKL 180 Query: 181 TGMAFRVPTPNVSVVDLTCRLEKSSSYEDVKATIRYAADGPLRGILGYTEEDVVSNDFVG 240 G+A RVPTPNVSVVDL ++ K + EDV A R +AD L+ IL +E +V DF Sbjct: 181 NGIALRVPTPNVSVVDLVVQVSKITFAEDVNAAFRDSADNELKCILXVCDEPLVXVDFXC 240 Query: 241 DSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIE 281 S D+ L + K+ +WYDN WGYS R +D + Sbjct: 241 SDVFSNRDSSLTLVMGDXMXKVXAWYDNXWGYSQRXVDFAD 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4719 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66689 196 3e-52 >Cs66689 Length = 145 Score = 196 bits (498), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 94/147 (63%), Positives = 112/147 (76%), Gaps = 4/147 (2%) Query: 276 MRKFDDKLPSREFDNFQFVNFTEIMSKHTTSSEKEAAFALAALMEIPIQYKAAVEFGILG 335 M+KFDDK+P+REFDNFQFVNFT IMSK+ T SEKE AFALAALMEIPIQYKAAVE GI+G Sbjct: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 Query: 336 RTTGXXXXXXXXXXXXXYTHRA-PTREPSGLSAPAGDERSEMLCPVCLTNVKDIAFGCGH 394 RTTG Y+ RA P R+PS S P + ++ CP+CLTN KD+AFGCGH Sbjct: 61 RTTGRAKKIAPRPPPAPYSRRALPERQPSRGSTPVAETQA---CPICLTNAKDLAFGCGH 117 Query: 395 MSCRDCAPRLSDCPICRQPIRSRLRVF 421 M+CR+C R+S+CPICRQ I +RLR+F Sbjct: 118 MTCRECGSRVSNCPICRQRITNRLRLF 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226792919 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56435546 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 122 3e-30 >Cs30681 Length = 257 Score = 122 bits (305), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 72/180 (40%), Positives = 102/180 (56%), Gaps = 6/180 (3%) Query: 1 MENNSLANALFGPENRINLDWPTRVKICTGIARGLAFLHEESRLKIVHRDIKATNVLLDG 60 M N S+ + L + L W TR+KI ARGLA+LHE +I+ RD K++N+LLD Sbjct: 1 MPNRSVQDHLTS-RFQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDE 59 Query: 61 DLNPKISDFGLAKLYDEEK-THVSTKVAGTIGYMAPEYALLGHLTYKADVYSFGVVALEI 119 N K+SDFGLA+L + +HVST V GTIGY APEY G LTYK+D++SFGV E+ Sbjct: 60 QWNAKLSDFGLARLGPSDGLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYEL 119 Query: 120 VSGKK--NSYVPSNACVSLLDWAY-QLQQGGNLKELIDESLMSEIHGKEAKVMVKVGLLC 176 ++G++ + P + LL+W L ++D L + K A+ + V C Sbjct: 120 ITGRRPLDRNRPKSEQ-KLLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKC 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21329 (398 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19474 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30197 189 1e-50 >Cs30197 Length = 247 Score = 189 bits (479), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 92/112 (82%), Positives = 100/112 (89%) Query: 1 ISIVFLRNKWILLNETRFTSKRPANEIISKIEEAAGPLGFGVKKNNFKLKLQGEKTGRKG 60 +S +F + ++ ETRFTSKRP NEIISKIEEAA PLGF VKKNNFKLKLQGEKTGRKG Sbjct: 122 LSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKG 181 Query: 61 HLSVATEIFEVAPSLYMVEVRKSGGDTLEFHNFYKNLSTGLKDIVWKSADES 112 HLSVATEIFEVAPSLYMVE+RKSGGDTLEFH FYKNLSTGLKD+VWKS DE+ Sbjct: 182 HLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGDET 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7882 (413 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752629 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32686 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3887 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67555 147 7e-38 >Cs67555 Length = 246 Score = 147 bits (371), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 79/131 (60%), Positives = 89/131 (67%), Gaps = 1/131 (0%) Query: 1 MGYWQTKVLPKIKKVFXXXXXXXXXXXXXXXXXFDXXXXXXXXXXXXXXXXLQPKVIELY 60 MGYW++KVLP+IKKVF FD LQPKV+E+Y Sbjct: 1 MGYWKSKVLPRIKKVFEKNGTKKAAAAEACKS-FDDSKEEINKEFEEKKPELQPKVVEIY 59 Query: 61 EASSAEIKILVKERKESGLKKYSAAVHKFLEELAKIEFPGSKTVSEASSKYGSAYVSSPV 120 EASSAEIK LVK+RKE GLKK+S AVHK LEEL KIEFPGSK VSEASSK+G+A V PV Sbjct: 60 EASSAEIKTLVKDRKEDGLKKHSTAVHKLLEELVKIEFPGSKAVSEASSKFGAASVPGPV 119 Query: 121 FFVFEKVSTFI 131 FF+FEKVSTFI Sbjct: 120 FFIFEKVSTFI 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7121 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 205 3e-55 >Cs101477 Length = 242 Score = 205 bits (522), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 117/193 (60%), Positives = 132/193 (68%), Gaps = 23/193 (11%) Query: 31 KRGFSETESKISTDTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHXXXXXX 90 KRGF++T VDLKLNLS +KE +GG D I K K Sbjct: 39 KRGFADT----------VVDLKLNLS--TKE---SGGIDVI------EKTKGKSASATGA 77 Query: 91 XXXXXXXXXXQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAP 150 QVVGWPPVRSFRKN+ VQK + +G+++ + +N A VKVSMDGAP Sbjct: 78 TDLSKPPAKSQVVGWPPVRSFRKNIMA-VQKDNEEGDNKASSSSSSNVA-FVKVSMDGAP 135 Query: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYE 210 YLRKVDLK+YKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNESKL+D+LNGSDY PTYE Sbjct: 136 YLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE 195 Query: 211 DKDGDWMLVGDVP 223 DKDGDWMLVGDVP Sbjct: 196 DKDGDWMLVGDVP 208 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22063 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29817 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812271 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21393 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26884 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9236 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 95 4e-22 >Cs169106187 Length = 148 Score = 95.1 bits (235), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 50/148 (33%), Positives = 79/148 (53%), Gaps = 3/148 (2%) Query: 1 MSSPSKRREM-DLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAY 59 M+S +E+ DL K + + + M + GP+DS Y GGV+ + + P Y Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 60 PYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDP 119 P+K P + F K++HPN++ +GS+CLD++ + WSP + V + + LL PNP DP Sbjct: 61 PFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDP 118 Query: 120 LNGEAAALMMRDRPAYEQRVKEFCLKYA 147 L E A + D+ YE + + KYA Sbjct: 119 LVPEIAHMYKSDKAKYESTARSWTQKYA 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30431 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10382 (351 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24860 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18960 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs51332 125 1e-31 >Cs51332 Length = 318 Score = 125 bits (315), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 64/145 (44%), Positives = 97/145 (66%), Gaps = 6/145 (4%) Query: 1 MTGVPTKMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYR 60 +GV T M+T+N +V+M N TFFG+HV+S P+ L YSEI +A+G ++K+YQ RKS + Sbjct: 175 FSGVATDMITVNSTVKMIYRNTGTFFGVHVTSNPLDLSYSEITIASGAIRKFYQSRKSQK 234 Query: 61 NVTVNLQGIKVPLYGAGASLAVSDNNGG----VPMMLVFEVRSRGNVVGRLVRSKHRRHV 116 VTV + G K+PLYG+GA L+++ G VP+ L F VRSR V+G+LV+ K +++ Sbjct: 235 TVTVAVMGNKIPLYGSGAGLSINSTTGSTSHPVPLNLNFVVRSRAYVLGKLVKPKFYKNI 294 Query: 117 SCTMEVGSHS-STPIKLKTSSCTYK 140 +C++ + P+ LK +SCTY Sbjct: 295 ACSITFDPKKLNVPVSLK-NSCTYD 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29178 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7674 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13087 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 86 3e-19 >Cs25409 Length = 359 Score = 86.3 bits (212), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 36/68 (52%), Positives = 50/68 (73%), Gaps = 4/68 (5%) Query: 6 IGKPSERNEIKYKGVRKRKWGKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRG 65 + KP++ Y+GVR+R WGKWV+EIRLP +R R+WLG++D E+AA A+D A + LRG Sbjct: 159 VAKPTKL----YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRG 214 Query: 66 HTAKFNFP 73 A+ NFP Sbjct: 215 EFARLNFP 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19737 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21204 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6335 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18120 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4779 (606 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 105 1e-24 >Cs24180 Length = 294 Score = 105 bits (262), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 91/302 (30%), Positives = 141/302 (46%), Gaps = 49/302 (16%) Query: 150 NKYEMGEEVGRGHFGYTCKATFKKGELKGQQAAVKVIPKAKMTTAIAIEDVRREVKILRA 209 ++YE E++G G +G KA + + + A+K I + + +R E+ +L+ Sbjct: 2 DQYEKVEKIGEGTYGVVYKA---RNCVTNETIALKKIRLEQEDEGVPSTAIR-EISLLKE 57 Query: 210 LSGHDNLVKFYDAYEDQENVYIVMELCEGGELLDRILARGGKYTEDDA------RTVMTQ 263 + H N+V+ D ++ +Y+V E LD L + D A +T + Q Sbjct: 58 MQ-HGNIVRLQDVVHSEKKLYLVFEY------LDLDLKKHMDSCPDFANDPRLIKTFLYQ 110 Query: 264 ILNVVAFCHLQGVVHRDLKPENFLFTSKDEDSQLKAIDFGLSD-FVKPDERLNDIVGSAY 322 IL +A+CH V+HRDLKP+N L + + LK DFGL+ F P V + + Sbjct: 111 ILRGIAYCHSHRVLHRDLKPQNLLIDRR--TNALKLADFGLARAFGIPVRTFTHEVVTLW 168 Query: 323 YVAPEVL--HRSYATEADVWSVGVIAYILLCGSRPFWARTES-----GIFRVV------- 368 Y APE+L R Y+T DVWSVG I + + RP + IFRV+ Sbjct: 169 YRAPEILLGSRHYSTPVDVWSVGCI-FAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEDT 227 Query: 369 ---LKADPSFDE--PPWPS--LSTEAR-------DFVKRLLNKDPRKRMTAAQALCHPWL 414 + + P F P WPS L T R D + ++L DP +R+TA AL H + Sbjct: 228 WPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYF 287 Query: 415 KN 416 ++ Sbjct: 288 RD 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5899 (524 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99071 226 4e-61 >Cs99071 Length = 150 Score = 226 bits (576), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 107/122 (87%), Positives = 115/122 (94%) Query: 334 MAPSDEAELMNMVATAAAIDDRPSCFRFPRGNGIGALLPANNKGTALEVGKGRILMEGSR 393 MAPSDEAELM+MVATAA IDDRPSCFRFPRGNGIGA+LP NNKGT LE+GKGRILMEG R Sbjct: 1 MAPSDEAELMHMVATAAVIDDRPSCFRFPRGNGIGAVLPPNNKGTPLEIGKGRILMEGDR 60 Query: 394 VAILGYGSIVQQCVKAANNLKTRDISVTVADARFCKPLDTELIKQLAKEHEILITVEEGS 453 VAILGYGSIVQQCV AAN LK++DISVTVADARFCKPLDT+LI+QLA EHEILITVEEGS Sbjct: 61 VAILGYGSIVQQCVLAANMLKSQDISVTVADARFCKPLDTDLIRQLANEHEILITVEEGS 120 Query: 454 IG 455 +G Sbjct: 121 VG 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12925 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48261349 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2672 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91044742 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25685 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs167106188 113 1e-27 >Cs167106188 Length = 229 Score = 113 bits (283), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 3/79 (3%) Query: 1 MTTSSKGNNN---ASSVVQVQEQAAGSHECCMCGDFGFSYELFVCKVCQFRSQHRYCSNL 57 MTT+ + N+N A+S Q QA+ ECCMCGD+G S ELF CKVCQFRSQHRYCSNL Sbjct: 1 MTTNKEANSNIIAATSAKDSQSQASCPAECCMCGDYGVSNELFRCKVCQFRSQHRYCSNL 60 Query: 58 YPNAESYRICNWCLTQKED 76 YP AESY++CNWCL+Q+++ Sbjct: 61 YPKAESYQVCNWCLSQRDE 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15104 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84445 164 8e-43 >Cs84445 Length = 149 Score = 164 bits (416), Expect = 8e-43, Method: Compositional matrix adjust. Identities = 73/81 (90%), Positives = 79/81 (97%) Query: 191 MKQRYVGHCNVGTDIKQASFLGQRGEYVASGSDDGRWFVWEKRTGRLIKMLQGDEAVVNC 250 MKQRYVGHCNVGTDIKQASFLGQRG+Y+ASGSDDGRWF+WEK+TGRLIKML GDEAVVNC Sbjct: 1 MKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAVVNC 60 Query: 251 VQCHPVDCVVATSGIDNTIKV 271 VQCHP DCVVATSGID+TIK+ Sbjct: 61 VQCHPFDCVVATSGIDSTIKI 81 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31405 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30223 59 8e-11 >Cs30223 Length = 379 Score = 58.5 bits (140), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 68/304 (22%), Positives = 116/304 (38%), Gaps = 42/304 (13%) Query: 22 PLDLIKVRMQLQGESNPARAAAPQPIHNLRPAFAYNSHSATLVXXXXXXXTVRAGPISVG 81 PLD+IK R+Q+ G P+ H+ R R I + Sbjct: 43 PLDVIKTRLQVHG--------LPEGTHSGR----------------------RGSIIIIS 72 Query: 82 VK-IFQTEGVKALFSGVSATVLRQTLYSTTRMGLYEILKVKWADPNSGN--LPLARKIFX 138 ++ I + EG+K L+ G+S T+L +YE LK GN L + + + Sbjct: 73 LQNILKNEGLKGLYRGLSPTLLALLPNWAVYFAVYERLKGLLRTHGDGNSQLSVGKNMIA 132 Query: 139 XXXXXXXXXXXXXXXXXXMVRMQAGGRD-----YKNVIDAISKMARSEGVLSLWRGSSLT 193 R+Q G YK+++ A+ +++ EG+ L+ G + Sbjct: 133 AAGAGAATAITTNPLWVVKTRLQTQGMRSNVVPYKSILSALRRISHEEGMRGLYSGILPS 192 Query: 194 VNRAMIVTASQLASYDQIKEAIL---DRHLMKDGLGTHVTXXXXXXXXXXXXXNPIDVIK 250 + V A Q +Y++IK + D + K G+ + P +V++ Sbjct: 193 LAGVSHV-AIQFPAYERIKHYMAKKDDTDVDKLNPGSVMIASSIAKVLASVITYPHEVVR 251 Query: 251 TRVMNMKVEAGRDPPYTGALDCALKTVRAEGPMALYKGFIPTISRQGPFTVVLFVTLEQI 310 +R+ D Y G +DC K + EG Y+G + R P V+ F + E I Sbjct: 252 SRLQEQGQNRKVDVQYAGVVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAVITFTSYEII 311 Query: 311 RKVL 314 + L Sbjct: 312 QSFL 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748637 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64410 226 6e-62 >Cs64410 Length = 147 Score = 226 bits (577), Expect = 6e-62, Method: Compositional matrix adjust. Identities = 114/139 (82%), Positives = 120/139 (86%), Gaps = 8/139 (5%) Query: 1 MEGWDPNTKSTLTQIPLLTTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60 MEGWDPNTKSTLTQIPLL+TKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA Sbjct: 1 MEGWDPNTKSTLTQIPLLSTKAGPRDGAAWTQRLKEEYKALIAYTQMNKSNDNDWFRISA 60 Query: 61 ANPEGTRWTGKCWYVYNLLKYEFDLQFDIPITYPATAPELELPQLDGKTQKV--GLILIL 118 ANPEGTRWTGKC YV+NLLKYEFDLQFDIP+TYPATAPELELPQLDGKTQK+ G + L Sbjct: 61 ANPEGTRWTGKCRYVHNLLKYEFDLQFDIPVTYPATAPELELPQLDGKTQKMYRGGKICL 120 Query: 119 RFSLFP------HFCFLIV 131 P +FCF V Sbjct: 121 TVHFKPLWAKNWYFCFTFV 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48408266 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23635 122 6e-31 >Cs23635 Length = 278 Score = 122 bits (307), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 59/97 (60%), Positives = 74/97 (76%) Query: 1 MSDTLSAAQTYEFLRKWLMDHPKFFNNQLYVAGDSYSGIVVPIIVQEISDGNHDDNVPPI 60 M+DTLSAAQ Y FLRKWL+ HP F N LY+ GDSYSGI+VP+IVQ ISDG + P + Sbjct: 141 MNDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRM 200 Query: 61 NIKGYVLGNPATDLDKDEDSRILFAYLKALISDELYQ 97 N+KGY+LGNP TD ++++S FAYL ALIS E+Y+ Sbjct: 201 NLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYE 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9925 (465 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3798 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27037 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25063 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12120 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9746 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85196 135 2e-34 >Cs85196 Length = 149 Score = 135 bits (340), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 69/142 (48%), Positives = 96/142 (67%) Query: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 LT + E KEAF LFD DG G I KEL MR+LG TE ++ MI +VD DG+G I Sbjct: 5 LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64 Query: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 DF EF ++M K+ + D++EEL +AF++ D D+NG ISAA+++ + +LGE TD E+ E Sbjct: 65 DFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE 124 Query: 141 MIEEADRDRDGEVNADEFIRMM 162 M EAD D DG +N +EF+++M Sbjct: 125 MXREADVDGDGXINYEEFVKVM 146 Score = 57.8 bits (138), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 44/66 (66%) Query: 27 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAIDFDEFA 86 +E+KEAF +FD D +G I A EL M LG ++T+E++ +M + D DG G I+++EF Sbjct: 84 EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMXREADVDGDGXINYEEFV 143 Query: 87 HMMTAK 92 +M AK Sbjct: 144 KVMMAK 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11115 (331 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7520 (419 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91356 124 2e-30 >Cs91356 Length = 433 Score = 124 bits (310), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 99/289 (34%), Positives = 142/289 (49%), Gaps = 21/289 (7%) Query: 119 VAALVVDFFCVSMIDVAKELNLPSYLFMPSNAGYLALMLQLPILHEKNQVAVE---ESDP 175 V L+ D VA L LP + S+ IL EK +A + SD Sbjct: 84 VTCLITDAIWHFAQTVADTLRLPRIVLRTSSISSFLAFSAFQILLEKGYLAEQVSFSSDS 143 Query: 176 EWLIPGIVHPVPP---RVLPMALTDGSRPAYIKLASRFRETR---GIVANTFVELETHAI 229 + P V +PP + +P+ +T +R + +++ +T+ G++ N+F +LE + Sbjct: 144 QLEKP--VTELPPLRVKDIPIIVTHDTRNFHQLISAVVSKTKACSGLIWNSFEDLEQTEL 201 Query: 230 TLFSNDTRIPPVYPVGPGIDLDDGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGS 289 T D IP ++P+GP A S+ +Q I WLD Q KSV+++ FGS+ Sbjct: 202 TRLHKDFPIP-MFPIGPFHKY--CLASSSSLLSQDQSCISWLDKQAAKSVMYVSFGSIVV 258 Query: 290 FRAEQVKEIALGLEQSGQRFLWSLRMQPPKGTVPSDCSNLEEVFPDGFLERTNGKKGLIC 349 + EIA GL S FLW +R G VP E P GFLE +G+ G I Sbjct: 259 VNVTEFLEIAWGLANSRVPFLWVVR----PGLVPG--VEWLEPLPKGFLEMLDGR-GHIV 311 Query: 350 GWAPQEEVLAHSATGGFLSHCGWNSILESLWHGVPIATWPMYAEHQLNA 398 WAPQ+EVLAH A GGF +H GWNS LES+ GVP+ P + + +NA Sbjct: 312 KWAPQQEVLAHPAVGGFWTHNGWNSTLESICEGVPMICQPCFGDQLVNA 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16098 (339 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17391 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742802 (45 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748171 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17314 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10510 (330 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs62644 63 4e-12 >Cs62644 Length = 272 Score = 62.8 bits (151), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Query: 259 DDYSWRKYGQKPIKGSPHPRGYYKCSS--VRGCPARKHVERALDDAAMLVVTYEGEH 313 D ++WRKYGQK I + HPR Y++C+ V+GC A K V+R DD M TY G H Sbjct: 136 DGHAWRKYGQKEILNTKHPRSYFRCTHKYVQGCRATKQVQRRDDDPQMYDTTYIGHH 192 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753563 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19280 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6064 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263478 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13107 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25792 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27485 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764350 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17999 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9623 (673 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs83759 115 1e-27 >Cs83759 Length = 140 Score = 115 bits (289), Expect = 1e-27, Method: Composition-based stats. Identities = 60/111 (54%), Positives = 75/111 (67%), Gaps = 5/111 (4%) Query: 483 YLPEIFPKLNKVLFLDDDVVVQKDLTAVWSLDLKGNVNGAV--ETCGESF---HRFDRYL 537 Y+PE+FP LNK+LFLDD VVVQ DL+++ LDL G V GAV CG++ ++ YL Sbjct: 11 YIPELFPDLNKILFLDDAVVVQHDLSSLLELDLNGKVVGAVVGSLCGDNCCPGRKYKDYL 70 Query: 538 NFSNPLISKNFDAHACGWAYGMNIFDLKEWKKQNITEVYHGWQKLNHDRQL 588 NFS P+IS NFD C W YGMN+ DL+ W++ NIT YH W KL H QL Sbjct: 71 NFSYPIISSNFDHDHCAWLYGMNVLDLEAWRRTNITATYHKWLKLEHFHQL 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2902 (228 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20530 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48390652 (64 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46607608 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5266 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5745 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9413 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25148 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20341 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25592 170 1e-44 >Cs25592 Length = 183 Score = 170 bits (430), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 115/192 (59%), Positives = 134/192 (69%), Gaps = 15/192 (7%) Query: 1 MKGRVRWDEANIGEIEANKPVRQKITEPKTPYHPMMTDDEYGSLSPMRGGTFDDCV---G 57 MKGRVRWDE N+GEIEANKPVRQKITEPKTPYHPM+ DD+Y SP R G+FD CV Sbjct: 1 MKGRVRWDEDNLGEIEANKPVRQKITEPKTPYHPMIDDDDY--TSP-RQGSFDQCVDAIA 57 Query: 58 DADHAEAIRTALSDVASSSRKSTQRSTGWTSSEDEADTMEQDDEDSEKSK---SFREHRR 114 D +AE +RTAL+DVASSS K+T +S GWTSSEDEAD ME++DEDSE + SFREHR+ Sbjct: 58 DGMNAEELRTALNDVASSSGKTTGKS-GWTSSEDEADPMEEEDEDSEMDRGSVSFREHRK 116 Query: 115 AHYDEFQKVKELRRKASLLXXXXXXXXXXXXXXXXXXXSGSSSLTAGVKEIDIDEDGTSS 174 AHYDEF +VKEL R+ S+L SSSL+AGVK IDI+ D + Sbjct: 117 AHYDEFLRVKELLREGSVLEEEDEDNGNGKANDGICDS--SSSLSAGVKCIDIERDTATP 174 Query: 175 TKNSSVPPANGA 186 S PPANGA Sbjct: 175 ---QSEPPANGA 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226795738 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7498 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12106 (334 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3789 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19861 (370 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31805 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4146 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs162106182 70 1e-14 >Cs162106182 Length = 107 Score = 70.5 bits (171), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 46/78 (58%) Query: 138 KSYCPYCLRAKRMFAELHEHPFVVELDLRDDGAQIQSVLLDVVGRTTVPQIFVNGKHIGG 197 K+ CP+C+ K +F +L +ELD DG+ IQS L + G+ TVP +F+ GKHIGG Sbjct: 20 KTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGG 79 Query: 198 SDDLKAAVLSGQLQKLLS 215 D A G+L LL+ Sbjct: 80 CDSTTALHREGKLVPLLT 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812193 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15327 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 112 3e-27 >Cs48454 Length = 244 Score = 112 bits (279), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 65/169 (38%), Positives = 101/169 (59%), Gaps = 2/169 (1%) Query: 1 MVRKKVEMKRIENNTSRQVTFSKRRKGLLKKAYELSVLCDAEVAVIVFSQKGRIYEFSS- 59 M R +V++KRIEN +RQVTFSKRR GLLKKA+E+SVLCDAEVA+IVFS KG+++E+S+ Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 60 SDMQRTINRYHKHENGSGPTNKVEVEQYVQHLXXXXXXXXXXXXXXXXSQRKLLGNDLDS 119 S M+R + RY ++ E+E + +Q+ +G DL Sbjct: 61 SCMERILERYERYCYAERQLQANEIEPN-GNWTLEYSKLKARMEVLQRNQKHFMGEDLAD 119 Query: 120 CPVEELQEISSQLERSLRSISERKAQLYTEHMEQHKARERFLLQENAQL 168 ++ELQ + Q++ L+ I RK QL + + + + +++ L ++N L Sbjct: 120 LSLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQNNLL 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18565 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26462 (338 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5729 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11429 (321 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48386554 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27915 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10166 (230 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391848 (61 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8351 (612 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32119 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67211 63 1e-12 >Cs67211 Length = 534 Score = 62.8 bits (151), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query: 84 CCICLAKYADDDELRELPCLHVFHVECVDKWLK-INASCPLCKSEAGESSGEARDS 138 C ICLA+Y + D +R LPC H +H+ CVDKWLK I+ CPLC+ + + + E+ +S Sbjct: 474 CYICLAEYEEGDRIRLLPCHHEYHMSCVDKWLKEIHGVCPLCRRDVRQGATESSNS 529 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2613 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30148 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10163 162 4e-42 >Cs10163 Length = 156 Score = 162 bits (410), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 74/137 (54%), Positives = 101/137 (73%) Query: 161 SNRRLHRYDQYGGSDFVEEAKHLKQMFILRLYMELHAGGWPLILLSRKPEAERNSSIEDL 220 SN + R + +G + +EEAKHLK MF L+L+M+L GWP+ILLSRK E +RN++ E L Sbjct: 14 SNLLIDRVNVHGYIECIEEAKHLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRNATTELL 73 Query: 221 ISAGYRAWSSLIMRSEDELHMESHDYFSKRRDAMQKEGFRAIASVSSHMDALRSPFSGER 280 ISAGYR WSSLIMR ++E+ M+S +Y S+RR +QKEGF +S+ MDAL G+R Sbjct: 74 ISAGYRGWSSLIMRLDNEMQMDSREYLSRRRAILQKEGFHITGLISNQMDALIGQSLGKR 133 Query: 281 IFKLPNPIFYNFSHQIE 297 +FK+PNP++Y+F HQIE Sbjct: 134 VFKIPNPLYYSFDHQIE 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13560 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17501 (39 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7849 (333 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14765 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47367 84 1e-18 >Cs47367 Length = 140 Score = 84.0 bits (206), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/113 (41%), Positives = 63/113 (55%), Gaps = 2/113 (1%) Query: 50 ITAGCDILLMPSRFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGW 109 I AG D +L+PSRFEPCGL QL+AMRYGTVP+V STGGL DTV Q G Sbjct: 2 IIAGADFILIPSRFEPCGLIQLHAMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCE 61 Query: 110 TFSPLTKESMLAALKLACRTFREYKPSWEGLMKRGMERDFTWESAAIKYERVF 162 P+ ++ ++ A T+ + +MK GM +D +W+ A K+E Sbjct: 62 AVDPVDVAAVSTTVRRALATYGTQ--ALAEMMKNGMAQDLSWKGPAKKWEETL 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22425 (431 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825516 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22065 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11175 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32802 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20614 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25574 (534 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22156 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 404 e-115 >Cs36106190 Length = 283 Score = 404 bits (1037), Expect = e-115, Method: Compositional matrix adjust. Identities = 208/281 (74%), Positives = 220/281 (78%), Gaps = 6/281 (2%) Query: 6 EVAERGS----FPAKDYHDPPPAPLFDPAELAKWSFYRALIAEFXXXXXXXXXXXXXXIG 61 EV E G KDY DPPPAPL D AEL WSFYRALIAEF IG Sbjct: 4 EVNEEGQTHRHHHGKDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVATVIG 63 Query: 62 YKSQTELDNCGGVGTLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLCLARKVSPVRA 121 +K Q+ D CGGVG LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGL LARKVS +RA Sbjct: 64 HKKQS--DACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRA 121 Query: 122 VLYMVAQSLGAIAGVALVKAIQKSYYTKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTV 181 V YMVAQ LGAI GV LVKA K Y GGGAN+++ GY+ G L AEIIGTFVLVYTV Sbjct: 122 VAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLVYTV 181 Query: 182 FSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGPAVIFNQDKAW 241 FSATDPKRSARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS G AVI+N DKAW Sbjct: 182 FSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNDKAW 241 Query: 242 DDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSHPS 282 DD WIFWVGPF+GA AA YHQ+ILRA A KALGSFRS+PS Sbjct: 242 DDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSNPS 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12962 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17147 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22807 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5939 (292 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6728 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27027 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29186 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21228 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 79 6e-17 >Cs60106184 Length = 168 Score = 78.6 bits (192), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 36/76 (47%), Positives = 50/76 (65%) Query: 44 KLFIGGVSYQTDDQSLREAFQKYGEVVDARIIMDRESGRSRGFGFVTFTSNXXXXXXXXX 103 + F+GG+++ T D SL EAF YG++++++II DRE+GRSRGFGFVTF Sbjct: 9 RCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEG 68 Query: 104 XDGQELHGRRVRVNYA 119 +GQ L GR + VN A Sbjct: 69 MNGQNLDGRNITVNEA 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6269 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42594 97 9e-23 >Cs42594 Length = 166 Score = 97.1 bits (240), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 55/102 (53%), Positives = 64/102 (62%), Gaps = 9/102 (8%) Query: 35 ADKSRRKLAKN---AKLGKK------DPNKPKRPASAFFVFLEEFRTVYKKEHPNVKAVS 85 +D + KL+ N AK G+K DPNKPKRPASAFFVF+EEFR YKK+HP K+V+ Sbjct: 8 SDTTNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVA 67 Query: 86 AVGKAGGEKWKSMSXXXXXXXXXXXXXXXTEYEKLMKAYNNK 127 AVGK GGEKWKSMS EYEK MK YN + Sbjct: 68 AVGKTGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14104 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs43896 59 7e-11 >Cs43896 Length = 166 Score = 58.5 bits (140), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 3/115 (2%) Query: 135 IKGLLGSIPDNAFQKNLVGTDWSINYRLASVFLGGLKLASVGFISSIAAVAASNGLFAVR 194 I+ GS+P + F+ G +S+ R+A+ F G+ SVGF+ I +N + + Sbjct: 21 IQNACGSLPSSVFEAERPGCRFSVKQRIATYFYKGVLYGSVGFVCGIIGQGIANLIMTAK 80 Query: 195 KFINPTLISDQEKKRTPILKTAIIYSSFLGTSANLRYQIIAGVIEHRISDEFASQ 249 + I S+ + P++K+A ++ FL S+N+RYQI+ G+ S A Q Sbjct: 81 RNIKK---SEYDIPVPPLVKSAALWGVFLAVSSNIRYQIVNGLERIVESSPLAKQ 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10171 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24080 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9795 (400 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925660 (214 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14309 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6611 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs13890 352 4e-99 >Cs13890 Length = 225 Score = 352 bits (902), Expect = 4e-99, Method: Compositional matrix adjust. Identities = 189/223 (84%), Positives = 208/223 (93%) Query: 62 LGGNGFVGSHVCREALDRGLSVASLSRSGRSKLHDLWANSVTWHQGNLLSPESLKDAFNG 121 LGGNGFVGSH+CREALDRGL+VASLSRSGRS L D WAN+V WHQGNLLS +S K+A +G Sbjct: 1 LGGNGFVGSHICREALDRGLTVASLSRSGRSSLRDSWANNVIWHQGNLLSSDSWKEALDG 60 Query: 122 VTSVISCVGGFGSNSYMYKINGTANINAIRVAAEQGVKRFVYISAADFGVANYLLQGYYE 181 VT+VISCVGGFGSNSYMYKINGTANINAIR A+E+GVKRFVYISAADFGVANYLLQGYYE Sbjct: 61 VTAVISCVGGFGSNSYMYKINGTANINAIRAASEKGVKRFVYISAADFGVANYLLQGYYE 120 Query: 182 GKRAAETELLTKFPYGGVILRPGFIYGTRSVGSLKIPLGVIGSPLEMLFQNTRPLSQLPL 241 GKRAAETELLT++PYGGVILRPGFIYGTR+VG +K+PLGVIGSP+EM+ Q+ +PLSQLPL Sbjct: 121 GKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKLPLGVIGSPMEMVLQHAKPLSQLPL 180 Query: 242 VGPLFTPPVNVTSVANVAVRAATDPVFPPGIVDVQGIQRYTQK 284 VGPLFTPPVNVT VA VAVRAATDPVFPPGIVDV GI RY+QK Sbjct: 181 VGPLFTPPVNVTVVAKVAVRAATDPVFPPGIVDVHGILRYSQK 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9638 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9983 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18841 (355 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41093 367 e-103 >Cs41093 Length = 250 Score = 367 bits (941), Expect = e-103, Method: Compositional matrix adjust. Identities = 183/253 (72%), Positives = 213/253 (84%), Gaps = 5/253 (1%) Query: 11 EEVSNKQVLLKEHLMSGNPKDSNMCVSTSKIKLKLPRGFTGVLLKNLYLSCDPYMAARMK 70 E V NKQV+LK+ +SG PK+++M ++ S I+LK+P+G GVLLKNLYLSCDPYM RM Sbjct: 3 ELVRNKQVILKD-FVSGFPKETDMYMTESSIELKVPKGSNGVLLKNLYLSCDPYMRPRMT 61 Query: 71 KLDASSSYALDMYRPGQPISGYGVSKVLDSGHPKFAKGDLVWGFTGWEEYSVITATESLI 130 ++ S ++ ++PG PISGYGV+KVLDS +P+F+KGDLVWG TGWEEYS+ITA L Sbjct: 62 YIEGSY---VESFKPGLPISGYGVAKVLDSENPEFSKGDLVWGMTGWEEYSLITAP-YLF 117 Query: 131 KIQHTDVPLSYYTGILGMNGMTAYAGFYEVCSPKPGEKVFVSAAAGAIGQLVGQFAKLSG 190 KIQHTDVPLSYYTGILGM GMTAY GFYEVCS K GE VF+SAA+GA+GQLVGQFAKL G Sbjct: 118 KIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSAKHGECVFISAASGAVGQLVGQFAKLLG 177 Query: 191 CYVVGTAGSKKKVDLLKNKFGFDEAFNYKEETDLVVALKRYFPEGIDIYFESVGGKMLDA 250 CYVVG+AGSK KVDLLKNKFGFDEAFNYKEE DL ALKRYFPEGID+YFE+VGGK LDA Sbjct: 178 CYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDVYFENVGGKTLDA 237 Query: 251 VLLNMRFKGRIAA 263 VL NM+ +GRIAA Sbjct: 238 VLPNMKIRGRIAA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54620195 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2940 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs75694 67 3e-13 >Cs75694 Length = 102 Score = 67.0 bits (162), Expect = 3e-13, Method: Composition-based stats. Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 2/81 (2%) Query: 234 RGLSADTIASLPSVSYKTGSS-QNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNW 292 R L + + +LP + + SS Q E+C IC D++DGE L +LSCKH +H+ C+++W Sbjct: 15 RRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHEFHASCVDSW 74 Query: 293 LT-INKICPVCSAEVSTSGNS 312 LT CPVC ++ + S Sbjct: 75 LTKWGTFCPVCKHDMRNNSES 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9199 (466 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8274 (386 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42822 195 7e-52 >Cs42822 Length = 333 Score = 195 bits (495), Expect = 7e-52, Method: Compositional matrix adjust. Identities = 126/385 (32%), Positives = 179/385 (46%), Gaps = 56/385 (14%) Query: 4 ISERSRTSQVITCKAVVCWGVGEAWKVEEIEVEPPKRSEVRVKMLYASLCHTDILISKGH 63 +S + QVITCKA V WG G+ VEE+EV PP+ E+R+K++ SLC +DI + Sbjct: 1 MSTSIKQPQVITCKAAVAWGAGQPLVVEEVEVNPPQPEEIRIKVVCTSLCRSDITAWETQ 60 Query: 64 PIPLFPRVLGHEGVGVVESIGEDVRNINGGDVVIPTFVSXXXXXXXXVSGKTNMCLKNPL 123 I FPR+ GHE G+VES+G V N G+ V+ F+ S K+N C L Sbjct: 61 AI--FPRIFGHEASGIVESVGPGVTEFNEGEHVLTVFIGECKTCRQCKSDKSNTCEVLGL 118 Query: 124 PFSGLM-PDGTSRMSVAGQKLYHLFSCSTLSEYMVVNVNYLLKLPGISTTSPSLPHASFL 182 G+M D +R S+ Sbjct: 119 ERRGVMHSDQQTRFSIK------------------------------------------- 135 Query: 183 SCGFSTGFGAPWKEAKVEKGSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKNERKKGKG 242 G GA W A + KGST D N K K Sbjct: 136 ------GLGAAWNVADISKGSTVVIFGLGTVGLSVAQGAKARGASRIIGVDTNPEKCEKA 189 Query: 243 EAFGMTDFINPDDDGDCKSVSELIKHSTAGMGVDYCFECTGFAPFINEALEATKLGTGKA 302 +AFG+T+F+NP+D+ + V ++IK T G G DY FEC G I AL++ G G A Sbjct: 190 KAFGVTEFLNPNDNNE--PVQQVIKRITDG-GADYSFECIGDTGMITTALQSCCDGWGLA 246 Query: 303 IVIGT-STATSVQINSLPLLCGRTLKGSIFGGLKPKTDLPVIIDKWMNKDMHLDELLTHE 361 + +G V + L GRTLKGS+FGG KPKTDLP ++++++ K+ +DE +TH Sbjct: 247 VTLGVPKLKPEVAAHYGLFLSGRTLKGSLFGGWKPKTDLPSLVNRYLKKEFMVDEFITHN 306 Query: 362 VPLIDINQALELLRHPDCVKVLIKI 386 + DINQA L++ C++ +I + Sbjct: 307 LLFEDINQAFNLMKEGKCLRSVIHM 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824541 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040105 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815077 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15446 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs38703 86 5e-19 >Cs38703 Length = 93 Score = 85.5 bits (210), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 40/77 (51%), Positives = 52/77 (67%) Query: 112 ADVDGNGVLDYGEFAAVTIHLQKLENDEHLHKAFVFFDKDGSGYIXXXXXXXXXXXXXXX 171 ADVDG+G L+YGEF AV++HL+K+ NDEHLHKAF FFD++ SG+I Sbjct: 4 ADVDGDGSLNYGEFVAVSVHLKKMANDEHLHKAFSFFDRNQSGFIETEELQNALNDEVDT 63 Query: 172 TDIEVLNDIMREVDTDK 188 + V+N IM +VDTDK Sbjct: 64 SSENVINAIMHDVDTDK 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121754 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 116 7e-29 >Cs169106187 Length = 148 Score = 116 bits (290), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 49/102 (48%), Positives = 69/102 (67%) Query: 5 ARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYP 64 A KR++++ K LQ+DPP S P ++ W A I GP D+P+ GG F +T+ F DYP Sbjct: 2 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYP 61 Query: 65 NKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 KPP V F +++FHPNI ++GSICLDIL+ QWSP ++ +L Sbjct: 62 FKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29024 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4317 398 e-113 >Cs4317 Length = 283 Score = 398 bits (1023), Expect = e-113, Method: Compositional matrix adjust. Identities = 187/278 (67%), Positives = 226/278 (81%), Gaps = 1/278 (0%) Query: 3 AATKSSIFAASTQHLPTIPSIFGSKASPPVSNTLASSFRGSSLARCPSIRKKVVKGNAKV 62 AAT SIFAAS+Q S+ A+P VS+TL SSF+G+ L R +KK V+ KV Sbjct: 2 AATAGSIFAASSQFASATRSVSCRNATPSVSSTLGSSFKGALLPRSSPKQKKTVRITEKV 61 Query: 63 SAAATTFAPTPVEEPKEFSLPSWAMFELGRAPVYWKTMNGLPPTAGEKLRIFYNPAANKI 122 +AA TT A P EE +E++ PSWAMFELG+APVYWKTMNGLPP +GEKL+IFYNP A K+ Sbjct: 62 TAAVTT-ATNPYEEIEEYTRPSWAMFELGKAPVYWKTMNGLPPMSGEKLKIFYNPYAKKL 120 Query: 123 VPNEEYGIAFNGGFNQPIMCGAEPRAMLSISRGKADSPMYSIQICIPRHALNLIFSFTNG 182 +PNE++GI FNGGFNQP MCG EPRAML +RG+ DSP Y+IQIC+P+HA+NLIFSFTNG Sbjct: 121 LPNEDFGIGFNGGFNQPFMCGGEPRAMLRKNRGQNDSPFYTIQICVPKHAINLIFSFTNG 180 Query: 183 VDWDGPYRLQFQVPNGLKNKPIEFFNEGLAEELSKDGACERAIFPDTFVVVTRCNIIGNL 242 V+WDGPYR++F VP +NKP++FFN+GLA++LSKDGACE+AIFPDT VVV RC +IGNL Sbjct: 181 VEWDGPYRIKFLVPRAWRNKPMDFFNKGLADQLSKDGACEKAIFPDTDVVVDRCVLIGNL 240 Query: 243 TVEGGDRCNLNLVPGCTDPSSPSYDPLANVDDGSCPIE 280 EGGDRC+LNLVPGC DPSSP YDPLANVDDGSCP++ Sbjct: 241 AAEGGDRCDLNLVPGCMDPSSPLYDPLANVDDGSCPLD 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32258 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746664 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774769 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6115 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44142 119 5e-29 >Cs44142 Length = 180 Score = 119 bits (297), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 72/195 (36%), Positives = 110/195 (56%), Gaps = 31/195 (15%) Query: 99 MLSARDLSISWGSHPLYWTWRPCLQSRFAEVAELRTIWWLEICGTTNTQMLSQKTVYGAY 158 M+SARDL I W S YW W ++RF EVAEL + WLEI G +T+ LS T+Y AY Sbjct: 1 MISARDLLIIWSSTSAYWRWISIPEARFPEVAELIRVCWLEIRGKISTRSLSPGTLYTAY 60 Query: 159 LIIKIANRAYGLDTLPSEVSLEVGSYKSQG-SIYLSKRNDIKSG---------KQASSEH 208 L+ K+ +YG + P VS+ + + ++Q ++YL + ++ G QAS+ Sbjct: 61 LVYKLTAGSYGFEYQPVSVSVGLVNGETQTQTVYLHEERGLRQGYHGLLNRSSSQASTPK 120 Query: 209 E---HFPKVVRASRSRVLDEDRGGSKRGDGWMEVEIGSFYNGECDEKDVRMSLREVKGVH 265 E +FPK +R D W+E+E+G F+N E + ++ MS+ E+KG H Sbjct: 121 ENVCYFPK-----------------ERKDEWLEIELGDFFNEEDEHGELEMSVLELKG-H 162 Query: 266 LKAGLIVEGIELRPK 280 K GL+++GI++RPK Sbjct: 163 WKRGLVIQGIDIRPK 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4754 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10827 (320 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4986 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3379 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286303 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25772 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8555 (367 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74261 169 3e-44 >Cs74261 Length = 193 Score = 169 bits (429), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 76/137 (55%), Positives = 107/137 (78%) Query: 40 WAQMPQELLREVLVRIEASEAAWPPRKSVVACAGVCRSWRHLTKEIVKAPELSGKLTFPI 99 WA + ELL E++ R+E +E +WP R++VVACA VC+ WR +TK+IVK+P LSGK+TFP Sbjct: 57 WAGLLPELLGEIIRRVETTEDSWPHRQNVVACACVCKRWREITKDIVKSPFLSGKITFPS 116 Query: 100 SVKQPGPRDDLVQCFIKRNRSDQTYYLFLGLTPALIDEGKFLLAARKFKRPTCTDYVISL 159 +KQPGPR+ QC I+RN+ T+YL+L LTP+ ++GKFLLAAR+++R ++Y+ISL Sbjct: 117 CLKQPGPREFPHQCLIRRNKKTSTFYLYLALTPSFSEKGKFLLAARRYRRGAHSEYIISL 176 Query: 160 YADDMSKGSSYYVGKLR 176 A D+S+GS+ YVGKLR Sbjct: 177 DAGDLSQGSNAYVGKLR 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121400 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20782 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808433 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6029 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104090 277 1e-76 >Cs104090 Length = 227 Score = 277 bits (709), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 121/147 (82%), Positives = 135/147 (91%) Query: 223 VDKRFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGLPL 282 +DKRFKTLP E+LPRNE +GGYIFVCNNDTMQE+LKRQLFGLPPRYRDSVRAITPGLPL Sbjct: 73 LDKRFKTLPATETLPRNEVLGGYIFVCNNDTMQEDLKRQLFGLPPRYRDSVRAITPGLPL 132 Query: 283 FLYNYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEEDSF 342 FLYNY+THQLHGIFEA FGG+N DP+AWEDKKC GESRFPAQVR+ RK+C+ LEED+F Sbjct: 133 FLYNYTTHQLHGIFEATGFGGSNIDPTAWEDKKCKGESRFPAQVRIRVRKLCKALEEDAF 192 Query: 343 RPILHHYDGPKFRLELSVPEALSLLDI 369 RP+LHHYDGPKFRLELSVPE L L+D+ Sbjct: 193 RPVLHHYDGPKFRLELSVPETLDLMDL 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20067 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48488286 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7228 (400 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49233 96 6e-22 >Cs49233 Length = 326 Score = 95.9 bits (237), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 79/296 (26%), Positives = 137/296 (46%), Gaps = 47/296 (15%) Query: 64 LERAFTALQAWKSAISDDPSKILDSWVGPNVCS------YKGVFCSP--DSQEVTGIDLN 115 L+R AL K+++ +++ +WVG + C + GV CS D + VT +++ Sbjct: 25 LKRDVKALNEIKASLG---WRVVYAWVGDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVY 81 Query: 116 HANLKGXXXXXXXXXXXXXXXXXXXXRFSGQIPETLRDLTALQELDLSNNDFSGSFPTVT 175 ++ G P + +L L LDL NN +G P Sbjct: 82 AVSI------------------------VGPFPIAVTNLLDLTRLDLHNNKLTGPIPPQI 117 Query: 176 LQIPNLIYLDLRYNSYSGTIPGELFN-QKLDAIFLNNNNFEGEIPESLGN-SQASVINFA 233 ++ L L+LR+N IP E+ ++L + L+ NNF+GEIP+ + N + + Sbjct: 118 GRLKRLRILNLRWNKLQDVIPAEIGELKRLTHLSLSFNNFKGEIPKEIANLPELRYLYLQ 177 Query: 234 NNQFTGNLPASFGFMGTKLKEILFLNNRLTGCIPEGV---GIFTDVKVFDASHNSLMGHL 290 N+ TG +P G + + + NN L G I E + G F ++ ++N L G + Sbjct: 178 ENRLTGRIPPELGIL-PNFRHLDVGNNHLVGTIRELIRFEGSFPVLRNLYLNNNYLTGGV 236 Query: 291 PDTISCLEEIEVLNLAHNELSGVLPDLVCSLKSLENLTVAYNFFSGFSQECTKLPD 346 P ++ L +E+L L+HN++SG +P + + L L + +N FSG ++PD Sbjct: 237 PAQLANLTNLEILYLSHNKMSGTIPLALAHIPKLTYLYLDHNQFSG------RIPD 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31538 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31941 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489292 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76512 81 3e-18 >Cs76512 Length = 76 Score = 81.3 bits (199), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 41/75 (54%), Positives = 49/75 (65%) Query: 29 LDMAVLVDAQGDLLNNIETQVSSAVDHVQQGNNALQKAKKLQKSSRKWMCXXXXXXXXXX 88 +DMAVLV+AQG++L+NIE+QVS+AV +VQ G ALQ AKK QKSSRKWMC Sbjct: 1 MDMAVLVEAQGEILDNIESQVSNAVTNVQSGTTALQSAKKHQKSSRKWMCIAIIILLIIV 60 Query: 89 XXXXXXXXKPWSSNN 103 KPW S N Sbjct: 61 AVIVVGVIKPWKSGN 75 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226785200 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29065 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859309 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71818683 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21408 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26510 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92452 130 1e-32 >Cs92452 Length = 220 Score = 130 bits (326), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 64/107 (59%), Positives = 80/107 (74%), Gaps = 5/107 (4%) Query: 6 LAGQFG---DTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYGFV 62 +AG +G D+ K+FVGGLAWET +T++ YFEQFGDILEAVVIT K TGRSKGY FV Sbjct: 1 MAGAYGAEADSANRKLFVGGLAWETNSDTLRTYFEQFGDILEAVVITHKNTGRSKGYRFV 60 Query: 63 TFREAEAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGRR 109 TFR+ +A+RAC + +P+I GR+ANCNLA LG R++P P G R Sbjct: 61 TFRDPGSALRACANPSPMIGGRKANCNLAHLG--RTRPDLPSFGHPR 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32071 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78136 234 1e-63 >Cs78136 Length = 347 Score = 234 bits (597), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 114/175 (65%), Positives = 129/175 (73%), Gaps = 7/175 (4%) Query: 14 LELPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIREIDLYKFDPWQLPEMALYGEKEWY 73 L LPPGFRF+PTDEEL+ YLCRK A Q ++ II EIDLYKFDPW LP A++GEKEWY Sbjct: 12 LNLPPGFRFYPTDEELLVQYLCRKVAGQHFSLQIIGEIDLYKFDPWVLPSKAIFGEKEWY 71 Query: 74 FFSPRDRKYPNGSRPNRAAGTGYWKATGADKHI-GKPKALGIKKALVFYAGKAPKGIKTN 132 FFSPRDRKYPNGSRPNR AG+GYWKATG DK I + + +GIKKALVFY GKAPKG KTN Sbjct: 72 FFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITTEGRKVGIKKALVFYVGKAPKGTKTN 131 Query: 133 WIMHEYRLANVDRSAAAAKKNQNLRLDDWVLCRIYNKKGSIEKYNVTTKMTKYPE 187 WIMHEYRL R KN + +LDDWVLCRIY K +K T ++ E Sbjct: 132 WIMHEYRLFEPSR------KNGSSKLDDWVLCRIYKKHSGSQKPVSATSVSSSKE 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3455 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808946 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9602 (808 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12739 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6823 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19045 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18573 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12900 (322 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82779 128 1e-31 >Cs82779 Length = 314 Score = 128 bits (321), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 86/277 (31%), Positives = 142/277 (51%), Gaps = 12/277 (4%) Query: 37 ERQQIRETYKSIYGDDLVNRLKDAAAAGISPKLCAALSMWMTEQHERDAVVVREALDDQK 96 +R I++ Y+++Y +DL RL ++ +S KL A+ +WM + RDAVV+R +L Sbjct: 45 QRALIQQDYRAMYSEDLCKRL----SSELSGKLEMAVLLWMHDPAGRDAVVMRNSLTTG- 99 Query: 97 GDTNYNALVEIFVGRKSSHILLIKQAYYRRFWRQLDQDIINIEPPNPYQKILVALVASHK 156 + A E+ R S I LI+Q Y+ +F L+ DI ++K+L+A V+ Sbjct: 100 ---SLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKR-HTSGDHEKLLLAYVSPPW 155 Query: 157 AHHADVSQHIAKADARRLYETGEGSSGPIEEAVVLEILSKRSIPQLKLTFSCYKHIYGHE 216 +V + + + DA+ LY+ GE G +E + I +RS L Y ++G+ Sbjct: 156 NEGLEVDRQMVENDAKALYKAGEKRLG-TDERTFIRIFCERSRAHLAYVAPVYHSMHGNS 214 Query: 217 YTESLKTRNYGELENAMKMIVQCIYNPPDYFAMQMLYASMKGCISDEGAXXXXXXXXAEV 276 + +K G E + I++C NP YFA ++L+ +MKG +D+ E+ Sbjct: 215 LKKVVKKETSGNFEYGLLTILKCSENPAKYFA-KVLHNAMKGLGTDDTTLVRVIVTRTEI 273 Query: 277 DMDEIKREFKKKHGMELRDAICDNIPSGDYRDFLVAL 313 DM IK E+ KK+ L DA+ SG+YR FL++L Sbjct: 274 DMQYIKAEYSKKYKKTLTDAVHSET-SGNYRTFLLSL 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799534 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28541 (531 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 109 7e-26 >Cs68010 Length = 146 Score = 109 bits (273), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 59/146 (40%), Positives = 84/146 (57%), Gaps = 7/146 (4%) Query: 385 MRAVYGGFAAAL--KDLKIWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYD 442 M A GF +AL K +WVMNVV + LP+I +RG G+ HDWCE+F TYPR+YD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 443 LLHADHLF---SKLKKRCNLVAVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEV 499 L+HA+ L S + RC+ + + E+DRILRPEG +I+RD I + ++W+ Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWDA 120 Query: 500 SL--TYSKDKEGLLCVQKSMWRPKES 523 + S E LL QK ++ + S Sbjct: 121 RVIEIESNSDERLLICQKPFFKRQAS 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28491 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88194 125 6e-31 >Cs88194 Length = 241 Score = 125 bits (313), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 61/109 (55%), Positives = 84/109 (77%) Query: 53 SGKKRRLSSEQVKALERSFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQL 112 + +KR L+ +Q + LE+SFEVENKLEPERK++LA++LGLQPRQVAIWFQNRRARWKTKQL Sbjct: 2 ASEKRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQL 61 Query: 113 ERDYSALKADYDGLKHNYDSLERQNKALAEKLSQLKAKLCTEGAESNGS 161 E+DY L+ Y+ LK +YD+L ++ + L ++ +L KL + ES + Sbjct: 62 EKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKESKNT 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19141 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3819 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13719 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74790 108 2e-26 >Cs74790 Length = 135 Score = 108 bits (271), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 58/104 (55%), Positives = 63/104 (60%), Gaps = 3/104 (2%) Query: 18 LVHKPSVGAPSSTVLALPSLARKGRVSCSME---GKKESNXXXXXXXXXXXXXXXXXXXX 74 LVHKPS+ A SS VL LP+ A KG+V CSME K+ES Sbjct: 18 LVHKPSIVASSSPVLGLPAKAVKGKVRCSMEEKPSKQESKTNVGMSASLLAAACAATMSS 77 Query: 75 XXXXLVDDRLSTEGTGLPFGLSNNLLGWILFGVFGLIWTFYFIY 118 LVDDR+STEGTGLPFGLSNNLLGWIL GVFGLIW Y Y Sbjct: 78 PAMALVDDRMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIPY 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32118 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5558 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8275 (380 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42822 296 2e-82 >Cs42822 Length = 333 Score = 296 bits (758), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 160/371 (43%), Positives = 211/371 (56%), Gaps = 49/371 (13%) Query: 8 VIPCTAAVAWEAGKPLVMERVEVAPPQAMEVRVKIKYTSLCHTDLYFWEAKGQTPLFPRI 67 VI C AAVAW AG+PLV+E VEV PPQ E+R+K+ TSLC +D+ WE + +FPRI Sbjct: 10 VITCKAAVAWGAGQPLVVEEVEVNPPQPEEIRIKVVCTSLCRSDITAWETQA---IFPRI 66 Query: 68 FGHEASGIXXXXXXXXXXXXXXDHVLPVFTGECGDCAHCKSEESNMCDLLRINTDRGVML 127 FGHEASGI +HVL VF GEC C CKS++SN C++L + RGVM Sbjct: 67 FGHEASGIVESVGPGVTEFNEGEHVLTVFIGECKTCRQCKSDKSNTCEVLGLER-RGVMH 125 Query: 128 SDEKPRFSINGTPINHFVGTSTFSEYTVIHSGCLAKINPLAPLDIVCILSCGITTGLGAT 187 SD++ RFSI G LGA Sbjct: 126 SDQQTRFSIKG---------------------------------------------LGAA 140 Query: 188 LNVAKPKKGSSVAIFXXXXXXXXXXXXXRISGASRIIGVDRNPKRFEEAKKFGVNEFVNP 247 NVA KGS+V IF + GASRIIGVD NP++ E+AK FGV EF+NP Sbjct: 141 WNVADISKGSTVVIFGLGTVGLSVAQGAKARGASRIIGVDTNPEKCEKAKAFGVTEFLNP 200 Query: 248 KDHDKPVQEVIAEMTNGGADRSIECTGNINAMISAFECVHDGWGVAVLVGVPNKDAVFMT 307 D+++PVQ+VI +T+GGAD S EC G+ + +A + DGWG+AV +GVP Sbjct: 201 NDNNEPVQQVIKRITDGGADYSFECIGDTGMITTALQSCCDGWGLAVTLGVPKLKPEVAA 260 Query: 308 KPINLLNERTLKGTFFGNYKPRTDLPSVVEMYMSKKLEVEKFITHRVPFSEINKAFDYMI 367 L+ RTLKG+ FG +KP+TDLPS+V Y+ K+ V++FITH + F +IN+AF+ M Sbjct: 261 HYGLFLSGRTLKGSLFGGWKPKTDLPSLVNRYLKKEFMVDEFITHNLLFEDINQAFNLMK 320 Query: 368 RGEGLRCIVSM 378 G+ LR ++ M Sbjct: 321 EGKCLRSVIHM 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6548 (451 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27547 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs117106181 351 5e-99 >Cs117106181 Length = 221 Score = 351 bits (900), Expect = 5e-99, Method: Compositional matrix adjust. Identities = 165/219 (75%), Positives = 182/219 (83%) Query: 1 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVD 60 M Q+SLIY+FVARG V+LAEYTEF+GNF SIA QCLQKLPA+NNKFTYNCD HTFNYLVD Sbjct: 1 MSQKSLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVD 60 Query: 61 NGFTYCVVAVEAVGRQVPIAFLERIKEDFIGRYGGGKAATAVANSLNKEFGSKLKEHMQY 120 NG+TYCVVA E+ GRQ+P+AFLER+K++F+ +YGGGKAATA AN LNKEFG KLKE MQY Sbjct: 61 NGYTYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQY 120 Query: 121 CVDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQG 180 CVDHPEEISKL+KVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENL QAQDFR G Sbjct: 121 CVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTG 180 Query: 181 TQMRRKMWFQNMXXXXXXXXXXXXXXXXXXXSVCNGFKC 219 T+MRRKMW QNM SVC+GF C Sbjct: 181 TKMRRKMWLQNMKIKLIVLGILIALILIIVLSVCHGFNC 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15188 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71826098 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3518 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486536 (83 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs22934 63 5e-13 >Cs22934 Length = 166 Score = 63.2 bits (152), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 33/43 (76%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Query: 1 LLAEGRFYSDLELTEKEIERMVMEASRLEY-ADGTFKQQLGRR 42 LLAEGRFYSDLELTEKEIE MVME SR EY A KQQLG + Sbjct: 38 LLAEGRFYSDLELTEKEIECMVMEVSRAEYLAGDNLKQQLGHK 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25668 (535 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742903 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34689 222 2e-60 >Cs34689 Length = 264 Score = 222 bits (565), Expect = 2e-60, Method: Compositional matrix adjust. Identities = 109/110 (99%), Positives = 110/110 (100%) Query: 83 VSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 142 VSTSVVEPYNSVLSTHSLLEHTDV+VLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS Sbjct: 1 VSTSVVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVIS 60 Query: 143 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 61 SLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2543 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99541 148 4e-38 >Cs99541 Length = 211 Score = 148 bits (374), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 69/162 (42%), Positives = 101/162 (62%) Query: 12 KLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIKFDIWDTAGQER 71 K +++GD G GK+ L+L+F +F + TIG F ++++++ IK IWDTAGQE Sbjct: 8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQES 67 Query: 72 YHSLAPMYYRGXXXXXXXYDITSMDSFLRAKKWVLEVQRQANPTLIMFLAGNKADLEDKR 131 + S+ YYRG YDIT ++F W+ + ++ AN + + L GNK DL +R Sbjct: 68 FRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR 127 Query: 132 KVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAK 173 V +EEGEQ+AKE+GL+F+E SAKTAQNV E F + A + K Sbjct: 128 AVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYK 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1247 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29234 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15336 73 4e-15 >Cs15336 Length = 263 Score = 73.2 bits (178), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 65/233 (27%), Positives = 108/233 (46%), Gaps = 25/233 (10%) Query: 15 VISGSTRGLGKALAREFLLSGDRVVVASRSPESVQATVRELEENLREGINSAGGLSKNLK 74 +++G TRG+G A+ E G V SR+ + ++E + SK LK Sbjct: 17 LVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWK-------------SKGLK 63 Query: 75 HAKVVGVACDVCEAGDVQKLANFAVSEL-GHIDIWINNAGANKGFRPLLQFTDEDIKQIV 133 V G ACD+ + QKL SE G ++I +NNAG + +FT ED I+ Sbjct: 64 ---VSGSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIP-KEATEFTMEDFSTIM 119 Query: 134 STNLVGSILCTREAMRIMMNQAKGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSL 193 +TN + ++ A ++ G IF + +G + PL+++Y STK + QL +L Sbjct: 120 TTNFESAYHLSQLAYPLLKASGNGNIIF--ISSVTGVIAVPLSSIYASTKGAMNQLTKNL 177 Query: 194 LKECKGSKVGVHTASPGMVLTDLLLSGSSLKNKQMFNFICELPETVARTLVPR 246 E + V+ +P ++ T L+ S K+ ++ L + RT +PR Sbjct: 178 ACEWGKDNIRVNAVAPWIIRTSLI--DSIEKDPRVMEHASRL---IPRTPIPR 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761285 (46 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4244 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6365 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22441 (367 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5233 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7103 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6932 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3765 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6950 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19889 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28976 (293 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2074 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380944 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24201 (434 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34035 216 4e-58 >Cs34035 Length = 460 Score = 216 bits (550), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 122/196 (62%), Positives = 141/196 (71%), Gaps = 5/196 (2%) Query: 184 SVEKAK-LKPLKKGSQNQAEGESQSSLSPTEGDKHP-RVGTLPNYGFSFRCDERAEKRRE 241 S+EKA+ K LK+G EG + SS SP EGD P R G LP YGFSF+CDERA+KR+E Sbjct: 205 SLEKARHQKHLKQGPPEVKEG-THSSSSP-EGDTKPQRTGVLPAYGFSFKCDERAQKRKE 262 Query: 242 FYTKLEEKIHAKEMEKNNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELK 301 FY KLEEKIHA+E+EK +QAK++E EAEI+M RK L FKATPMPSFY EP PPKVELK Sbjct: 263 FYAKLEEKIHAREVEKTTIQAKTQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELK 322 Query: 302 KIPTTRAKSPKLGRRNSLPPAVSEAKGNTNGQSSRLSLDQKVPQN-TSKGPSPVHPKKPQ 360 K P TRAKSPKL R S S+ + + QS R SLD K+ QN +KG SP KKP Sbjct: 323 KTPPTRAKSPKLSRSRSSRIKDSDGNSSHSSQSGRFSLDVKLTQNRVAKGSSPQDYKKPL 382 Query: 361 RKSLPRLPSEKTTLPN 376 RKSLP+LPSEKTTL N Sbjct: 383 RKSLPKLPSEKTTLAN 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19252 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64862 80 1e-17 >Cs64862 Length = 266 Score = 79.7 bits (195), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 42/81 (51%), Positives = 59/81 (72%), Gaps = 2/81 (2%) Query: 46 DTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALGLNMEVP 104 + LKLG C+D+LG LV++ +G+P + CC +L+GL +LEAAICLCT I+ L LN+ +P Sbjct: 171 NALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFIP 230 Query: 105 VALSLLVSACQKTVPPGFKCE 125 +AL L++ C KT PPGF C Sbjct: 231 LALPALIT-CGKTPPPGFVCP 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27035 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6103 (363 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9892 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4888 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27130 (494 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22262 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3951 291 7e-81 >Cs3951 Length = 185 Score = 291 bits (744), Expect = 7e-81, Method: Compositional matrix adjust. Identities = 141/175 (80%), Positives = 153/175 (87%) Query: 113 LEMDDEYEGNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFXXXXXXXXXXXXI 172 LEMDDEYEGNVEATGEDYSVEPA++RRPFRALLDVGLI+TTTGNRVF I Sbjct: 2 LEMDDEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDI 61 Query: 173 PHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEA 232 PHS+KRFAGFSKD KQLDAEVHRKYIYGGHVAAYM+TL EDEPEKYQ+HF+EYIKKGI+A Sbjct: 62 PHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDA 121 Query: 233 DNIEELYKKVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 D +E LYKKVHAAIRADPT KK+EK PKEHKRYNLKKLT++ERK KLVERL A Sbjct: 122 DGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNAL 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9171 (496 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59303 71 2e-14 >Cs59303 Length = 175 Score = 71.2 bits (173), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 45/141 (31%), Positives = 69/141 (48%), Gaps = 1/141 (0%) Query: 353 VDAKQKGATFCQEYKRDGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRITTVEEGIHHC 412 VD K T + G I P + V+ DM IA +E FGPV +++ ++E I Sbjct: 35 VDGGAKLETGGERLGAKGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRS 94 Query: 413 NASNFGLQGCVFTKDINKAMLIGDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGIT 472 NAS +GL VFT +++ A + A+ G+V IN PF G K SG G + + Sbjct: 95 NASQYGLAAGVFTHNLDTANTLMRALRVGSVWINCFDVFDA-AIPFGGYKQSGQGREKGS 153 Query: 473 NSINMMTKIKTTVINLPTPSY 493 S++ ++K V L P++ Sbjct: 154 YSLSNYLQVKAVVTALKNPAW 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9060 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20202 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9543 (535 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81867 75 1e-15 >Cs81867 Length = 293 Score = 75.1 bits (183), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 57/195 (29%), Positives = 99/195 (50%), Gaps = 6/195 (3%) Query: 51 DIGVMSGAAIYIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAI 110 ++ ++S +K + +S E ++ ++ L+G+ + G SD GRR +I+ + Sbjct: 2 EVMILSFVGPAVKSEWGLSSSEESLITTVVFAGMLVGAYSWGLISDIYGRRMSILGGALV 61 Query: 111 FFVGALLMGFATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPASSRGFLTSFPEVFIN 170 FV LL FA NY L+ R +AG G+G + + V P++ ++ F + Sbjct: 62 TFVAGLLSAFAPNYISLLILRGLAGAGLGSGHVFFSWFMEFVPPSNRGKWMVVFSTFWT- 120 Query: 171 SGILLGYVSNYAFSKLPTH-LGWRLMLGVGAIPSIFLAVGVLAMPESPRWLVMQGRLGDA 229 G VS A + + L WR +L + AIP+ L + ++ MPESPR+L +GR+ DA Sbjct: 121 ----FGSVSEAALAWIVMPILTWRWLLALSAIPAFVLLIFIVFMPESPRYLCTKGRITDA 176 Query: 230 TRVLDKTSDSKEESM 244 +LDK + + S+ Sbjct: 177 HNILDKIAQFNQTSL 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275353 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86545 154 2e-40 >Cs86545 Length = 400 Score = 154 bits (389), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 71/101 (70%), Positives = 80/101 (79%) Query: 16 FDEEEPPRSPQSXXXXXXXXXXXXNSLAEILPLSDTPGGPWKVYGVARRPRPNWNADHPV 75 F+E+EP RS QS NSLAEILPL DTPGGPWKVYGVARRP+PNWNADH V Sbjct: 16 FEEDEPARSYQSVGLIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWNADHLV 75 Query: 76 EYIQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTDAENC 116 EY+QCD+SDP++ + LS L DVTHIFYVTWTNRST+AENC Sbjct: 76 EYVQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENC 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32502 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9661 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779444 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029865 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17724 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10799 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 427 e-122 >Cs10194 Length = 251 Score = 427 bits (1099), Expect = e-122, Method: Compositional matrix adjust. Identities = 213/252 (84%), Positives = 230/252 (91%), Gaps = 1/252 (0%) Query: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 MPIRNIAVG P E HPDALRAALAEFISTLIFVFAGEGSGMAF KLT + A TPSGLVA Sbjct: 1 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA 60 Query: 61 AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL 120 A++AHAF LFVAV + ANISGGHVNPAVTFGAF+GGNISLLRG+LYWIAQLLG+TVAC L Sbjct: 61 ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL 120 Query: 121 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 180 LK VTNGQTT+AF+LS GVG WNA VFEIVMTFGLVYTVYATA+DPKKGS+GTIAPIAIG Sbjct: 121 LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIG 180 Query: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIG 240 FIVGANILAGGAFDGASMNPAVSFGPALVSWSW+NHWVYW GPLIG G+AG++YEF FI Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI- 239 Query: 241 NSGHEQLPSTDY 252 N HEQLP+T+Y Sbjct: 240 NQSHEQLPTTEY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13441 (361 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25555 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs50758 427 e-122 >Cs50758 Length = 335 Score = 427 bits (1099), Expect = e-122, Method: Compositional matrix adjust. Identities = 207/267 (77%), Positives = 233/267 (87%), Gaps = 6/267 (2%) Query: 1 MASLPPPLESHLRLSPDPGEKPLNHETQLPMAPIHIVTHASQLPAEFLEPSAERPLIIGF 60 MAS P ++H+ LS DP KP++ + PIHIVT+ASQLPAEFLEPS+ER L+IGF Sbjct: 1 MAS-SPSHQTHIPLSSDPDGKPIDS-----VVPIHIVTNASQLPAEFLEPSSERQLVIGF 54 Query: 61 DCEGVDLCRHGTLCIMQLAFPNAIYLVDAIQGGVMLINACKPALESPYITKVIHDCKRDS 120 DCEGVDLCRHG+LCIMQLAFP+AIYLVDAIQGG ++ ACKPALES YITKVIHDCKRDS Sbjct: 55 DCEGVDLCRHGSLCIMQLAFPDAIYLVDAIQGGETVVKACKPALESSYITKVIHDCKRDS 114 Query: 121 EALYFQFGIKLNNVVDTQIAYSLIEEQEGQKRVLVDYISFVGLLADPRYCGISYLEKEEV 180 EALYFQFGIKL+NVVDTQIAYSLIEEQEG+KR DYISFVGLLADPRYCGISY EKEEV Sbjct: 115 EALYFQFGIKLHNVVDTQIAYSLIEEQEGRKRSPDDYISFVGLLADPRYCGISYQEKEEV 174 Query: 181 RFLLRQDPNFWTYRPLSEQMVRAAADDVRFLLHIYYKMMEKLNQQSLWYLAIRGALYCRC 240 R LLRQDP FWTYRPL+E MVRAAADDVRFL +IY+ MM+KLNQQSLWYLA+RGALYCRC Sbjct: 175 RVLLRQDPQFWTYRPLTELMVRAAADDVRFLPYIYHNMMKKLNQQSLWYLAVRGALYCRC 234 Query: 241 FCISDNNFADWPSLPPIPDNLKVEGNA 267 FCI++N++ DWP LPP+PD L VEG+ Sbjct: 235 FCINENDYVDWPPLPPVPDYLIVEGDV 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32102 (494 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17598 187 2e-49 >Cs17598 Length = 108 Score = 187 bits (476), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 83/108 (76%), Positives = 98/108 (90%) Query: 387 MSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLVDDWDCLKTMVRSFETHCGSLS 446 MSHRMH+D ++KLIGKLLFGIEKGP++LN VRPAGQPLVDDW CLK++VR+FE+HCG+LS Sbjct: 1 MSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALS 60 Query: 447 QYGMKHMRSLANICNAGMTQEQMAEASAQACVSAPSGRWSSLHRGFSA 494 QYGMKHMRSLANICN G+ +E+MAEASAQAC + PSG W SL +GFSA Sbjct: 61 QYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWRSLDKGFSA 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797160 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26338 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1760 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2684 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69971 96 2e-22 >Cs69971 Length = 173 Score = 95.9 bits (237), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 73/186 (39%), Positives = 97/186 (52%), Gaps = 24/186 (12%) Query: 1 MQRQSLGGSPSKLHQAHGGPKDQTLTVDDSPNRIKDLLAFXXXXXXXXXXXXXXXYEDDE 60 MQRQSLG SKLH HGG + +D R+ +L Y DD+ Sbjct: 1 MQRQSLGSPVSKLH-IHGGGGGGGSSKEDL--RLTEL---HPSSSSSSSATSPTVYNDDD 54 Query: 61 DHKASKPHRLS-SPPSIA----------PHKSIHVIPVXXXXXXXXXXXXSHVPSQSDLA 109 + K +KP R S SPP +A P K IH+IP+ SH PS SDLA Sbjct: 55 ESKTTKPRRFSLSPPPLALSSSLSTHSRPEKLIHLIPLLTLFCFLVLYFSSHSPSPSDLA 114 Query: 110 QFNGFTKLPGSAKRVVSADSEIDGIGRFIDIRKSDVLAIRSLRNLQDTQTQNLVPRSRSH 169 QF+ F + P + + EID + RFI++R+ D LAIRSLRN+Q+ + Q+ P+ R H Sbjct: 115 QFHAFQR-PSNRR----DSGEIDDVNRFIELRRGDFLAIRSLRNIQEIEKQS--PKFRPH 167 Query: 170 RKVADF 175 RK+ADF Sbjct: 168 RKIADF 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14168 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48735581 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269198 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 61752123 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2536 (365 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23103 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6183 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48382362 (218 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10579 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96407 74 1e-15 >Cs96407 Length = 215 Score = 73.9 bits (180), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 63/188 (33%), Positives = 92/188 (48%), Gaps = 28/188 (14%) Query: 32 PISQTLNFPKSIH------GLRLPRVAHSASLPRGDSHTRKSFI-VKASAGELPLVGNVA 84 P SQ+L P GLR + S++LP S + K+ I K S G+ P Sbjct: 24 PPSQSLAIPSKSSSQSQFFGLRF---SFSSNLPIPSSTSFKTSISAKVSKGQAP------ 74 Query: 85 PDFEAEAVFDQEFVNVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFAELNTE 144 P F + DQE NV LS++ GK V+++FYP D T C + AF D + +F + E Sbjct: 75 PSFTLK---DQEGRNVSLSKFKGKP-VVVYFYPADETPGCTKQACAFRDSYEKFKKAGAE 130 Query: 145 ILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYGVLIPDQG-IALRGLF 203 ++G+S D SH A+ + R L Y L+SD + K +GV G + R + Sbjct: 131 VIGISGDDSSSHKAFAKKYR-------LPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTY 183 Query: 204 IIDKEGVI 211 I+DK GV+ Sbjct: 184 ILDKNGVV 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23352 (437 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 408 e-116 >Cs84538 Length = 216 Score = 408 bits (1048), Expect = e-116, Method: Compositional matrix adjust. Identities = 192/216 (88%), Positives = 204/216 (94%) Query: 222 MCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 281 MC L INDLDAGAGR+GGTTQYTVNNQMVNATLMNIADNPT VQLPGMYNKEENPRVPII Sbjct: 1 MCCLMINDLDAGAGRMGGTTQYTVNNQMVNATLMNIADNPTCVQLPGMYNKEENPRVPII 60 Query: 282 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQS 341 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQS 120 Query: 342 IDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 401 IDFFGALRARVYDDEVR WI+G+GV SIGK LVNSKE PTFEQP+MT+EKLLEYGNM+V Sbjct: 121 IDFFGALRARVYDDEVRNWISGIGVGSIGKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIV 180 Query: 402 QEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437 QEQENVKRVQLADKYLSEAALG+AN+DA+ +G FYG Sbjct: 181 QEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7985 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147361 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283069 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12672 (318 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93799 100 2e-23 >Cs93799 Length = 160 Score = 100 bits (249), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 60/161 (37%), Positives = 93/161 (57%), Gaps = 7/161 (4%) Query: 163 LSKTEAEYEALEYARINGLDLVTVCPTLIMGPILQSTVNASTLVLIKLLKEGYESLENKP 222 +SKT AE A E+A NG D+V + P +GP Q VNAS VL +LL+ ++ E+ Sbjct: 1 MSKTLAEKAAWEFAEKNGTDVVAIHPATSLGPFPQPYVNASGAVLQRLLQGSKDTQEHYW 60 Query: 223 RMIVDVRDVAEAVIMVYEKPEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEE 282 V V+DVA+A ++++E A GRY+CT + + E++ ++P YP + + E Sbjct: 61 LGAVHVKDVAKAQVLLFETSAASGRYLCTNGIYQFAEFAEKVSKLFPE--YPIHRFKGET 118 Query: 283 QPRL-----SSEKLQRLGLSFRPLKETLTGSVESYKEAGLL 318 QP L ++++L LGL F P++ET+ +VES K G L Sbjct: 119 QPGLVACENAAKRLISLGLDFTPVEETIREAVESLKAQGHL 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54682321 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27484 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10209 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24958 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30274 (59 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14289 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26728 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265854 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54924 189 1e-50 >Cs54924 Length = 140 Score = 189 bits (480), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 100/140 (71%), Positives = 105/140 (75%), Gaps = 2/140 (1%) Query: 1 MSSP--TSKGGRGXXXXXXXXXXXXXAGLQFPVGRIARFLKAGKYAERVGAGAPXXXXXX 58 MSS ++KGGRG AGLQFPVGRIARFLKAGKYAERVGAGAP Sbjct: 1 MSSTGGSTKGGRGKPKASKSVSRSHKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAV 60 Query: 59 XXXXXXXXXXXXGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGAVTIANGGVMPNIHQN 118 GNAARDNKKNRIVPRHIQLAVRNDEELSKLLG+VTIANGGV+PNIHQ Sbjct: 61 LEYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQT 120 Query: 119 LLPKKVGKGKGEIGSASQEF 138 LLPKKVGKGKG+IGSASQEF Sbjct: 121 LLPKKVGKGKGDIGSASQEF 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9627 (473 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4847 (293 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27856 (545 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32864 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25908 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs13890 177 5e-47 >Cs13890 Length = 225 Score = 177 bits (448), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 88/128 (68%), Positives = 100/128 (78%) Query: 1 VKRFVYISAADFGLANYLLRGYYEGKRAAETELLTKFPYGGVILKPGFIYGTRSVGSVKL 60 VKRFVYISAADFG+ANYLL+GYYEGKRAAETELLT++PYGGVIL+PGFIYGTR+VG +KL Sbjct: 97 VKRFVYISAADFGVANYLLQGYYEGKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKL 156 Query: 61 PLGVIGYPLEMLFQYTRPLSQLPLVGPLFXXXXXXXXXXXXXXXXXXXXXFPPGIVDVQG 120 PLGVIG P+EM+ Q+ +PLSQLPLVGPLF FPPGIVDV G Sbjct: 157 PLGVIGSPMEMVLQHAKPLSQLPLVGPLFTPPVNVTVVAKVAVRAATDPVFPPGIVDVHG 216 Query: 121 IQRYTQKK 128 I RY+QK Sbjct: 217 ILRYSQKS 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13779 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs94907 216 7e-59 >Cs94907 Length = 139 Score = 216 bits (551), Expect = 7e-59, Method: Compositional matrix adjust. Identities = 103/130 (79%), Positives = 113/130 (86%) Query: 14 SDGGKHDDDAALTDFLASLMDYAPTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFVS 73 S G+HDDDAALT+FL+SLM Y PTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFV+ Sbjct: 10 SSDGRHDDDAALTEFLSSLMGYTPTIPDELVEHYLAKSGFQCPDVRLIRLVAVATQKFVA 69 Query: 74 EVATDALQQCKARQASVVXXXXXXXXXXXXLILTMEDLSRALREHGVNVKHQEYFADSPS 133 EVATDALQQCKARQA+V LILTMEDLS+ALRE+GVNVKHQEYFAD+PS Sbjct: 70 EVATDALQQCKARQAAVAKDKRDKQQKDKRLILTMEDLSKALREYGVNVKHQEYFADNPS 129 Query: 134 TGMDPATREE 143 TGMDPA++EE Sbjct: 130 TGMDPASKEE 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9935 (521 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2751 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601835 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19101 (400 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226777607 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391514 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2584 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68106183 100 6e-24 >Cs68106183 Length = 160 Score = 100 bits (250), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 85/165 (51%), Positives = 93/165 (56%), Gaps = 13/165 (7%) Query: 1 MEGRKQXXXXXXXXXXXXXXXKESSASPGIFGAIFAPPSKDLVLGRESVHSEFTGKK--L 58 MEGRKQ KESS+S GIFG+IF+PPSK VLGRES+HSE KK Sbjct: 1 MEGRKQTGSSSSLTNELFGS-KESSSSSGIFGSIFSPPSK--VLGRESLHSESMEKKHDS 57 Query: 59 SDEPLHFTPGDQP-----DGAXXXXXXXXXXXXXXXXXXXXYRDQRVQQPCHLSSSIYYG 113 S E + P G Y+DQRVQ PCHLSSSIYYG Sbjct: 58 SKEAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDMSSMYQDQRVQ-PCHLSSSIYYG 116 Query: 114 GQDIYSYSQSN-QSPEYNSTYKKDGTEDDSGSACRGNWWQGSLYY 157 GQD+YS N Q P NS +KKDG EDDSGSA RGNWWQGSLYY Sbjct: 117 GQDVYSPRPPNSQGPGVNSVFKKDG-EDDSGSASRGNWWQGSLYY 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31992 (566 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13962 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8306 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6579 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6779 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32493 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46991714 (56 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5463 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44282 151 2e-39 >Cs44282 Length = 125 Score = 151 bits (381), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 78/112 (69%), Positives = 81/112 (72%), Gaps = 1/112 (0%) Query: 1 MEDYVHRIGRTGRAGSMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTXXXXX 60 +EDYVHRIGRTGR GSMGQ+TSFYTDRDM LVA IKKAI DA SGNAVAFATGK Sbjct: 15 VEDYVHRIGRTGRGGSMGQATSFYTDRDMLLVAQIKKAIVDAESGNAVAFATGKVARRKE 74 Query: 61 XXXXXXXXXXXVALSNSSTAGPASVNIEDKYRFMFADSNNKKEGAADSAWDD 112 VA S S GP SVNIEDKYRFM A SN K+EGAADSAWDD Sbjct: 75 REAAAAQKGATVATSKLSMMGP-SVNIEDKYRFMIAASNMKREGAADSAWDD 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 15184581 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27776 (419 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13992 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68106183 86 1e-19 >Cs68106183 Length = 160 Score = 85.5 bits (210), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 52/107 (48%), Positives = 64/107 (59%), Gaps = 7/107 (6%) Query: 3 EYWQQHSLRNHALNTKQGTAAISSEGARYSVPNKDRSSVLQEERSEPCYLSSSIYYGGQE 62 E W L + G A+ S E KD SS+ Q++R +PC+LSSSIYYGGQ+ Sbjct: 60 EAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDMSSMYQDQRVQPCHLSSSIYYGGQD 119 Query: 63 VYS-QSPRTHASGSYPIFKKDAGEDDPNGTNSNSAARGNWWQGSLYY 108 VYS + P + G +FKKD GEDD S SA+RGNWWQGSLYY Sbjct: 120 VYSPRPPNSQGPGVNSVFKKD-GEDD-----SGSASRGNWWQGSLYY 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25110 (205 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32822 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7248 (582 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2090 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41829 172 8e-46 >Cs41829 Length = 162 Score = 172 bits (435), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 80/90 (88%), Positives = 84/90 (93%) Query: 1 MHAHLTAAVVSNDPLFLQDVIGNTVNGTTYAGLRARTTGAPQNHWFGPAGDPRGVGIGTP 60 MHAHLTAAVVSNDPLFLQ+VIGNTVNGTTYAGLRARTTGAPQNHWFGP+GDPRG GIGTP Sbjct: 73 MHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPSGDPRGAGIGTP 132 Query: 61 EAIKLVWSCHREIIYDVGPLPKQWQTPPST 90 EAIKLVWS HREIIYD GP+P W+ PPST Sbjct: 133 EAIKLVWSSHREIIYDYGPVPGNWEIPPST 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7350 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784615 (123 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796879 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239938 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6224 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28069 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36587 310 2e-86 >Cs36587 Length = 202 Score = 310 bits (794), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 155/203 (76%), Positives = 177/203 (87%), Gaps = 5/203 (2%) Query: 249 LAVTFPIEKAPTKKISTLNAEVKVSELLNYPVRGLVFEGGNTLEDLSYTVSDACICLQEN 308 +A+ FPIEKAPTKKI + + VK+SELLNYPVRGLVFEGGN+LEDLS TVSDACICLQEN Sbjct: 1 MALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQEN 60 Query: 309 NVPYNVLISDCGKRIFLLPQCYAEKQALGEVSAEVLDTQVNPAVWEISGHMVLKRKKDYD 368 N+PYNVLI+DCGKRIFLLPQCYAEKQALGEVS+E+LDTQVNPAVWEISGHMVLKRKKDY+ Sbjct: 61 NIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYE 120 Query: 369 EASDENAWKLLAEVSLSEERFQEVNALIFERIASGNNGNENLPE----DPEVKPRSHEEV 424 EAS+ENAW+LLAEVSLSEER+QEVNALIFE IA G++ N + E + + KP+S EV Sbjct: 121 EASEENAWRLLAEVSLSEERYQEVNALIFEAIARGDDANGGVAESVIGEADAKPKSGGEV 180 Query: 425 DATINKSSRAAMVGETQECIVLQ 447 DA INK+S AMV T EC+VLQ Sbjct: 181 DA-INKNSCPAMVSGTPECLVLQ 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21954 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3278 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68106183 103 1e-24 >Cs68106183 Length = 160 Score = 103 bits (256), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 81/170 (47%), Positives = 101/170 (59%), Gaps = 27/170 (15%) Query: 6 KYQGNSGSSLTADLFGAKDKESPPKSSTGIFASIFPPPSQVVGRNSSSSELTEYWQKQSS 65 + Q S SSLT +LFG+K+ SS+GIF SIF PPS+V+GR S SE E K+ Sbjct: 4 RKQTGSSSSLTNELFGSKES----SSSSGIFGSIFSPPSKVLGRESLHSESME---KKHD 56 Query: 66 LGNHAWNSKQAI-------------SGEGAHYSLPNKDRSSVLQEERAEPCHLSSSIYYG 112 AWN+K S E KD SS+ Q++R +PCHLSSSIYYG Sbjct: 57 SSKEAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDMSSMYQDQRVQPCHLSSSIYYG 116 Query: 113 GQEVYS-QSPSTRSSGSYPIFKKDGGEDDPNGTNSNSAARGNWWQGSLYY 161 GQ+VYS + P+++ G +FKKD GEDD S SA+RGNWWQGSLYY Sbjct: 117 GQDVYSPRPPNSQGPGVNSVFKKD-GEDD-----SGSASRGNWWQGSLYY 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24131 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52926 88 1e-19 >Cs52926 Length = 231 Score = 87.8 bits (216), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 65/202 (32%), Positives = 90/202 (44%), Gaps = 23/202 (11%) Query: 32 SLATRKLSELVQDQTQLLKYHNGPLLSGK-ITINLIWYGNFKPSQKAIVXXXXXXXXXXX 90 +L+T K E D L +YH GP+LS I I L+WYG + QK ++ Sbjct: 43 TLSTSKKYEGSSDLVNL-RYHMGPVLSSSPINIYLVWYGRWPNYQKLLIKDFILSISPAA 101 Query: 91 XXKTPQPSVAAWWQTTEKYYHLTXXXXXXXXXXXXXGRQILDQSYSLGKSLT---TKQIV 147 +PSV+ WW+T Y T + D YS GKSLT +Q++ Sbjct: 102 AAA--KPSVSDWWRTVSLY---TDQTGANVSRTVLIAGEHSDHLYSHGKSLTRLSVQQVI 156 Query: 148 ALAAKG-----DQKNAINVVLTSADVAVDGFCMNRCGTHGSASGSFKTGHTKGSKNSKFA 202 A + D KN I ++LT+ DV + +C CG H S G+T Sbjct: 157 GTAVESAPFPVDHKNGIFLILTADDVTMQDYCRAVCGFHYFTFPSM-VGYT-------MP 208 Query: 203 YIWVGNSETQCPGQCAWPFHQP 224 Y W+GNS QCP C++PF P Sbjct: 209 YAWIGNSTKQCPEVCSYPFAVP 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32276 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36796 65 4e-13 >Cs36796 Length = 99 Score = 65.1 bits (157), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 29/62 (46%), Positives = 41/62 (66%) Query: 57 VDSVQSVFSSVARGCGWQHLVVYVNLATFYFVGMTIAVLLGFKFKLYAKGLWIGIICGLS 116 ++ +Q V S VA G GWQ LV Y+NL +Y VG+ + +LLGF F A+G+W G+I G+ Sbjct: 1 MNCLQPVLSGVAVGAGWQSLVAYINLGCYYIVGLPLGILLGFTFGFGAEGIWSGMIGGIG 60 Query: 117 CQ 118 Q Sbjct: 61 LQ 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698874 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8357 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs38375 91 9e-21 >Cs38375 Length = 183 Score = 90.5 bits (223), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 51/114 (44%), Positives = 71/114 (62%), Gaps = 2/114 (1%) Query: 1 MAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTGY-KPKEEFVYLLDGAYVLQEQGNML 59 +APEYA G +T+KADVYSFG+V +E+V+G+ +PK + L + A L E+ + Sbjct: 43 LAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDLNRPKGQQC-LTEWARPLLEEYAID 101 Query: 60 ELVDPDLGSNYSKTEAMTMLNLALLCTNPSPTLRPTMSSVVSMLEGKTPVQAPM 113 ELVDP LG++YS+ E ML+ A LC P RP MS V+ +LEG T + M Sbjct: 102 ELVDPRLGNHYSEHEVYCMLHAASLCIRRDPHSRPRMSQVLRILEGDTVIDTYM 155 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8447 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104648 433 e-124 >Cs104648 Length = 236 Score = 433 bits (1113), Expect = e-124, Method: Compositional matrix adjust. Identities = 207/236 (87%), Positives = 225/236 (95%) Query: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKITATSLVNRFVQTNDAAVSVQVGDDAQLAYSHS 60 MLGVFSSAIVSPPEELVAAGSRTPSPK T+T+LV+RF+QTN +AVSVQVGD+ LAY+H Sbjct: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKTTSTALVDRFLQTNSSAVSVQVGDNVTLAYTHQ 60 Query: 61 NESALQPRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 NES L+ RSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP Sbjct: 61 NESPLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 Query: 121 PNHVVGHLSGNFAFIVFDKSTSTVFVASDQFGKIPLSWGITADGYVAFADDAELLKGACG 180 PNHVVGHLSG FAFIV+DKSTST+FVASDQFGK+PL WGITADG+VAFADDA+LLKGACG Sbjct: 121 PNHVVGHLSGYFAFIVYDKSTSTLFVASDQFGKVPLYWGITADGHVAFADDADLLKGACG 180 Query: 181 KSLASFPQGCFYSTSVGGLRSYENPKNKITAVPATDEEIWGATFKVEGPAVLAATK 236 KSLASFPQGCF+ST+VGGLRS+ENPKNKITAVPA +EEIWGATFKVEGPAV AAT+ Sbjct: 181 KSLASFPQGCFFSTAVGGLRSFENPKNKITAVPAAEEEIWGATFKVEGPAVFAATE 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812304 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10247 117 2e-29 >Cs10247 Length = 259 Score = 117 bits (294), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 55/70 (78%), Positives = 63/70 (90%) Query: 2 AIRRSGFKIVLCFRLVPLLPFNMLNYLLSVTPVPIGQYMLASWIGMMPITLALVYVGTTL 61 AI++SGFKI+ RLVPLLPFN+LNYLLSVTPV G+YMLASW+GMMP T +LVYVGTTL Sbjct: 129 AIQKSGFKIIFLLRLVPLLPFNILNYLLSVTPVHTGKYMLASWLGMMPSTFSLVYVGTTL 188 Query: 62 KDISDVTHGW 71 KD+SDVTHGW Sbjct: 189 KDLSDVTHGW 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13975 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31917 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487994 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10594 (408 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42867 63 5e-12 >Cs42867 Length = 334 Score = 63.2 bits (152), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 14/208 (6%) Query: 84 VLLKFLRARDFRVPDSFAMITKCLAWRKEFGADGVVEEDLGFKEL-----EGVVAYMHGY 138 L++FL+ARD+ V + M+ CL WR E D ++ + + EL + + + GY Sbjct: 36 TLVRFLKARDWNVSKAHKMLVDCLRWRIENDIDNILAKPILPAELYRAVRDSQLVGVSGY 95 Query: 139 DKQGHPVCYNAYGV-FKDKEMYERIFGDDEKLKKFLRWRVQVLERGINALHFKAGGIN-S 196 K+G PV G+ DK ++ ++ R +V+ + H + G + Sbjct: 96 SKEGLPVIAVGVGLSTHDKASVNYYVQSHIQMNEY---RDRVVLPSASKKHGRYIGTSLK 152 Query: 197 IIQVTDLKDMPKRELRVASNQILSLFQD-NYPEMVARKIFINVPWYFSVLYSMFSPFLTQ 255 ++ +T LK ++++ + +++ D NYPE +N P+ FS + + P L + Sbjct: 153 VLDMTGLKLSALNQIKLMT--VITTIDDLNYPEKTETYYIVNAPYIFSACWKVVKPLLQE 210 Query: 256 RTKSKFVIAKEGNVAETLYKFIRPEDVP 283 RT+ K + +GN + L K + +P Sbjct: 211 RTRRKIQVL-QGNGRDELLKIMDYASLP 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27400 (266 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41944 88 1e-19 >Cs41944 Length = 375 Score = 87.8 bits (216), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 45/120 (37%), Positives = 74/120 (61%), Gaps = 4/120 (3%) Query: 1 MTDLLGTPSADAIARVRNEKARRYLSSMRRKKQIPFSQKFPNADPLALRLLERMLAFEPK 60 + +LLGTP+ + VRNE A+RY+ + + + +Q FP+ PLA+ L++RML F+P Sbjct: 256 LIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAIDLVDRMLTFDPM 315 Query: 61 DRPTAEEALADPYFKGLAKVEREPSA-QPVTKMEFEFERRRITKEDVRELIYRETLEYHP 119 R T +EALA PY L EP +P + F+FE++ + +E ++++IY+E L +P Sbjct: 316 KRITVDEALAHPYLARLHDEADEPVCPEPFS---FDFEQQSLGEEQIKDMIYQEALALNP 372 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91022484 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68601 327 6e-92 >Cs68601 Length = 229 Score = 327 bits (838), Expect = 6e-92, Method: Compositional matrix adjust. Identities = 150/193 (77%), Positives = 170/193 (88%) Query: 1 MKEEYGLFVWPCSLVLAEYVWQQRLRFSGASVVELGAGTSLPGLVAARVGADVTLTDDSS 60 MKEEYGLFVWPCS++LAEYVWQQR RFSGA+VVELGAGTSLPGLVAA+VG++VTLTDDS+ Sbjct: 31 MKEEYGLFVWPCSVILAEYVWQQRYRFSGANVVELGAGTSLPGLVAAKVGSNVTLTDDSN 90 Query: 61 RLEVLDNMRRVLDLNKLECKVMGLTWGAWDASTFSLHPKFILGADVLYDATAFDDLFATV 120 R+EVL NMRRV ++NKL C+VMGLTWG DAS F L+P ILGADV YDA+AFDDLFAT+ Sbjct: 91 RIEVLKNMRRVCEMNKLNCRVMGLTWGFLDASIFDLNPNIILGADVFYDASAFDDLFATI 150 Query: 121 TFLLQNSPGSVFITTYHNRSGHRLIEFLMVKWGLKCLKLLDAFSFMPSYKASGLRGNLQL 180 T+LLQ+SPGSVFITTYHNRSGH LIEFLMVKWGLKC+KL+D FSF+P YKA L GN+QL Sbjct: 151 TYLLQSSPGSVFITTYHNRSGHHLIEFLMVKWGLKCVKLVDGFSFLPHYKARELNGNIQL 210 Query: 181 AEIALDSEQAETT 193 AEI D E E T Sbjct: 211 AEIVFDHESPEET 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5239 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7028 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58194 172 4e-45 >Cs58194 Length = 167 Score = 172 bits (435), Expect = 4e-45, Method: Compositional matrix adjust. Identities = 90/166 (54%), Positives = 102/166 (61%), Gaps = 10/166 (6%) Query: 83 MNRKDWLSLVAVHSDSWLLSVAFYFGARLN--RNERKRLFSLINDLPTVFEVVT--ERKP 138 M KDWLSLVAVHSDSWLL+VAFYFGAR +NERK+LF +INDLPT+FEVVT ++P Sbjct: 1 MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQP 60 Query: 139 VKEKPSVXXXXXXXXXXXXXXXXLVKSTPKLP------XXXXXXXXXXXXXTLCGSCGGN 192 + + K+ P CG+CG N Sbjct: 61 KDQSANHNSSKSKSSGKSRPAESQTKAVKMSPPPKDDDDSGDEEEEDDEQGATCGACGDN 120 Query: 193 YNADEFWIGCDICEKWFHGKCVKITPAKAENIKQYKCPSCSLKRGR 238 Y DEFWI CDICEKWFHGKCVKITPAKAE+IKQYKCPSCS KR R Sbjct: 121 YGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSSKRAR 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17486 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034490 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42420 216 2e-58 >Cs42420 Length = 250 Score = 216 bits (550), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 109/134 (81%), Positives = 118/134 (88%) Query: 71 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 130 M K YPTVSE+YK A++K +RKLRG IAEKNCAPLMLRIAWHSAGTYD KTKTGGPFGTM Sbjct: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60 Query: 131 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADLYQLAGVVAVEITGGPDVPFHPGRK 190 R AEQ+H ANNGLDIAVRLLEP K+QFP +SYADLYQLAGVV VE+TGGPD+PFHPGR Sbjct: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120 Query: 191 DAPEPPPEGRLPDA 204 D EPP EGRLPDA Sbjct: 121 DKAEPPQEGRLPDA 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10810 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42420 385 e-109 >Cs42420 Length = 250 Score = 385 bits (988), Expect = e-109, Method: Compositional matrix adjust. Identities = 194/250 (77%), Positives = 209/250 (83%) Query: 1 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 60 M K YPTVSE+YK A++K +RKLRG IAEKNCAPLMLRIAWHSAGTYD KTKTGGPFGTM Sbjct: 1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60 Query: 61 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK 120 R AEQ+H ANNGLDIAVRLLEP K+QFP +SYAD YQLAGVV VE+TGGPD+PFHPGR Sbjct: 61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120 Query: 121 DAPEPPPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 D EPP EGRLPDA +G DHLR VFG MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT Sbjct: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 Query: 181 PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHM 240 NPLIFDNSYFT LL G+++GLL LPSDKALLDDPVFRPLVEK H+ Sbjct: 181 RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHL 240 Query: 241 RLSELGFAEA 250 +LSELGFAEA Sbjct: 241 KLSELGFAEA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24129 (370 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41944 686 0.0 >Cs41944 Length = 375 Score = 686 bits (1770), Expect = 0.0, Method: Compositional matrix adjust. Identities = 321/375 (85%), Positives = 351/375 (93%), Gaps = 5/375 (1%) Query: 1 MADLTPSNG-----DFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSV 55 MAD+ NG DFPAVP+HGGQ+IQYNIFGNLFEIT KYRPPIMPIGRGAYGIVCSV Sbjct: 1 MADVAQVNGVGQTADFPAVPTHGGQFIQYNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV 60 Query: 56 LNSETKEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIAIRDVIPPPLRREFSDV 115 LN+ET E+VAIKKIANAFDNHMDAKRTLREIKLL+H DHENVIA++DV+PPPLRREF+DV Sbjct: 61 LNTETNELVAIKKIANAFDNHMDAKRTLREIKLLQHFDHENVIAVKDVVPPPLRREFTDV 120 Query: 116 YIATELMDTDLHQIIRSNQGLSEEHCQYFMYQILRGLKYIHSANVIHRDLKPSNLLLNAN 175 YIA ELMDTDLHQIIRSNQ LSEEHCQYF+YQ+LRGLKYIHSANVIHRDLKPSNLLLNAN Sbjct: 121 YIAAELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNAN 180 Query: 176 CDLKICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 235 CDLKICDFGLARPT+ENE +TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR Sbjct: 181 CDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR 240 Query: 236 KPLFPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLAQHPRQPLERLFPHVNP 295 +PLFPGKDHVHQMRLL ELLGTPT++DLGFVRNEDA+RYIRQL QHPRQ L ++FPHV+P Sbjct: 241 RPLFPGKDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHP 300 Query: 296 MAIDLVDRMLTFDPTRRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLGEEQMK 355 +AIDLVDRMLTFDP +RITV++ALAHPYL RLHD ADEP+C EPFSFDFEQQ LGEEQ+K Sbjct: 301 LAIDLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIK 360 Query: 356 DMIYREAIALNPEYA 370 DMIY+EA+ALNP +A Sbjct: 361 DMIYQEALALNPGFA 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2264 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42594 132 2e-33 >Cs42594 Length = 166 Score = 132 bits (332), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 63/80 (78%), Positives = 71/80 (88%) Query: 30 DPNKPKRPASAFFVFMEDFRVKFKKDHPNNKSVAAVGKAGGDKWKSLSEAEKAPYIAKAE 89 DPNKPKRPASAFFVFME+FR ++KKDHP NKSVAAVGK GG+KWKS+SEA+KAPY+AKAE Sbjct: 34 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKTGGEKWKSMSEADKAPYVAKAE 93 Query: 90 KRKAEYTKTMNAYNKRIAEG 109 KRK EY K M YN+R AEG Sbjct: 94 KRKVEYEKDMKNYNRRQAEG 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31892 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21945 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6378 (299 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27175 (545 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93856 132 1e-32 >Cs93856 Length = 309 Score = 132 bits (331), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 93/304 (30%), Positives = 148/304 (48%), Gaps = 32/304 (10%) Query: 80 GAEDEIEDATSTSKFNWRDHWYPVSLIEDLDPRLPTPFQLLGRDLAIWYDGESWV-AFDD 138 +E+E + ++W + WYP+ L +D+ P + + + ++ DG+ + D Sbjct: 19 ASEEESRGERRVADYDWTEEWYPLYLTKDVPDDAPLGLTVFDQQIVLYKDGKGELRCHQD 78 Query: 139 RCPHRLAPLSEGRIDEGGNLQCSYHGWSFDGCGSCVKIPQASSEGPESRAVRSPRACATR 198 RCPHRLA LSEG++ +G L+C YHGW F+G G CVKIPQ ++ R+ AC Sbjct: 79 RCPHRLAKLSEGQLIDG-RLECLYHGWQFEGEGKCVKIPQLPADAKIPRS-----ACVRT 132 Query: 199 FPTLVSQGLLFVWPDENGWERANATKPTMLP--DEFSKPEFSSVTIQRDLFYGYDTLMEN 256 + SQG+++VW + P LP + F++P F V+ +L Y + L+EN Sbjct: 133 YEVKESQGVVWVW-----MSQKTPPNPDKLPWFENFARPGFQDVSTIHELPYDHSILLEN 187 Query: 257 VSDPSHIDFAHHKV--TGRRDRAKPLPFKLEDSGPWGFSG----ANEGNPRITAEFIAPC 310 + DP+HI +H + + +R+ A+PL F++ + GF+ +G+ F APC Sbjct: 188 LMDPAHIPISHDRTDYSAKREDAQPLGFEVTERTDPGFASQWGREKDGSMPNFLRFEAPC 247 Query: 311 YYLNKIE-IDTKLPVVGDQKWVIWICSFNVPMAPGKTRSIVCSARNFFQFSMPGPAWWQV 369 N E +D K G+ S A +TR I + + P W QV Sbjct: 248 VLQNNRESVDNK---TGENTTPRVYSS-----ADHRTRGINAYCAXWNTGTSP---WXQV 296 Query: 370 VPRW 373 VP W Sbjct: 297 VPDW 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig168 (522 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23635 128 2e-31 >Cs23635 Length = 278 Score = 128 bits (321), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 83/252 (32%), Positives = 124/252 (49%), Gaps = 21/252 (8%) Query: 109 AGYYRLPRSNAASMFYLFFES-RTNKNNPVVIWLTGGPGCSSELALFYENGPF-----RI 162 GY + +++ +FY F ES R+ +++P+V+WLTGGPGCS L +E GP + Sbjct: 40 TGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFSGLVFEIGPLSFDYEKS 99 Query: 163 QKNL-SLTWNDYGWDKASNILFVDQPVGTGFSYT-TNSADIRHDEEGVSNDLYDFLQEFF 220 + NL N Y W K +NI+F+D PVGTGFSY T I +D + + Y FL+++ Sbjct: 100 KVNLPKFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGYIMNDTLSAAQNYY-FLRKWL 158 Query: 221 TQHPQFAKNDFYITGESYAGHYVPALASRVHKGNKAKEGTHINLKGFAIGNGLTNPEIQY 280 HP F N YI G+SY+G VP + + G +NLKG+ +GN LT+ Sbjct: 159 IAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQ 218 Query: 281 KAYSDYALEMKLITKPDYDSISQIIPDCEESAKACAASTSGDACENSLSICNSIVNQIMQ 340 + +A LI+ Y+S + + C N L I + + I + Sbjct: 219 NSVPHFAYLNALISHEIYES----------AKRNCQGEYVNVDPSNGLCIAD--LENITE 266 Query: 341 IISDTNHYDIRK 352 IS NH I + Sbjct: 267 CISRVNHAQIYE 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21943 (420 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13021 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4163 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30951 71 1e-14 >Cs30951 Length = 59 Score = 71.2 bits (173), Expect = 1e-14, Method: Composition-based stats. Identities = 31/48 (64%), Positives = 38/48 (79%) Query: 16 QEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNIMTT 63 Q K LLQS+ LY+YILETSVYPREPE +K++R+VTA HPW +M T Sbjct: 12 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGT 59 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2565 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10760 (403 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10288 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11716 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig491 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12174 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11104 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784313 (64 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig120 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10854 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48016 307 9e-86 >Cs48016 Length = 254 Score = 307 bits (786), Expect = 9e-86, Method: Compositional matrix adjust. Identities = 158/248 (63%), Positives = 174/248 (70%), Gaps = 14/248 (5%) Query: 44 FKLNPDISSLSLSTKSDFHGKRIAFQ---ATGIRGNSQSHASSAVYSQQSGFRIGKAAKW 100 KL LS SDFHG + FQ A RG+S + SA Q+G RIGKA +W Sbjct: 1 MKLRSQALRLSSPLTSDFHGHGVVFQENKAIPKRGSSSKFSISA----QTGLRIGKAQRW 56 Query: 101 WEKGNQPNMKEVSSAEDLVESLSNAGDKLVIVDFFSPGCGGCKALHPKICQLAEMNPDVQ 160 WEKG QPNM+EV+SA+DLVESL +AGDKLV+VDFFSPGCGGCKALHPKICQLAEMNPDVQ Sbjct: 57 WEKGLQPNMREVASAQDLVESLWHAGDKLVVVDFFSPGCGGCKALHPKICQLAEMNPDVQ 116 Query: 161 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFRDALAKHKPERCS 220 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKF+DALAKH P+RC Sbjct: 117 FLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFKDALAKHTPDRCG 176 Query: 221 LGPTXXXXXXXXXXXXXXXXXSFTYTPKPTE-DVPAKEEVIVAEEAPSR------LPLPS 273 LGPT SF YTPKP PA EEV +AE P LPLPS Sbjct: 177 LGPTKGLEEKELLALAANKDLSFNYTPKPQPMPAPAVEEVGLAEVPPPHSILNLPLPLPS 236 Query: 274 ATSQSAQV 281 + ++ Sbjct: 237 TLKSTQEI 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20988 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12973 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18043 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430564 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11290 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93559 388 e-110 >Cs93559 Length = 300 Score = 388 bits (996), Expect = e-110, Method: Compositional matrix adjust. Identities = 175/300 (58%), Positives = 222/300 (74%), Gaps = 1/300 (0%) Query: 18 VASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLRGFGDTDAPPSPTSYTAM 77 +A G GP VLFLHGFPELWY+WR Q+L+LSSLGYR IAPDLRG+GDT+AP S +SY+ Sbjct: 1 IAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLRGYGDTEAPSSISSYSCH 60 Query: 78 HXXXXXXXXXXXXXXXQVFLVAHDWGAVIAWWFCLFRPDRVKALVNMSIAFSPRNPKRKP 137 H QVF+VAHDWGA+IAW+ CLF P+RVKA V +S+ F PRNP KP Sbjct: 61 HIVGDLVALINSLGVEQVFVVAHDWGAIIAWYLCLFCPERVKAFVCLSVPFLPRNPNIKP 120 Query: 138 VDGFRALFGDDYYICRFQEPEEIERDFDSIGTAAVMKRFLTSRSPKPPCIPKDQGLK-SW 196 V+ RALFGDDYYICRFQEP +IE +GTA V+K L +R P P C P++ Sbjct: 121 VESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANRKPGPSCFPEENAFGIDP 180 Query: 197 AAPVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIV 256 VTLP+W +E+DL++ +KF+++GFTG LNYYRA+NL WE+T WT +Q+KVPVKFIV Sbjct: 181 ENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMTAAWTEVQVKVPVKFIV 240 Query: 257 GELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEKPDEVSQHVYDFIKKF 316 GELD+ Y PG++ Y+H GGFK+DVP L+E+VV+E A HFI QE+ +E++ H+YDFIKKF Sbjct: 241 GELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQERAEEINAHIYDFIKKF 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48289683 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9025 (213 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs97586 177 8e-47 >Cs97586 Length = 200 Score = 177 bits (449), Expect = 8e-47, Method: Compositional matrix adjust. Identities = 86/197 (43%), Positives = 125/197 (63%), Gaps = 2/197 (1%) Query: 3 PVKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFEDGD 62 PVKV+G LS RV+A L EKD++F+L+ +++ G+HKK F+ + PFG+VPAF+D Sbjct: 4 PVKVYGPPLSTAVCRVVACLLEKDVEFQLISLNMAKGDHKKPDFLKIQPFGQVPAFQDEK 63 Query: 63 LKLFESRAITQYIVHEYADKGTPLVFQDSK-KMAMIAVGCEVEGQKFDPAASKLTFEQVI 121 + L ESRAI +Y+ Y +KG +F + A I E EGQ F+P +S L F+ + Sbjct: 64 ISLLESRAICRYVCENYPEKGNKGLFGTNPLAKASIDQWLEAEGQSFNPPSSALVFQLAL 123 Query: 122 KPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMG-T 180 P + + D V+++ E KLA VLDVYE RL +S++LAG+ F+LADL H+P HYL+ T Sbjct: 124 APRMNIKQDEGVIKQNEEKLAKVLDVYEKRLGESRFLAGDEFSLADLSHLPNAHYLVNAT 183 Query: 181 QSKKLFVSRPHVSAWVA 197 ++ SR +V WV Sbjct: 184 DRGEILTSRDNVGRWVG 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486593 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7482 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs85196 102 4e-24 >Cs85196 Length = 149 Score = 102 bits (254), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 56/138 (40%), Positives = 85/138 (61%), Gaps = 2/138 (1%) Query: 77 NELKRVFQMFDRNGDGRITKQELNDSLENLGIYIPDKELFNMIEKIDVNGDGCVDIDEFG 136 +E K F +FD++GDG IT +EL + +LG + EL +MI ++D +G+G +D EF Sbjct: 11 SEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70 Query: 137 ELYQSIMXXXXXXXXMKEAFNVFDQNGDGFITVDELRSVLSSLGLKQGRTIEDCKRMIMK 196 L M +KEAF VFD++ +GFI+ ELR V+++LG K T E+ M + Sbjct: 71 NLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK--LTDEEVDEMXRE 128 Query: 197 VDVDGDGRVNFKEFRQMM 214 DVDGDG +N++EF ++M Sbjct: 129 ADVDGDGXINYEEFVKVM 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23598 (52 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24142 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27809 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16472 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 221848062 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22837 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32625 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51293454 (68 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27725 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812619 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239599 (64 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7788 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4826 484 e-139 >Cs4826 Length = 268 Score = 484 bits (1247), Expect = e-139, Method: Compositional matrix adjust. Identities = 238/254 (93%), Positives = 245/254 (96%), Gaps = 1/254 (0%) Query: 11 LRTTPFLGQSRGPSFNTLKDVVPMGTGKYTMGNDLWYGPDRVKYLGPFSAQTPSYLNGEF 70 LR TPFLGQSR + N LKDVVPMG KYTMGN+LWYGPDRVKYLGPFSAQTPSYL GEF Sbjct: 16 LRATPFLGQSRTTA-NALKDVVPMGNAKYTMGNELWYGPDRVKYLGPFSAQTPSYLTGEF 74 Query: 71 PGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLEKWVRVDFKEPVWFK 130 PGDYGWDTAGLSADPEAFA+NRALEVIHGRWAMLGALGCITPEVLEKW+RVDFKEPVWFK Sbjct: 75 PGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPEVLEKWLRVDFKEPVWFK 134 Query: 131 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVILMGLVEGFRINGLDGVGEGNNLYPGG 190 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQV+LMGLVEGFRINGL GVGEGN+LYPGG Sbjct: 135 AGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGNDLYPGG 194 Query: 191 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVA 250 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHL+NPVA Sbjct: 195 QYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLENPVA 254 Query: 251 NNAWVYATKFVPGS 264 NNAWVYATKFVPGS Sbjct: 255 NNAWVYATKFVPGS 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098750 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5249 (345 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9610 (418 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80709 164 1e-42 >Cs80709 Length = 246 Score = 164 bits (416), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 102/206 (49%), Positives = 130/206 (63%), Gaps = 20/206 (9%) Query: 222 MWLPLQ--KAGRLHLAVTVLDENGKEQKN--LQGLDLNRFHTQGDDSPDVQEKPDVKERR 277 MW+PLQ K GRLHLA+TVL+E+ K+ + G LN+ + D K D++E Sbjct: 1 MWIPLQNIKIGRLHLAITVLEESAKQGVDSPCDGGTLNKEGM--GNKEDQSNKEDIRE-- 56 Query: 278 NSFASDTXXXXXXXXXXXXXXXXVADHFEPIDIDGQKETGIWVHHPGSEVSQTWEARKGK 337 SFA++T VAD+FEPI+I+GQ+ETGIWVH PGSEV+QTWE RKGK Sbjct: 57 -SFANETTDKGSFSSVSSEKSPKVADNFEPINIEGQQETGIWVHQPGSEVAQTWEPRKGK 115 Query: 338 GRRLNTQIQGEPNGS-------GIGSQVNDTSSTDENPEDKRRMASVRRGLHKIGSVFHR 390 RRL+T ++ PNGS GS ND+SSTD+N E K S+RRGL KIGS+F R Sbjct: 116 NRRLDTLVRRVPNGSFNSTNSAASGSLNNDSSSTDDNQEGKN---SIRRGLRKIGSMFQR 172 Query: 391 NS-KEDNSCTFKEPLETPRVNLRAVN 415 NS KED++ + E +PR NLRAVN Sbjct: 173 NSRKEDHAGSIGEGCPSPRANLRAVN 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51561065 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763001 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18983 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6600 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20959 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21511 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs103996 155 3e-40 >Cs103996 Length = 236 Score = 155 bits (393), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 83/197 (42%), Positives = 115/197 (58%), Gaps = 7/197 (3%) Query: 18 KKLKYLEFVQVAAIYVVVCFSSLYEYAKENSGPLKPGVQTVEGTVRTVIGPVYEKLHGLP 77 ++L++L F+++AAI +VC SSLY+YAK NSGPL+ V TVE V V+GPVY+K G+P Sbjct: 8 QELRHLGFMRIAAIQALVCVSSLYDYAKRNSGPLRSPVGTVESAVTAVVGPVYQKFKGVP 67 Query: 78 FQFLKFVDRKVDESLSEVDRHVPVLVKQASSQALSVAREVEQG--GLVSTAKNITVSVYY 135 L F+D+KVDE+ + D H P L K+ +SQ S+ Q LVS A+ Sbjct: 68 DDLLVFLDKKVDEASRKFDEHAPPLAKRVASQVHSLIETASQKAQNLVSEAQTGGPRAAV 127 Query: 136 KYEPVAEQY-----AVSAWRALNRLPLFPLVAQIIVPTVSYWSGKYNRAVGYTANRGYSV 190 Y ++ +V AW LN LF +A + VPT + WS KYN V +GY+V Sbjct: 128 HYAAAESKHLLVTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTV 187 Query: 191 AAYLPLIPTERIAKVFE 207 YLPL+P + IAK F+ Sbjct: 188 FGYLPLVPIDDIAKAFK 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2618 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs3081 231 4e-63 >Cs3081 Length = 161 Score = 231 bits (588), Expect = 4e-63, Method: Compositional matrix adjust. Identities = 112/159 (70%), Positives = 125/159 (78%), Gaps = 1/159 (0%) Query: 3 AGKQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPXXXXXXGFVGPAG 62 A Q MV+G DDSE+ YAL+WTLDH F PFKL+IVHA+P G GP Sbjct: 4 AETQTMVVGIDDSEQSTYALQWTLDHFFAN-STVNPPFKLVIVHARPSPSAVIGLAGPGA 62 Query: 63 AEVLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILV 122 EVLP VD+D KK+AARV E AKE C+SKSV D VVEV+EGDARN+LCEAVE+HHASILV Sbjct: 63 VEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASILV 122 Query: 123 VGSHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPKTKH 161 VGSHGYGAIKRA+LGSVSDYCAHH HCTVMIVK+PKTKH Sbjct: 123 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7125 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240999 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28471 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18742 (277 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46602678 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48940805 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26077 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9979 (342 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56433206 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240017 (71 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9527 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11667 147 8e-38 >Cs11667 Length = 250 Score = 147 bits (372), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 92/240 (38%), Positives = 130/240 (54%), Gaps = 38/240 (15%) Query: 22 SSKSKFATSA-------VQLPSIGANASSRF-SMSAEWMPGEPRPPYLDGSAPGDFGFDP 73 +SKS+F T + V L + ++AS + + EW+PG P YL+GS PGD GFDP Sbjct: 17 ASKSRFLTGSSGKLNREVALKPVSSSASFKVEAKKGEWLPGLASPTYLNGSLPGDNGFDP 76 Query: 74 LRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAAVPGGQATYLG 133 L L E PENL+ + ++EL++ RWAML V G+L+PE + +W G+A Y Sbjct: 77 LGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIINVPQW--YDAGKAEYFA 134 Query: 134 NPVPWGTLPTILVIEFLSIAFVEHQR--------SMEKDPEKKK---------YPGGAFD 176 + T+ VIEF+ +VE +R S+ +DP K+ YPGG F+ Sbjct: 135 SS------STLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFN 188 Query: 177 PLGYSKDPXXXXXXXXXXXXNGRLALLAFVGFVVQQSAYPGTGPLENLATHLADPWHNNI 236 PL ++ NGRLA+LAF+GF+VQ + G GP ENL H++DPWHN I Sbjct: 189 PLNFAP----TDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812892 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs19106181 155 3e-40 >Cs19106181 Length = 303 Score = 155 bits (393), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 76/119 (63%), Positives = 90/119 (75%), Gaps = 5/119 (4%) Query: 37 EYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTXXXXXXXXXXXXIKFRGVDADINFNLGD 96 +YRGVTFYRRTGRWESHIWDCGKQVYLGGFDT IKFRGVDADINF++ D Sbjct: 154 QYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTALAAARAYDRAAIKFRGVDADINFHVDD 213 Query: 97 YEEDMKLLGDLNKEEFVHALRRQST-GASRGNSKYRGVAAAALPKCGARWEDLMGQVPG 154 Y++D++++ + K+EFV++LRRQ+T ASRG SKYRGV L KCG RWE MGQ G Sbjct: 214 YQDDIRIMSNFTKDEFVYSLRRQNTAAASRGTSKYRGV---TLHKCG-RWEARMGQYLG 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26368 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11002 (231 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18726 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14855 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10804 (576 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15399 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28902 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 87 1e-19 >Cs25776 Length = 104 Score = 87.4 bits (215), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 2/93 (2%) Query: 109 MAPELLSGKSNMVTEKIDVYSFGIVMWELLTGDEPYRDMHCASIIGGIVNNTLRPQIPPW 168 MAPE L G+ + EK DVYSFG+++WEL+T +P+ + A ++G + R IP Sbjct: 1 MAPEFLRGEPS--NEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQN 58 Query: 169 CDPEWKSLMESCWAPEPSQRPSFSEISQKLRNM 201 P SLMESCWA +P+QRPSF+ I + L+ + Sbjct: 59 TSPVLASLMESCWADDPAQRPSFANIVESLKKL 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5567 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9875 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60106184 77 2e-16 >Cs60106184 Length = 168 Score = 77.0 bits (188), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/77 (45%), Positives = 52/77 (67%) Query: 192 RLYVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIES 251 R +VG LAW + +L F G +LE+K++ DR++GRSRGFGFVT+ M AIE Sbjct: 9 RCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAIEG 68 Query: 252 LDGVDLNGRSIRVSAAE 268 ++G +L+GR+I V+ A+ Sbjct: 69 MNGQNLDGRNITVNEAQ 85 Score = 60.1 bits (144), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 30/76 (39%), Positives = 44/76 (57%) Query: 87 EPKLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQEAESAA 146 E + FVG L ++ + L F + G++ ++I D+ TGRSRGFGFVT + + A Sbjct: 7 EFRCFVGGLAWATTDSSLHEAFGAYGDILESKIINDRETGRSRGFGFVTFRDEKSMRDAI 66 Query: 147 RQLNGYELDGRALRVN 162 +NG LDGR + VN Sbjct: 67 EGMNGQNLDGRNITVN 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30141 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825009 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15951 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15346 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418420 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31648 (296 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs13890 145 7e-37 >Cs13890 Length = 225 Score = 145 bits (365), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 77/178 (43%), Positives = 111/178 (62%), Gaps = 2/178 (1%) Query: 68 LGGTGFVGSAICKAAVSRGIEVVGVSRSGRPTYSGAWIDQVNWVPGDVFYVN-WDEVLIG 126 LGG GFVGS IC+ A+ RG+ V +SRSGR + +W + V W G++ + W E L G Sbjct: 1 LGGNGFVGSHICREALDRGLTVASLSRSGRSSLRDSWANNVIWHQGNLLSSDSWKEALDG 60 Query: 127 ATAVVSTIGGFGSEEQMQRINGEXXXXXXXXXKDYGVPKFILISVHDYNLPPFLLSSGYF 186 TAV+S +GGFGS M +ING + GV +F+ IS D+ + +LL GY+ Sbjct: 61 VTAVISCVGGFGSNSYMYKINGTANINAIRAASEKGVKRFVYISAADFGVANYLLQ-GYY 119 Query: 187 TGKRKAESEVLSKYPNSGIVLRPGFIYGKRRVDGFEIPLDFIGEPLERFIKATENFTK 244 GKR AE+E+L++YP G++LRPGFIYG R V G ++PL IG P+E ++ + ++ Sbjct: 120 EGKRAAETELLTRYPYGGVILRPGFIYGTRTVGGMKLPLGVIGSPMEMVLQHAKPLSQ 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26608 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26019 (320 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10738 (362 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54021 343 2e-96 >Cs54021 Length = 255 Score = 343 bits (880), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 162/254 (63%), Positives = 197/254 (77%) Query: 1 MAKAPEQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNE 60 M +APEQEHP AFGWAA+DTSG LSPF+FSRR+TG++DV FKV +CGICH+DLH IKNE Sbjct: 1 MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNE 60 Query: 61 WGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKM 120 WG ++YP+VPGHEIVG VTEVGSKVSK K GDKVGVGCMVG+CH+C+SC +LENYCPK+ Sbjct: 61 WGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCHSCDSCAIDLENYCPKV 120 Query: 121 ILTYGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL 180 I+TY + Y D T+TYGGYSD MVA+E ++VR PE PLDA APLLCAGITVYSPL+++GL Sbjct: 121 IMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGL 180 Query: 181 AEPXXXXXXXXXXXXXXXXXXFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ 240 +P K +G PSKK EA+++LGA+ F+VSRD + Sbjct: 181 DKPGMHVGCXRLGRSRPCRPSIRKGYGGSGDCDQYPPSKKSEAIERLGAEFFLVSRDQNE 240 Query: 241 MQAAIGTLDGIIDT 254 MQAA+GT+DGIIDT Sbjct: 241 MQAALGTMDGIIDT 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939202 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13757 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11706 (247 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3252 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32030 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046338 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17483 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10998 (258 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58194 197 9e-53 >Cs58194 Length = 167 Score = 197 bits (501), Expect = 9e-53, Method: Compositional matrix adjust. Identities = 100/173 (57%), Positives = 113/173 (65%), Gaps = 7/173 (4%) Query: 85 MQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADRKRLFNMINELPTIFEVVTGTAKKQ 144 MQEKDWLSLVAVHSD+WLLAVAFYFGARFGF K +RK+LF MIN+LPTIFEVVTG AK+ Sbjct: 1 MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQP 60 Query: 145 VKEXXXXXXXXXXXXXXXXXXXXEPQPRHSKALQSKDAXXXXXXXXXXXXXXXXXXXXTL 204 + +P S+ K + Sbjct: 61 KDQSANHNSSKSKSSGKS-------RPAESQTKAVKMSPPPKDDDDSGDEEEEDDEQGAT 113 Query: 205 CGACGENYAADEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAK 257 CGACG+NY DEFWICCDICEKWFHGKCVKITPA+AEHIKQYKCPSCS+KRA+ Sbjct: 114 CGACGDNYGTDEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSCSSKRAR 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7431 (376 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22383 (371 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26492 114 2e-27 >Cs26492 Length = 262 Score = 114 bits (285), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 60/175 (34%), Positives = 98/175 (56%), Gaps = 2/175 (1%) Query: 43 LMYTATWPKEVRKIAADLLVKPVQVN-IGNVDELVANKSITQYVEVLTSMEKHRRLEQLL 101 +M++AT P +R + L P+ V+ +G+ D+ +A+ I+ Y + EK + QL+ Sbjct: 1 MMFSATMPPWIRSLTNKYLKNPLTVDLVGDSDQKLAD-GISLYSIATSMYEKPSIIGQLI 59 Query: 102 RSQEPGSKIIIFCSTKKMCDQLSRNLTRQFGAAAIHGDKSQSERDYVLNQFRSGRTPILV 161 G K I+F TK+ D+L+ + + + +HGD SQS+R+ L+ FR GR IL+ Sbjct: 60 TEYAKGGKCIVFTQTKRDADRLAHAMAKSYNCEPLHGDISQSQRERTLSAFRDGRFNILI 119 Query: 162 ATDVAARGLDIKDIRVVINYDFPTGVEDYVHRIXXXXXXXXXXLAYTFFGDQDAK 216 ATDVAARGLD+ ++ ++I+Y+ P E +VHR A + DQ A+ Sbjct: 120 ATDVAARGLDVPNVDLIIHYELPNTSETFVHRTGRTGRAGKKGSAILIYTDQQAR 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762459 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8707 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23191 248 6e-68 >Cs23191 Length = 225 Score = 248 bits (632), Expect = 6e-68, Method: Compositional matrix adjust. Identities = 126/193 (65%), Positives = 148/193 (76%), Gaps = 4/193 (2%) Query: 1 MYPGGYTAEVTSLSPKATEEDVYNFFGHCGAVEHVEIIRSGEYASTAYVTFRDAFALQTA 60 MY GGY AEV LSP ATE+D++ FF HCG HVEIIRSGE TAYVTF +A+AL+TA Sbjct: 1 MYAGGYVAEVVGLSPNATEKDIHEFFSHCGDPVHVEIIRSGECGGTAYVTFSNAYALETA 60 Query: 61 ILLSGARIVDQCVCITSWGSYIDESDAWNGSTYPEGNTSSTTYHSSQFVSTPGEAVTV-- 118 +LLSGA IVDQ VCI WG++ DE + W S + N+ S T H QFVSTPGEAVTV Sbjct: 61 VLLSGAAIVDQPVCIIRWGAFTDEPNPWISSWGFDENSGSMTTHVGQFVSTPGEAVTVAQ 120 Query: 119 --VKTLASKGYVLGKDALTKAKAFDESHQLSATAAAKVCELSDRIGLTEKIHAGREVVKT 176 VKT+ +KGYVL KDAL KAKA DES+ LSA+AAAKV ELS+RIGLT+KI+A E +K+ Sbjct: 121 DAVKTMIAKGYVLSKDALVKAKALDESYGLSASAAAKVAELSNRIGLTDKINASMEAIKS 180 Query: 177 VDEKFHVSDITKS 189 VDEK+HVSDITKS Sbjct: 181 VDEKYHVSDITKS 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20751 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69971 100 1e-23 >Cs69971 Length = 173 Score = 100 bits (248), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 75/194 (38%), Positives = 97/194 (50%), Gaps = 38/194 (19%) Query: 1 MQRQSLGGSPASKLH------QTHGGPNDQTLTVVDSPNRNKDLSVFXXXXXXXXXXXXX 54 MQRQSLG SP SKLH D LT + + + + Sbjct: 1 MQRQSLG-SPVSKLHIHGGGGGGGSSKEDLRLTELHPSSSSSSSAT-------------S 46 Query: 55 XXXYQDDEDHKASKPHRLS-SPPPIA----------PHKSIHVIPVXXXXXXXXXXXXSH 103 Y DD++ K +KP R S SPPP+A P K IH+IP+ SH Sbjct: 47 PTVYNDDDESKTTKPRRFSLSPPPLALSSSLSTHSRPEKLIHLIPLLTLFCFLVLYFSSH 106 Query: 104 IPSQSDLAQFNGFTKLPGSAKRVVSADSEIDDIGRFIDIRKSDVLAIRSLRNLQDTQTQK 163 PS SDLAQF+ F + P + + EIDD+ RFI++R+ D LAIRSLRN+Q+ + Q Sbjct: 107 SPSPSDLAQFHAFQR-PSNRR----DSGEIDDVNRFIELRRGDFLAIRSLRNIQEIEKQS 161 Query: 164 LVPRSRSHRKIADF 177 P+ R HRKIADF Sbjct: 162 --PKFRPHRKIADF 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25548 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17706 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7548 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2475 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig94 (796 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15448 (464 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389300 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779431 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21759 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1132 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42616 472 e-135 >Cs42616 Length = 265 Score = 472 bits (1215), Expect = e-135, Method: Compositional matrix adjust. Identities = 230/265 (86%), Positives = 241/265 (90%) Query: 1 MATSAIQQSAFAGQTALKQSSELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP 60 MATSAIQQSAFAGQTAL+QS+E VRK+G GGR +MRRTVKSAPQSIWYGPDRPKYLGP Sbjct: 1 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP 60 Query: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR 120 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS+ Sbjct: 61 FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK 120 Query: 121 NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVXXXX 180 NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+ Sbjct: 121 NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGGP 180 Query: 181 XXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTGKGPVE 240 AFDPLGLADDP+ FAELKVKELKNGRLAM SMFGFFVQAIVTGKGP+E Sbjct: 181 LGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIE 240 Query: 241 NLFDHIADPVANNAWAYATNFVPGK 265 NL+DHIADPVANNAWAYATNFVPGK Sbjct: 241 NLYDHIADPVANNAWAYATNFVPGK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7338 (61 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790703 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91270 131 1e-33 >Cs91270 Length = 76 Score = 131 bits (330), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 65/72 (90%), Positives = 66/72 (91%) Query: 22 MYAGDIMTVNVNLAGLPALVLPCGFVEGGCAALPVGLQMIGAAFDEGKLLKVGHIFEQIL 81 MY+GDIMTVNVNLAGLPALVLPCGFVEGG LPVGLQMIGAAFDEGKLLKVGHIFEQ L Sbjct: 1 MYSGDIMTVNVNLAGLPALVLPCGFVEGGPVGLPVGLQMIGAAFDEGKLLKVGHIFEQTL 60 Query: 82 QNCNFVPPLIAD 93 Q C FVPPLIAD Sbjct: 61 QGCRFVPPLIAD 72 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30575 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs61560 144 1e-36 >Cs61560 Length = 153 Score = 144 bits (364), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 69/119 (57%), Positives = 83/119 (69%) Query: 213 MWRNLLVQAMYQVTVLLVLNFKGNRILGLQKDVQKHAIGVKNTLIFNAFVFCQIFNEFNA 272 MWRNLL+QA YQV+VLLVLNF+G RIL L+ D H+ VKNTLIFN+FV CQIFNEFNA Sbjct: 1 MWRNLLIQASYQVSVLLVLNFQGKRILNLESDSNAHSNKVKNTLIFNSFVLCQIFNEFNA 60 Query: 273 RKPEEINVFIGVTKNYLFMXXXXXXXXXXXXXXMFLGKFTKTVRLSWQQWLICLGIAIV 331 RKP+E N+F G+TKN LFM FLGKF T RL+W+ W+I + I + Sbjct: 61 RKPDEKNIFGGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFI 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793466 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14959 (537 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747176 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24186 (249 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13327 (496 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10036 256 3e-70 >Cs10036 Length = 267 Score = 256 bits (655), Expect = 3e-70, Method: Compositional matrix adjust. Identities = 131/266 (49%), Positives = 177/266 (66%), Gaps = 6/266 (2%) Query: 36 RASRFSANFGAKVGICELPFHPVSSEVIGGVGGTCVIRGCVPKKILVYGASFGGEIEDAR 95 RASRF+ANFGA V ICELPF +SSE GGVGGTCV+RGCVPKK+LVY + F E +++ Sbjct: 1 RASRFAANFGASVAICELPFSTISSETTGGVGGTCVLRGCVPKKLLVYASKFSHEFDESN 60 Query: 96 NYGWEVNEKVDFNWKKLLQKKTDEIVRLNGIYKRLLSNSGVKFFEGEGKIVGPNDVEVTQ 155 +GW+ + +W L+ K E+ RL GIYK +L N+G+ EG GKIV P+ V+V Sbjct: 61 GFGWKYGTEPQHDWSTLIANKNAELQRLTGIYKNILINAGITLIEGRGKIVDPHTVDV-- 118 Query: 156 LDGTKLSYSAKHILIATGSRAQRPAIPGQELGISSDEALSLEELPKRAVVLGGGYIAVEF 215 DG KL YSA+HILI+ G R P IPG E I SD AL L P++ ++GGGYIA+EF Sbjct: 119 -DG-KL-YSARHILISVGGRPFIPDIPGSEYAIDSDAALDLPSKPEKIAIVGGGYIALEF 175 Query: 216 ASIWRGMGASVDLFFRKELPLRGFDDELRAVVARNLEGRGIDLHPQTNLTELVKTEDG-I 274 A I+ G+ + V +F R++ LRGFD+++R VA + RGI+ H + + ++K+ DG + Sbjct: 176 AGIFSGLTSEVHVFIRQKKVLRGFDEDIRDFVAEQMSLRGIEFHTEESPQAILKSTDGSL 235 Query: 275 KVRTDHGEELIADVVLFATGRSPNTK 300 V+T+ G V+FATGR PNTK Sbjct: 236 SVKTNKGTVDGFSHVMFATGRXPNTK 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27867 (626 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5104 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48485736 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825476 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8734 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 82 5e-18 >Cs89949 Length = 240 Score = 82.4 bits (202), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 70/209 (33%), Positives = 100/209 (47%), Gaps = 23/209 (11%) Query: 40 GACGYGSLASGFSGGHLAAGVPSLFKGGAGCGACFQMRCKN-TTLCTKQGTIVTLTDL-- 96 GACGYG+L S G + AA +LF G CGACFQ+ C N C + IVT T+ Sbjct: 43 GACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFQIMCANDPQWCLRGSIIVTATNFCP 102 Query: 97 -----NQSNQTDFVLSSRAFAAMAQKGLDQHILRRGILDVEYKRVPCEYKNQNLSLRVEE 151 + N F LS F +AQ R GI+ V Y+RV C+ +N + + Sbjct: 103 PGGWCDPPNH-HFDLSQPVFQHIAQ-------YRAGIVPVIYRRVRCK-RNGGIRFTING 153 Query: 152 SSQKPHYLAVKILYQGGQTEIVAMDVAQVGSSNWSFLSRNNGAIWKTSRVPAGALQFRFV 211 S ++ V I GG ++ A+ + + + W +SRN G W+++ G FV Sbjct: 154 HS---YFNLVLITNVGGAGDVHAVSI-KGSRTRWQPMSRNWGQNWQSNSYLNGQ-SLSFV 208 Query: 212 VTSGYDGKTVWAPNVLPVNWKSGMIYDTR 240 VT+ +G +V + NV P NW G Y R Sbjct: 209 VTTS-NGHSVVSYNVAPPNWSFGQTYTGR 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22044 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73702 206 3e-55 >Cs73702 Length = 143 Score = 206 bits (523), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 100/117 (85%), Positives = 104/117 (88%) Query: 116 MWEDDNEGFVGCFLIKKDGSKTGQGRRGYLQEGAWDAIHVIEVGPEEEGTAHYRLTSTVM 175 MWEDDNEGFV CFLIKKDGSKT QGRR +L+EGAWDAIHVIEV PEEEG A Y LTSTVM Sbjct: 1 MWEDDNEGFVACFLIKKDGSKTAQGRRRHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVM 60 Query: 176 LSLTTDNESSGTFSLSGSIRRQMNMHLSTEEGHLCNMGRMIEEMESKLRNSLDQGLF 232 LSLTTD+ESSGTFSLSGSIRRQMNM LS EGHLCNMG+MIEEME KLRNSLDQ F Sbjct: 61 LSLTTDHESSGTFSLSGSIRRQMNMDLSVSEGHLCNMGKMIEEMEGKLRNSLDQVYF 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14960 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3685 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91019281 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18122 76 6e-17 >Cs18122 Length = 107 Score = 76.3 bits (186), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 34/65 (52%), Positives = 41/65 (63%) Query: 30 TLPQSACTPRCKNRCSATSHKKPCMFFXXXXXXXXXXVPPGVVGNKQMCPCYNNWKTQEG 89 T+ C +C RCS T ++KPC+FF VPPG GNK +CPCYNNWKT+EG Sbjct: 43 TVKSYQCPGKCDTRCSQTQYRKPCLFFCNKCCKKCLCVPPGYYGNKAVCPCYNNWKTKEG 102 Query: 90 RPKCP 94 PKCP Sbjct: 103 GPKCP 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2468 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6539 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14670 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7487 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91039667 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226781173 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10909 (570 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs82072 436 e-124 >Cs82072 Length = 267 Score = 436 bits (1121), Expect = e-124, Method: Compositional matrix adjust. Identities = 226/270 (83%), Positives = 243/270 (90%), Gaps = 5/270 (1%) Query: 303 IELIRQCVKLQRLWILDCIGDKGLGVVAKSCKELQELRVFPSDPFAAGHASVTEEGLVAI 362 I+LIR C KL+RLWILD IGD+GL VVA +CKELQELRVFPS +A+VTEEGLVAI Sbjct: 1 IKLIRFCRKLERLWILDSIGDRGLRVVAFTCKELQELRVFPS---GVDNAAVTEEGLVAI 57 Query: 363 SAGCPKIHSLLYFCQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMQPLDEGFGAI 422 SAGCPK+HSLLYFCQQMTNAALITVAKN NF RFRLCILD KPD VTMQPLDEGFGAI Sbjct: 58 SAGCPKLHSLLYFCQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAI 117 Query: 423 VQACKKIRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLE 482 VQ+CK++RRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAG+SDKGMLYVLNGCKKLRKLE Sbjct: 118 VQSCKRLRRLSLSGLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLE 177 Query: 483 IRDSPFGNKALLRDVGKYEAMRSLWMSSCEVTLGGCKALAKKMPRLNVEIINENDQMD-- 540 IRDSPFGN ALL DVGKYE MRSLWMSSCEVTLGGC+ LAKKMPRLNVEIINE+DQM+ Sbjct: 178 IRDSPFGNTALLTDVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFS 237 Query: 541 LDDEQRVEKMYLYRTLVGKRRDTPEFVWTL 570 LDD Q+V KMYLYRTLVG R+D P+FVWTL Sbjct: 238 LDDRQKVGKMYLYRTLVGPRKDAPDFVWTL 267 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48282335 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs162106182 119 5e-30 >Cs162106182 Length = 107 Score = 119 bits (299), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 64/82 (78%), Positives = 72/82 (87%) Query: 1 MALTKAKELVSTNSVVVFSKTHCPFCVNVKQLLTQLGASYKAIELDSESDGAQIQSALAE 60 MAL KA+E VS+NSVVVFSKT CPFCV+VK+L QLG ++KAIELD ESDG+ IQSALAE Sbjct: 1 MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAE 60 Query: 61 WTGQRTVPNVFISGNHIGGCDS 82 WTGQ+TVPNVFI G HIGGCDS Sbjct: 61 WTGQKTVPNVFIGGKHIGGCDS 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25141 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25777 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16126 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8538 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs28553 137 6e-35 >Cs28553 Length = 152 Score = 137 bits (345), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 66/80 (82%), Positives = 73/80 (91%) Query: 1 MRRLTKANIRILSKENLPKIASEDDEMVQISGDLDIVKDALIQVVTRLRANIFDREGGMS 60 MRRLTKANIRIL KENLPKIASEDDEMVQISGDLD+ KDALIQV+TRLRAN+FDREG +S Sbjct: 1 MRRLTKANIRILPKENLPKIASEDDEMVQISGDLDLAKDALIQVMTRLRANLFDREGAVS 60 Query: 61 GFLPVLPYLPVSADGPDGPN 80 F+PVLPY+PVS +G DG N Sbjct: 61 TFVPVLPYIPVSENGSDGLN 80 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14424 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs28826 119 1e-29 >Cs28826 Length = 277 Score = 119 bits (297), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 58/84 (69%), Positives = 63/84 (75%) Query: 28 KTSTSSHPPLKCPMAGTFYRCPAPGEPSFXXXXXXXXXXXXICIIEAMKLMNEIEADQSG 87 K+ SS PPLKCPMAGTFYR PAPGEP F +CIIEAMKLMNEIEAD+SG Sbjct: 194 KSVKSSLPPLKCPMAGTFYRSPAPGEPPFVKVGDRVQKGQVLCIIEAMKLMNEIEADRSG 253 Query: 88 TVAEILVEDGKPVSVDTPLFVIVP 111 T+ EI+ ED KPVSVDTPLFVI P Sbjct: 254 TIVEIIAEDRKPVSVDTPLFVIEP 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27473 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25217 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31178 178 4e-47 >Cs31178 Length = 112 Score = 178 bits (452), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 81/98 (82%), Positives = 93/98 (94%) Query: 1 MVKDASQGISYVCNNIADYGGDPNRIYLMGQSAGAHISACALLDQAIKEAKKEESISWSV 60 MVKDASQGIS+VCNNI++YGGDP+RIYLMGQSAGAHI+AC LL+QAIKE + ES +WSV Sbjct: 1 MVKDASQGISFVCNNISEYGGDPDRIYLMGQSAGAHIAACTLLEQAIKETGEGESTTWSV 60 Query: 61 SQIKAYFGLSGGYNLFNLVDHFHNRGLYRSIFLSIMEG 98 SQI+AYFGLSGGYNLF+LVDHFH+RGLYRSIFLSIM+G Sbjct: 61 SQIRAYFGLSGGYNLFDLVDHFHSRGLYRSIFLSIMDG 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10895 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12709 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226771428 (71 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21491 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39821 387 e-110 >Cs39821 Length = 258 Score = 387 bits (993), Expect = e-110, Method: Compositional matrix adjust. Identities = 203/268 (75%), Positives = 218/268 (81%), Gaps = 10/268 (3%) Query: 1 MASTACFXXXXXXXXXXXXXXXXXXXXXVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 MAST CF V NI K Q+V CRAQKQA +E+ G+ VSR Sbjct: 1 MASTQCFLHHHALSTTPARTSSSQRH--VSNI-KPTQIV-CRAQKQAV--QEDDGSAVSR 54 Query: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWNPSK 120 RLALTVLIGAAA+GSKVSPADAAYGESANVFGKPK+NTDFLPY G+GFKLSIP+KWNPSK Sbjct: 55 RLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSK 114 Query: 121 EVEFPGQVLRYEDNFDSNSNVSVTITPTDKKSIADYGSPEEFLAKVDYLLGKQAYFGKTE 180 E EFPGQVLRYEDNFD NSNVSV ITPTDKKSI DYGSPEEFL+KVDYLLGKQAY GKT Sbjct: 115 EREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTS 174 Query: 181 SEGGFDPGAVATANILESSSRVIDGKQYYYVSVLTRTADGDEGGKHQLITATVKDGKLYI 240 SEGGFDP AVATANILE+S R YY++SVLTRTADGDEGGKHQLITATVK GKLYI Sbjct: 175 SEGGFDPDAVATANILEASVR----PPYYFLSVLTRTADGDEGGKHQLITATVKGGKLYI 230 Query: 241 LKAQAGDKRWFKGARKFVESTASSFSVA 268 KAQAG++R FKGARK+VESTASSFSVA Sbjct: 231 CKAQAGEQRGFKGARKYVESTASSFSVA 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9606 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10179 (434 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4064 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 61 1e-11 >Cs31373 Length = 293 Score = 60.8 bits (146), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/84 (41%), Positives = 53/84 (63%), Gaps = 4/84 (4%) Query: 3 WTPELHERFIEAVNRLDGAEKATPKGVLKAMNVEGLTIYHVKSHLQKYRLARYMPEKKED 62 WTPELH RF++AV +L G +KA P +L+ M ++ LT +++ SHLQKYR R +E Sbjct: 90 WTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSHRKHLLAREA 148 Query: 63 KKASNSEEKK--ATSTINESDGRR 84 + AS S ++ +T+ S G+R Sbjct: 149 EAASWSHRRQMYGGATV-PSGGKR 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31570 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10220 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31347 (459 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7726 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 157 1e-40 >Cs30681 Length = 257 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 84/205 (40%), Positives = 121/205 (59%), Gaps = 9/205 (4%) Query: 71 NGSLHDFLHLSDEYNKPLTWNSRVKIALGTARALEYLHEVCSPSIIHKNIKSTNILLDVE 130 N S+ D HL+ + L WN+R+KIA AR L YLHE II ++ KS+NILLD + Sbjct: 3 NRSVQD--HLTSRFQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQ 60 Query: 131 LNPHLSDAGLASSIPNADQALDHNAGS-----GYSAPEVAMSGQYTLKSDVYGFGVVMLE 185 N LSD GLA P+ L H + + GY+APE +G+ T KSD++ FGV + E Sbjct: 61 WNAKLSDFGLARLGPS--DGLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYE 118 Query: 186 LLSGRKAFDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALC 245 L++GR+ D +P+SEQ L+ W P L D + ++DP+L+G Y +K + A V C Sbjct: 119 LITGRRPLDRNRPKSEQKLLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANKC 178 Query: 246 VQPEPEFRPPMSEVVQALVRLVQRA 270 + + + RP MSEVV+ L ++V A Sbjct: 179 LARQAKGRPKMSEVVEVLNKIVDAA 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9034 (386 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25409 70 4e-14 >Cs25409 Length = 359 Score = 70.1 bits (170), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 28/58 (48%), Positives = 36/58 (62%) Query: 114 YRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPE 171 YRG+RQR WGKW AEIR P+ R+WLGTF+T +RG+ A++NFP Sbjct: 166 YRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDQAAYKLRGEFARLNFPH 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747027 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 231 3e-63 >Cs81333 Length = 370 Score = 231 bits (590), Expect = 3e-63, Method: Compositional matrix adjust. Identities = 110/186 (59%), Positives = 138/186 (74%), Gaps = 3/186 (1%) Query: 3 SEPVNVNEYQELARQALPKMYYDFHTGGAEDQHTLKENVEAFRRITLRPRILVDVSRIDM 62 E NV EY+ +A++ LPKM +D++ GAEDQ TL+EN AF RI RPRIL+DVS+IDM Sbjct: 2 GEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDM 61 Query: 63 STTVLGYKISAPIMLAPTSMHQLAHPEGEVXXXXXXXXCNTIMILSSISSCTVEEVASSC 122 +TTVLG+KIS PIM+APT+M ++AHPEGE TIM LSS S+ +VEEVAS+ Sbjct: 62 NTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTG 121 Query: 123 NSVRFFQLYVFKRRDISAQIVRRAEENGYKAIVLTVDAPRPGRREADIKNKMVAP---QL 179 +RFFQLYV+K R++ AQ+VRRAE G+KAI LTVD PR GRREADIKN+ P L Sbjct: 122 PGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTL 181 Query: 180 RNFEGL 185 +NF+GL Sbjct: 182 KNFQGL 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30418 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28229 (502 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25763 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16124 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31969 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27622 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5118 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 52024425 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs194106183 275 2e-76 >Cs194106183 Length = 182 Score = 275 bits (704), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 131/181 (72%), Positives = 150/181 (82%), Gaps = 3/181 (1%) Query: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQ 59 MASSMISS TV+T +RA+ AQASMVAPFTGLKSSSAFP T+K+N DITSIASNGGRVQ Sbjct: 1 MASSMISSTTVATA--NRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQ 58 Query: 60 CMQVWPPLGLKKFETXXXXXXXXXXXXAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSP 119 CM+VWPP GLKKFET KE+ YLLR W+PCLEFELE G+VYRE+H SP Sbjct: 59 CMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSP 118 Query: 120 GYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYK 179 GYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP++F+RIIGFDN RQVQCISF+A K Sbjct: 119 GYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAK 178 Query: 180 P 180 P Sbjct: 179 P 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13954 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 69 6e-14 >Cs36939 Length = 275 Score = 68.6 bits (166), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 27/45 (60%), Positives = 37/45 (82%) Query: 76 LIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGI 120 +II L ALLGNRW+ IA LP RTDN++KNYWN+H++KK+ K+ + Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQL 45 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17400 (139 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29641 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12349 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26787 (444 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66689 162 6e-42 >Cs66689 Length = 145 Score = 162 bits (410), Expect = 6e-42, Method: Compositional matrix adjust. Identities = 85/181 (46%), Positives = 102/181 (56%), Gaps = 38/181 (20%) Query: 265 MKEFDDNIPTRAFDNFQFVNFTQIMSKNVPPSRKETEFALAALMEIPSQYKATLELSLLG 324 M++FDD IP R FDNFQFVNFT IMSKN PS KET FALAALMEIP QYKA +EL ++G Sbjct: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 Query: 325 GRKGNIPERVPLPPPV-YGASSFSSSKPSRGTGFSTPSFTKPSQTTSYEPSVPPYYGDSS 383 G + P PPP Y + +PSRG STP Sbjct: 61 RTTGRAKKIAPRPPPAPYSRRALPERQPSRG---STP----------------------- 94 Query: 384 SVGTAPSAPSSTYDHQVCPICLTNSKDMAFGCGHQTCCDCGQDLHSCPICRTTIQTRIKL 443 + Q CPICLTN+KD+AFGCGH TC +CG + +CPICR I R++L Sbjct: 95 -----------VAETQACPICLTNAKDLAFGCGHMTCRECGSRVSNCPICRQRITNRLRL 143 Query: 444 Y 444 + Sbjct: 144 F 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19762 (385 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7384 (326 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 186 4e-49 >Cs66150 Length = 305 Score = 186 bits (471), Expect = 4e-49, Method: Compositional matrix adjust. Identities = 100/250 (40%), Positives = 142/250 (56%), Gaps = 1/250 (0%) Query: 18 QGKESEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASI 77 +G S+ QL +FYS++CPNV + + + + I A+ +RL HDCFV+GCDASI Sbjct: 26 EGSPSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASI 85 Query: 78 IIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAVAARDCVVLAG 137 ++ S N + FA + + GF+ + K AVE CP VVSCADIL +AA V L+G Sbjct: 86 LLDSTNTIDSEKFAAPNNNSARGFEVIDNMKAAVERACPRVVSCADILTIAAERSVALSG 145 Query: 138 GPSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLS-LTDVIALSGAHTLG 196 GPS+ V LGRRD + + NLP P L++L + F L+ D++ALSGAHT G Sbjct: 146 GPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTFG 205 Query: 197 FSHCNRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAY 256 + C F RLY+F+ + DP+L+ + +QL CP + ++ D TP FDN Y Sbjct: 206 RAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNKY 265 Query: 257 YRNLVAGKGL 266 + NL K Sbjct: 266 FSNLRGRKAF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10692 (260 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 87 2e-19 >Cs89949 Length = 240 Score = 86.7 bits (213), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 70/226 (30%), Positives = 100/226 (44%), Gaps = 17/226 (7%) Query: 34 WLPAIATWYGNPEXXXXXXXXXXXXXMVDVKPFRARVGAVNPVLFKSGEGCGACYKIKCL 93 W+ A AT+YG + + + + A++ LF +G CGAC++I C Sbjct: 24 WINAHATFYGGGDASGTMGGACGYGNLYS-QGYGTNTAALSTALFNNGLSCGACFQIMCA 82 Query: 94 -DQSICSRRPVTIIVTDECP---GCSKGPAQFDLSGAAFGRMAVAGEGGLLRNQGELSVL 149 D C R + + T+ CP C FDLS F +A G + V+ Sbjct: 83 NDPQWCLRGSIIVTATNFCPPGGWCDPPNHHFDLSQPVFQHIA-------QYRAGIVPVI 135 Query: 150 YRRTPCKYPGKQIAFHVNEGSTNYWLSLLVEFEDGDGDVGSMHIRPASSSEWIEMSHVWG 209 YRR CK G I F +N S Y+ +L+ G GDV ++ I+ S + W MS WG Sbjct: 136 YRRVRCKRNGG-IRFTINGHS--YFNLVLITNVGGAGDVHAVSIK-GSRTRWQPMSRNWG 191 Query: 210 ANWCINGGPLKGPFSVKITTLSTAKTLSARDVIPGNWSPKATYTSR 255 NW N L G + T S ++ + +V P NWS TYT R Sbjct: 192 QNWQSN-SYLNGQSLSFVVTTSNGHSVVSYNVAPPNWSFGQTYTGR 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19230 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30239 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96440 329 1e-92 >Cs96440 Length = 212 Score = 329 bits (844), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 160/211 (75%), Positives = 184/211 (87%), Gaps = 2/211 (0%) Query: 19 LKLYSYWMSSCSFRVRIALNLKGLKYEYKA--LAKGEQFSPEFRKLNPMGYVPVLVDGDT 76 LKLYSYW SSCS RVRI LNLKGL+YEYKA L KGEQFSP+F K+NP+GYVP LVDGD Sbjct: 2 LKLYSYWRSSCSHRVRIGLNLKGLEYEYKAVNLVKGEQFSPDFLKINPIGYVPALVDGDF 61 Query: 77 VVADSFAIILYLEEKYPQHPLLPPDLQKKAINYQAANIVSSSIQPLQNMTVLKYIEEKVR 136 VV+DSFAI++YLEEKYPQ PLLP DL++KAINYQAANIVSSSIQPLQN+ V+KYIEEK Sbjct: 62 VVSDSFAILMYLEEKYPQPPLLPSDLKRKAINYQAANIVSSSIQPLQNLAVVKYIEEKAG 121 Query: 137 PVEKLEWVQFHIGKGFLALEELLNNHAGKYATGDEVYMADLFLAPQLYAAITRFQLDMTQ 196 E+ W + HIGKGF ALE+LL ++AGKYATGDEV++ADL+LAPQLYAA+ RF LDMTQ Sbjct: 122 ADERDIWAKTHIGKGFAALEKLLKDYAGKYATGDEVFLADLYLAPQLYAAVNRFNLDMTQ 181 Query: 197 FPLLARLHEAYNKIPAFLDALPEKQPDAPSS 227 FPLL +LHEAY+K+PAF +A PEKQPDAPSS Sbjct: 182 FPLLLKLHEAYSKLPAFQNAAPEKQPDAPSS 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30538 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783864 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs51828 78 4e-17 >Cs51828 Length = 166 Score = 78.2 bits (191), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 44/103 (42%), Positives = 62/103 (60%), Gaps = 3/103 (2%) Query: 1 LLQKIWPGLAGIQGPFYAGTGCFHRRKVFYGSSL--TDNEGNLTSERLNKGCFGNSPELI 58 L + I G+ GIQGPFY GTG FHRR V YG L +++GN+ + L K FGNS E I Sbjct: 18 LNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKK-FGNSKEFI 76 Query: 59 RSATQILLEENIDQPDDLSCAVDAAYHVAHSEFEHDTLWGKKV 101 +SA Q L + ++S ++D A+ VA +E+ + WG +V Sbjct: 77 KSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEV 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14379 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26880 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775327 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3348 (268 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs39821 348 5e-98 >Cs39821 Length = 258 Score = 348 bits (892), Expect = 5e-98, Method: Compositional matrix adjust. Identities = 186/268 (69%), Positives = 204/268 (76%), Gaps = 10/268 (3%) Query: 1 MASTACFXXXXXXXXXXXXXXXXXXXXXVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 MAST CF V NI K Q+V CRAQKQA +E+ G+ VSR Sbjct: 1 MASTQCFLHHHALSTTPARTSSSQRH--VSNI-KPTQIV-CRAQKQAV--QEDDGSAVSR 54 Query: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGKGFKLSIPAKWNPSK 120 RLALTVLIGAAA+GSKVSPADAAYGESANVFGKPK+NTDFLPY G GFKLSIP+KWNPSK Sbjct: 55 RLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSK 114 Query: 121 EVEYPGQVLRYEDNFDXXXXXXXXXXXXDKKSIGDYGPPEGFLTQVDYLLGKQAYFGKTD 180 E E+PGQVLRYEDNFD DKKSI DYG PE FL++VDYLLGKQAY GKT Sbjct: 115 EREFPGQVLRYEDNFDPNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTS 174 Query: 181 SEGGFDSGAVATANILESSSQAVDGKQYYYISVLTRTADGDEGGKHQLITATVKDGKLYI 240 SEGGFD AVATANILE+S + YY++SVLTRTADGDEGGKHQLITATVK GKLYI Sbjct: 175 SEGGFDPDAVATANILEASVRP----PYYFLSVLTRTADGDEGGKHQLITATVKGGKLYI 230 Query: 241 LKAQAGDKRWFKGARKFVENTASSFSVA 268 KAQAG++R FKGARK+VE+TASSFSVA Sbjct: 231 CKAQAGEQRGFKGARKYVESTASSFSVA 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859229 (53 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3562 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990999 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22683 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 118 5e-29 >Cs16453 Length = 223 Score = 118 bits (296), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 57/162 (35%), Positives = 93/162 (57%), Gaps = 4/162 (2%) Query: 107 ESILVATDYFSNANKLGQGGFGPVYKGKLPGGQEIAVKRLSSCSGQGL----EEFKNEVL 162 E I+ AT+ F+ + +G+GG G VY+ K+P G+ AVK+ S + EEF NE+ Sbjct: 34 EEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQEEFLNEIQ 93 Query: 163 LIAKLQHRNLVQLLGYCVEGEEKMLVYEYMANKSLDSFIFDRKLCVSLNWDMRFNIILGI 222 + +++HRN+V+ +C + ++YEY+ + SLD + + L W R N+I G+ Sbjct: 94 ALTEIRHRNIVKFYCFCSHPKHSFIIYEYLESGSLDKILCNDASAKELGWTQRLNVIKGV 153 Query: 223 ARGLLYLHQDSRLRIIHRDLKTSNILLGEEMNPKISDFGLAR 264 A L YLH + I+HRD+ + N+LL +SDFG+A+ Sbjct: 154 ADALFYLHNNCFPPIVHRDISSKNVLLDLGYEAHVSDFGIAK 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27941 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37806 181 7e-48 >Cs37806 Length = 239 Score = 181 bits (460), Expect = 7e-48, Method: Compositional matrix adjust. Identities = 86/166 (51%), Positives = 111/166 (66%), Gaps = 3/166 (1%) Query: 3 ISCNGCRILRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLR 62 +SCNGCR+LRKGCSE+C +RPCLQWI+SPESQ +ATVF+AKF+GRAGLM+ I+A PE R Sbjct: 1 MSCNGCRVLRKGCSESCILRPCLQWIESPESQGHATVFVAKFFGRAGLMSFISAVPESQR 60 Query: 63 PAIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQVAVEAVLKGQPITPITSEAAANGHG 122 PA+F+SLLYEACGR VNP+ G+VGLLW+G+W +CQ AVE VL+G + P+ + G Sbjct: 61 PALFQSLLYEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLRGGTLRPVPELLNSCGGS 120 Query: 123 PPLKAYDIRH---VSKDENSAASNDPQKVKTRYRFKRSAVKPKTNK 165 P + D+ D + R+ RS V P K Sbjct: 121 PTPTSDDVSEAEVTCTDMSRLQDRSFPSSHCRFSSSRSKVSPAKRK 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19704 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 59 3e-11 >Cs36939 Length = 275 Score = 59.3 bits (142), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 8/71 (11%) Query: 80 LIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQAENITPGQSSEVNDQ--- 136 +I+ L A GNRW+ IA +LP RTDN+IKNYW T ++K +++ + G SE N Q Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQLAAAG-CSEDNSQYRD 59 Query: 137 ----ASTSQVS 143 AS+ Q+S Sbjct: 60 ELASASSQQIS 70 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32163 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20015 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29831 (331 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20381 (69 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823766 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10840 (440 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783970 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16739 (215 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8015 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24483 (615 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10721 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16424 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs22681 65 3e-13 >Cs22681 Length = 148 Score = 64.7 bits (156), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 4/107 (3%) Query: 1 MELITGKRPVEAEFGDNKNIIYWVSNKVDTKEGAMEVLDKRLSDSLQEEMIQVLRIAVRC 60 +ELITG+ P++ EFG+ K+++ WV +D K G ++D L S ++++ +VL I++ C Sbjct: 42 LELITGRPPIDPEFGE-KDLVKWVCTTLDQK-GLDNIIDSNLDSSYKDQICRVLEISLLC 99 Query: 61 TYKAPSLRPSMKEVVQLLIEADPCRFDSCKSSTKTKEAPNVTKVKNP 107 T P RPSM++V +LL EA P R S + S KT + T +P Sbjct: 100 TNALPLNRPSMRKVGKLLAEA-PQR-TSLRPSRKTASSRLTTMKIHP 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24514 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26370 (406 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27026 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8513 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27617 135 7e-34 >Cs27617 Length = 249 Score = 135 bits (339), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 71/171 (41%), Positives = 97/171 (56%), Gaps = 2/171 (1%) Query: 6 YDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSE--LSSHQKKI 63 YD VTT+SP GR+FQ+EYA +AV IG++ K +V+ S+ L ++I Sbjct: 8 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDGIVMGVEKLIASKMMLPGSNRRI 67 Query: 64 FKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCTQRS 123 V H G+A+AGL ADGR + +SEA NY Y P+PV L ++A +CT Sbjct: 68 HSVHRHSGMAVAGLAADGRQIVTRAKSEATNYESVYGEPIPVKELAQRVASYVHLCTLYW 127 Query: 124 WKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER 174 W RP+G G+++GG D G LY PSG + Y AIG QAAKT +E+ Sbjct: 128 WLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGRQAAKTEIEK 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15287 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11106190 68 4e-14 >Cs11106190 Length = 174 Score = 68.2 bits (165), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 29/73 (39%), Positives = 53/73 (72%) Query: 12 EDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIA 71 +D LP A +++I+K+ LP + ++A+DA++ + EC EFI+ I+SE+++ C RE+++TI Sbjct: 28 QDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTIN 87 Query: 72 PEHVLKALQVLGF 84 + +L A+ LGF Sbjct: 88 GDDLLWAMATLGF 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28799 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8834 (104 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 84 3e-19 >Cs48454 Length = 244 Score = 84.3 bits (207), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 58/103 (56%), Positives = 76/103 (73%), Gaps = 3/103 (2%) Query: 1 MGEDLQILSFQELQNLEQQLDSALRRIRSRKNQVMYESISELQKKDKALQEQNNLLAKNV 60 MGEDL LS +ELQ++EQQ+DS L+ IRSRKNQ+M +SISELQKKDK L+EQNNLLAK V Sbjct: 113 MGEDLADLSLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQNNLLAKKV 172 Query: 61 KEKEKAVTSQAQLEHAQKQ---SLDSSSTLLPQELQYLNFRLA 100 KEKEK ++ +AQ Q+Q +SS+ L Q L ++++ Sbjct: 173 KEKEKLLSQEAQCREQQQQLNHDWNSSNVHLMQTLTNSSYQMG 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8789 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41729 140 1e-35 >Cs41729 Length = 181 Score = 140 bits (353), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 68/91 (74%), Positives = 78/91 (85%), Gaps = 3/91 (3%) Query: 16 GQSSANWCVCKDG--DPTALQRALDYACGAGADCNPIKPNGVCYNPNTIKAHCSYAVNSY 73 G S+ANWCVCKDG DP LQ+ALDYACGAGADCNPI NG CYNPNT+KAHCSYAVNSY Sbjct: 15 GHSTANWCVCKDGVGDPV-LQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSY 73 Query: 74 FQKKGQSTGTCDFSGTATATASDPSSNGCTY 104 FQ+KGQ+ G+CDFSG+AT +DPS+ GC+Y Sbjct: 74 FQRKGQAQGSCDFSGSATVATTDPSTAGCSY 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11703 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56431713 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16659 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15758 (278 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761363 (59 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5112 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24064 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9058 (494 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13809 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32982 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750865 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612112 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24202 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26121 (586 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810865 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs810 60 1e-11 >Cs810 Length = 224 Score = 60.5 bits (145), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 5/116 (4%) Query: 1 MSMIFNESLRLYPP--VAGFSRKVEREVRLGNVIVPANVGLVISNISFHHNRRIWGQDAQ 58 + I E+LR+YPP V G +E + +G VP L+++ H + R+W + Sbjct: 71 LRAIVKETLRIYPPGPVTGIREAME-DCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCE 129 Query: 59 LFKPERFAEGVAKAT-NNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSF 113 F+PERF A N ++PF G RSC G+ + ++ L+ ILQ + Sbjct: 130 -FRPERFLTTHADVDVNTQHFEYIPFSFGRRSCPGMTSGLQIVQLTLARILQGFDL 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11635 (418 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25511 (242 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86870 162 3e-42 >Cs86870 Length = 272 Score = 162 bits (410), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 82/232 (35%), Positives = 131/232 (56%), Gaps = 9/232 (3%) Query: 2 RPEIVLFGDSITEQSFQSGGWGAALADSYSRKADVKVRGYGGYNTRWALFLLQNLFPLDS 61 RP+ VLFG SI + F +GGWGA L+D Y+RKAD+ +RGY G+N+R AL +L +FP D+ Sbjct: 6 RPQFVLFGSSIVQLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDA 65 Query: 62 DKPPAAATIFFGANDAAILGRTSERQHVPLEEYKENLRKFVLHLKECSXXXXXXXXXXXX 121 P+ ++FG ND+ + HVPL EY EN+R+ HLK S Sbjct: 66 PIQPSLVIVYFGGNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPP 125 Query: 122 XDEDGRNEYARSLYGKDARELPERTNEVTGVYAKKCIELAEEMGLRSINLWSTLQETEGW 181 DE N+ ++ + RTNE+ Y+ CI L ++G+++++L++ +Q+ + W Sbjct: 126 VDEARINQGTSEIFSELV-----RTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDW 180 Query: 182 QKKFLSDGLHLTPEGNAVVHQEVVKVFTEAWFSAT----EMPHDFPHHSEID 229 + +DG+HL+ EG+ +V E++KV +A + + MP +F S D Sbjct: 181 KNACFTDGIHLSEEGSKIVVAEILKVLKQAEWKPSLHWKSMPTEFSEDSLYD 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13102 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9568 (610 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21714 172 6e-45 >Cs21714 Length = 286 Score = 172 bits (437), Expect = 6e-45, Method: Compositional matrix adjust. Identities = 98/245 (40%), Positives = 140/245 (57%), Gaps = 14/245 (5%) Query: 156 GTCKGATAGQMAFLLTGFGMLIVGAAGIRPCNLVFGADQFNQKTESGKRGVNSFFNWYMF 215 G+C+ A + QM +L T + GAAGIRPC FGADQF+++++ K ++ FFN++ Sbjct: 19 GSCEPAKSWQMLYLYTVLYITGFGAAGIRPCVSSFGADQFDERSKDYKTHLDRFFNFFYL 78 Query: 216 TFTFAQMIALTLIVYIQSNVSWSLGFGIPAILMLISCVLFFIGSKLYVKVKASGSPMNSV 275 + T ++A TL+VYIQ W FG AI M IS +LFFIG+ LY GSP+ V Sbjct: 79 SVTVGAIVAFTLVVYIQMEHGWGSAFGALAIAMGISNMLFFIGTPLYRHRLPGGSPLTRV 138 Query: 276 AQVVVVSIAKRHLKLKEPERPWLSMFVYMPPDSINS-----NLPYTNQFRCLDKAAILTP 330 AQV+V + KRH E L Y P ++ + +T+ FRCLDKAA+ Sbjct: 139 AQVLVAAFRKRHAAFSSSELIGL----YEVPGKHSAIKGSGKIDHTDDFRCLDKAALELK 194 Query: 331 EDKINPDGSAADPWRLCSMQQVEEVKCLLRVLPIWAAALIYHIAIVQQQTYVVFQALQSN 390 ED INP PW+LC++ QVEE K L+R++PI A ++ ++ + + T V QA N Sbjct: 195 EDVINP-----SPWKLCTVTQVEESKTLVRLVPIPACTIMLNVNLTEFLTLSVQQAYTMN 249 Query: 391 RRLGK 395 +GK Sbjct: 250 THMGK 254 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9457 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11667 436 e-124 >Cs11667 Length = 250 Score = 436 bits (1120), Expect = e-124, Method: Compositional matrix adjust. Identities = 212/253 (83%), Positives = 227/253 (89%), Gaps = 3/253 (1%) Query: 1 MATVTTQASAAIFRPCVNXXXXXXXXXXXXXNREVAFRPMASPPASSFKVEAKKGEWLPG 60 MATVTTQASAA+FRPC + NREVA +P++S ++SFKVEAKKGEWLPG Sbjct: 1 MATVTTQASAAVFRPCASKSRFLTGSSGKL-NREVALKPVSS--SASFKVEAKKGEWLPG 57 Query: 61 LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIG 120 L SP YL GSLPGDNGFDPL LAEDPENL+WY+QAELVN RWAMLGVVGMLLPEVFT IG Sbjct: 58 LASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIG 117 Query: 121 ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 180 I+NVP+WYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP Sbjct: 118 IINVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPP 177 Query: 181 GEVGYPGGIFNPLNFEPTLEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSD 240 EVGYPGGIFNPLNF PT EAKEKELANGRLAMLAFLGF+VQHNVTGKGPF+NLLQH+SD Sbjct: 178 NEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISD 237 Query: 241 PWHNTIVQTLSGS 253 PWHNTIVQTLSG+ Sbjct: 238 PWHNTIVQTLSGN 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14144 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3882 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28920 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12415 (250 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15142 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25482 (263 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12987 301 6e-84 >Cs12987 Length = 204 Score = 301 bits (770), Expect = 6e-84, Method: Compositional matrix adjust. Identities = 143/204 (70%), Positives = 159/204 (77%) Query: 59 VALTGVVFQPFEEVKNDAFVVPVSPQVSLARQRYTDESEAAINEQINVEYNVSYVYHALF 118 + LTGVVFQPFEEVK + VPVSP +SLARQ+Y DE EAAINEQINVEYNVSYVYHAL+ Sbjct: 1 MPLTGVVFQPFEEVKKEVLDVPVSPLLSLARQKYEDECEAAINEQINVEYNVSYVYHALY 60 Query: 119 AYFDRDNVALKGLANFFKXXXXXXXXXXXKLMEYQNKRGGRVKLHSVIAAPTEFDHAEKG 178 AYFDRDN+AL+GLA FFK K MEYQN RGG+VKLHS++ P+EFDHAEKG Sbjct: 61 AYFDRDNIALRGLAKFFKESSEEEREHAEKFMEYQNLRGGKVKLHSIMQPPSEFDHAEKG 120 Query: 179 DALYAMELAXXXXXXXXXXXXXXHKVADQNNDPQLMDFIESEFLAEQVEAIKKIADYVTQ 238 DALYAMELA H VAD+NNDPQ+ +F+ESEFL EQVEAI KIA YV+Q Sbjct: 121 DALYAMELALSLEKLTNEKLLSLHSVADRNNDPQMAEFVESEFLGEQVEAINKIAKYVSQ 180 Query: 239 LRRVGKGHGVWHFDQYLLHEGDAA 262 LR VGKGHGVWHFDQ LLHEGDAA Sbjct: 181 LRMVGKGHGVWHFDQMLLHEGDAA 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16998 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17519 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12560 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21429 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6662 (368 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs49233 125 8e-31 >Cs49233 Length = 326 Score = 125 bits (314), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 100/361 (27%), Positives = 149/361 (41%), Gaps = 54/361 (14%) Query: 11 VATFCAIVXXXXXXXXXXDLAALQSIRTGLTDSSLG--IFNSWVGTDCCVN-----WYGV 63 + F I+ D+ AL I+ +SLG + +WVG D C + W GV Sbjct: 10 ICIFSLILTAAQSKTLKRDVKALNEIK-----ASLGWRVVYAWVGDDPCGDGDLPPWSGV 64 Query: 64 SCDPTTGRVVDINLRGESEDPILKKSGQSGFMSGSISPKICSLDRLTTLVLADWKGVTGE 123 +C S Q + R+ T + + G Sbjct: 65 TC-----------------------STQGDY-------------RVVTELEVYAVSIVGP 88 Query: 124 IPQCLTTLSNLRVLDLVGNKISGKIPADIGNLKMLRVLNLADNQISGKIPASLVGLSGLM 183 P +T L +L LDL NK++G IP IG LK LR+LNL N++ IPA + L L Sbjct: 89 FPIAVTNLLDLTRLDLHNNKLTGPIPPQIGRLKRLRILNLRWNKLQDVIPAEIGELKRLT 148 Query: 184 HMDLSNNQITGELPADFGKLKMLSRALLNRNQLTGSIPDSIGNMNRLADLDLSRNQMWGS 243 H+ LS N GE+P + L L L N+LTG IP +G + LD+ N + G+ Sbjct: 149 HLSLSFNNFKGEIPKEIANLPELRYLYLQENRLTGRIPPELGILPNFRHLDVGNNHLVGT 208 Query: 244 VPDCL---GKMQVLSTLNLDGNKFSGQLPASVLSNRGMGILNLSRNGFEGNIPDVFHGNS 300 + + + G VL L L+ N +G +PA + + + IL LS N G IP Sbjct: 209 IRELIRFEGSFPVLRNLYLNNNYLTGGVPAQLANLTNLEILYLSHNKMSGTIPLALAHIP 268 Query: 301 YFMALDLSYNNLKGPIPGSLSAAKYIGHLDLSHNHLCGAIPVGNPFDHLEVSSFTNNDCL 360 L L +N G IP + ++ + + N + NP +V T+ + L Sbjct: 269 KLTYLYLDHNQFSGRIPDAFYKHPFLKEMYIEGNAFRPGV---NPIGIHKVLELTDTEFL 325 Query: 361 C 361 Sbjct: 326 V 326 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28518 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7568 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31574 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13625 (290 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13996 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 96 2e-22 >Cs89949 Length = 240 Score = 96.3 bits (238), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 70/201 (34%), Positives = 97/201 (48%), Gaps = 15/201 (7%) Query: 5 KPYRARVGAVSPVLFKSGEGCGACYKVKCL-DQSICSRRAVTIIVTDEC-PGGYCSNGRT 62 + Y A+S LF +G CGAC+++ C D C R ++ + T+ C PGG+C Sbjct: 53 QGYGTNTAALSTALFNNGLSCGACFQIMCANDPQWCLRGSIIVTATNFCPPGGWCDPPNH 112 Query: 63 HFDLSGAAFGRMAVAXXXXXXXXXXXXSVLYRRTPCKYPGKQIAFHVNEGSTNYWLSLLV 122 HFDLS F +A V+YRR CK G I F +N S Y+ +L+ Sbjct: 113 HFDLSQPVFQHIA-------QYRAGIVPVIYRRVRCKRNGG-IRFTINGHS--YFNLVLI 162 Query: 123 EFEDGDGDVGSMHIRPASSSEWIAMSHVWGANWCINGGPLNGPFSVKITTLSTAKTLSAR 182 G GDV ++ I+ S + W MS WG NW N LNG + T S ++ + Sbjct: 163 TNVGGAGDVHAVSIK-GSRTRWQPMSRNWGQNWQSN-SYLNGQSLSFVVTTSNGHSVVSY 220 Query: 183 DVIPSNWSPKATYTSRLNFRF 203 +V P NWS TYT R FR+ Sbjct: 221 NVAPPNWSFGQTYTGR-QFRY 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8326 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8270 (411 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5212 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27935 (256 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 271 4e-75 >Cs10194 Length = 251 Score = 271 bits (694), Expect = 4e-75, Method: Compositional matrix adjust. Identities = 135/256 (52%), Positives = 169/256 (66%), Gaps = 5/256 (1%) Query: 1 MPPRRYAFGRADEATHPDSIRATLAELVATFIFVFAGEGSALALGKIYKDSGTSASEXXX 60 MP R A G EATHPD++RA LAE ++T IFVFAGEGS +A K+ + + S Sbjct: 1 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA 60 Query: 61 XXXXXXXXXXXXXXXXXNVSGGHVNPAVTFGALLGGRLSVVRALYYWVAQLLGAIVASLL 120 N+SGGHVNPAVTFGA +GG +S++R + YW+AQLLG+ VA LL Sbjct: 61 ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL 120 Query: 121 LRLVTNGMRTVGFNVASGVAEVHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIG 180 L+ VTNG T F ++SGV + ++ EIV+TFGLVYTVYATA+DPK+GSLGTIAP+AIG Sbjct: 121 LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIG 180 Query: 181 FIVGANILVGGPFDGACMNPARAFGPALVGWRWRNHWIYWVXXXXXXXXXXXIYEYMVIP 240 FIVGANIL GG FDGA MNPA +FGPALV W W NHW+YWV +YE+ I Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI- 239 Query: 241 TETPHHAHQPLAPEDY 256 + +H+ L +Y Sbjct: 240 ----NQSHEQLPTTEY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3904 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10297 (326 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93799 75 1e-15 >Cs93799 Length = 160 Score = 75.1 bits (183), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 51/163 (31%), Positives = 86/163 (52%), Gaps = 6/163 (3%) Query: 167 LSKTEAEREALEFGKRNGLEVVTVCPSIILGPILQSTLNSSSSLIVKTIIGGLESLGCNY 226 +SKT AE+ A EF ++NG +VV + P+ LGP Q +N+S + +++ ++ G + +Y Sbjct: 1 MSKTLAEKAAWEFAEKNGTDVVAIHPATSLGPFPQPYVNASGA-VLQRLLQGSKDTQEHY 59 Query: 227 WT-FVDVRXXXXXXXXXYNKPEAAGERYLCNSHSIGIRDVVEKY--LRPTYPDYKYPKNL 283 W V V+ + A+G RYLC + + EK L P YP +++ K Sbjct: 60 WLGAVHVKDVAKAQVLLFETSAASG-RYLCTNGIYQFAEFAEKVSKLFPEYPIHRF-KGE 117 Query: 284 TYAEEEVQHFSSEKLQKLGWTFRPVEETLNDSIESYRKAGIVG 326 T ++++L LG F PVEET+ +++ES + G +G Sbjct: 118 TQPGLVACENAAKRLISLGLDFTPVEETIREAVESLKAQGHLG 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6386 (57 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91467 99 1e-23 >Cs91467 Length = 63 Score = 98.6 bits (244), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 45/57 (78%), Positives = 51/57 (89%) Query: 1 MASEGTLNCVDILIAILLPPLGVFLKFGCHAEFWICLLLTIFGYLPGIIYAIYVITK 57 MA EGT C+DI++AI+LPPLGVFLKFGC EFWICLLLTIFGY+PGIIYA+Y ITK Sbjct: 6 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 62 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31927 (350 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29842 (497 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92452 73 7e-15 >Cs92452 Length = 220 Score = 73.2 bits (178), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 32/82 (39%), Positives = 48/82 (58%) Query: 143 ADEDPIHRKIFVHGLGWDTNAETLTGVFREYGEIEDCKAVCDKVSGKSKGYGFILFKTRS 202 A+ D +RK+FV GL W+TN++TL F ++G+I + + K +G+SKGY F+ F+ Sbjct: 7 AEADSANRKLFVGGLAWETNSDTLRTYFEQFGDILEAVVITHKNTGRSKGYRFVTFRDPG 66 Query: 203 GARKALQQPQKRIGNRMTACQL 224 A +A P IG R C L Sbjct: 67 SALRACANPSPMIGGRKANCNL 88 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3077 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26743 (696 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs100314 343 5e-96 >Cs100314 Length = 451 Score = 343 bits (879), Expect = 5e-96, Method: Compositional matrix adjust. Identities = 204/451 (45%), Positives = 252/451 (55%), Gaps = 6/451 (1%) Query: 249 TMEKEQSDMDTGR-STLTNSSLNAENSSSPNETADKVSRQKKLMRYRXXXXXXXXXXXXQ 307 + EK+Q+D+ T R +T +N AE+ + + +K +QK +R + Q Sbjct: 2 SFEKDQTDLCTRRNTTASNCGPVAEHVVTSEKFPNKGYKQKNPLRGQRKLEENSEGKLLQ 61 Query: 308 DFYGTWPSSRTPCGHFENQLEGFMVESSPSTAPKQKRLLQGPDPSPYQHIPNQCAAQSMY 367 D YGTWP +R+P FENQL +V+SSPS+ Q+R L + YQ I N S Y Sbjct: 62 DLYGTWPLTRSPSVKFENQLAHPVVQSSPSSVHSQQRQLPKSETLQYQQISNSFVTPSAY 121 Query: 368 GNLTNP--STHVSSHIQPGKFKHQNLFSGCEVSSGNANAINKSVDTSAKPLTMSPQEKIE 425 GNLTNP + V SH+Q G+FKHQ+L S VS G A +NKS AK LTM+PQEKIE Sbjct: 122 GNLTNPYPAMPVLSHMQSGEFKHQSLSSCYNVSPGKAKHVNKSAAAPAKSLTMTPQEKIE 181 Query: 426 KLRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPQENQIQYFERADLEVEGLSTLPS 485 KLRRR QEN+IQ + ADLEV LS LPS Sbjct: 182 KLRRRQQMQAMLAIQKQQQQFSHQVSKEHSNPQNF--QENKIQLVDGADLEVGDLSALPS 239 Query: 486 LDPNSTVEQXXXXXXXXXXXXXXXEDTILYRLQYIISKLDIKIRLCIRDSLYRLAQSAMR 545 DPNS VEQ DTILYRLQ +I++LD++IRLCIRDSL+RLAQS M+ Sbjct: 240 FDPNSPVEQDDSNTSCLAVDNNPVADTILYRLQVVIAQLDLRIRLCIRDSLFRLAQSTMQ 299 Query: 546 RHYAXXXXXXXXXXKVEGEVFAE-EINNHNRFGKIPDLETETNPIDRTVAHLLFHRPLNS 604 RHYA + E EV E + +R+ ++PD ETETNPIDR VAHLLFHRPL+ Sbjct: 300 RHYASDTGSTNKRSRDEPEVVTEADSKPSSRYPRMPDAETETNPIDRAVAHLLFHRPLDL 359 Query: 605 SGKKSDASESPISTKLSCEHKTAGLVNLSNECFPDSLKNKQCFPRQGSESCRPFPEPSSV 664 GK + ESP+S K SCEH T L +L N C P S K Q + G PEP + Sbjct: 360 PGKYLETPESPVSAKFSCEHATMSLASLPNSCIPKSSKITQNISQLGPNDPCSVPEPQLL 419 Query: 665 DPFKTSPLVGNSENASSTGPDDGGTMEVEAS 695 D FKTSP + SENAS GP D G EVEAS Sbjct: 420 DQFKTSPCMDTSENASYYGPTDSGAAEVEAS 450 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5005 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31753 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12801 (238 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9361 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780713 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7583 (376 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27951 394 e-112 >Cs27951 Length = 235 Score = 394 bits (1013), Expect = e-112, Method: Compositional matrix adjust. Identities = 192/253 (75%), Positives = 212/253 (83%), Gaps = 18/253 (7%) Query: 124 FDRHLSLQNVRKVVSEADGYQPHLIAPEQGYRRLIEGSLSYFRGPAEASVDAVHFVLKEL 183 FDRHLS QNVRKVVSEADGYQPHLIAPEQGYRRLI+ +L+YFRGPAEASVDAVHFVLKEL Sbjct: 1 FDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKEL 60 Query: 184 VRKSLAETQELKRFPTLQAEIAAACNEALERFRNESKKTTLRLVDMESSYLTVDFFRRLP 243 VR+S+ ETQELKRFPTLQ+EIAAA N+ALERFR++SKKTT+RLV+MESSYLTVDFFR+LP Sbjct: 61 VRRSIGETQELKRFPTLQSEIAAAANKALERFRDDSKKTTMRLVEMESSYLTVDFFRKLP 120 Query: 244 QEMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDRYSEGHFRRIGSNVSSYVGMVSETLR 303 Q+ME DRY+EGHFRRIGSNVSSYVGMVSETL+ Sbjct: 121 QDMERGGNPTAPSAA------------------DRYTEGHFRRIGSNVSSYVGMVSETLK 162 Query: 304 NTIPKAVVHCQVKEANTSLLNHFYIQIGKREAKHLSQLLDEDPALMERRHQCAKRLELYK 363 NTIPKAVVHCQVKEA SLL+HFY Q+GK+E K L+QLLDEDP LMERR QCAKRLELYK Sbjct: 163 NTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERRQQCAKRLELYK 222 Query: 364 SARDEIDSVAWVR 376 SARDEIDSV+W R Sbjct: 223 SARDEIDSVSWTR 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939927 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26683 168 2e-44 >Cs26683 Length = 118 Score = 168 bits (425), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 86/106 (81%), Positives = 87/106 (82%), Gaps = 1/106 (0%) Query: 1 MATLDSDVPMIXXXXXXXXXXXXXX-XXXXRFEIKKWNAVALWAWDIVVDNCAICRNHIM 59 MATLDSDVPMI RFEIKKW+AVALWAWDIVVDNCAICRNHIM Sbjct: 1 MATLDSDVPMIPVGEASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60 Query: 60 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL 105 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL Sbjct: 61 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754210 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36641 108 3e-26 >Cs36641 Length = 261 Score = 108 bits (269), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 57/105 (54%), Positives = 72/105 (68%), Gaps = 5/105 (4%) Query: 27 MANPSTIAPLAEFIKTQFGKLDILVNNAGVGGSILDGDAFKAAVASGWKETIDWNKVMTE 86 +A+P+ I +A+FI++ FGKLDILVNNAG+ G D D SG+ E MT+ Sbjct: 72 VADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTL-----SGFIEEGVARGKMTQ 126 Query: 87 NYELAKECVQINYYGAKRTTEALIPLLQLSESPIIVNVSSSMGML 131 YE A++C+Q NY GAKR EALIPLLQLS+S IVNVSSS+G L Sbjct: 127 TYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKL 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5772 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5057 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5908 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8381 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69533 137 2e-34 >Cs69533 Length = 182 Score = 137 bits (344), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 2/162 (1%) Query: 162 VVSQVAGPFQSSSDLLEHGYVYQPDSSFVLGTPVNSATLSSWSCNSMPPVNMSQTKDEGR 221 ++SQV+G FQSSS LE G+ +PDSS +L P+ SA +SW+ N++ V++S Sbjct: 1 MLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAA-TSWT-NNVQTVSLSPASKGPE 58 Query: 222 LSGQTVTHNSCYSSSNESNPINWKMREKVDGVDPGQPQRVLPDFAQVYKFIGSVFDPSTS 281 ++ + S + + E D + P RVLPDFAQVY FIGSVFDP+ S Sbjct: 59 VANNRSNSTDSTPKAQVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNAS 118 Query: 282 NHMERLRQLDPINLETALLLMRNLSINLTRPEFEDHRKLIES 323 +H+++L+++DPI++ET LLLMRNLSINLT P+FEDHR+L+ S Sbjct: 119 DHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSS 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12578 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32458 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226778833 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10855 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49631623 (62 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146193 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22824 (399 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42230 270 2e-74 >Cs42230 Length = 227 Score = 270 bits (690), Expect = 2e-74, Method: Compositional matrix adjust. Identities = 131/213 (61%), Positives = 159/213 (74%), Gaps = 18/213 (8%) Query: 188 MILCRVIMGNMELLHPGSKQFHPSSKDFDSGVDGLQDPKHYIVWNMNMNTHIYPEFVVSF 247 M+LCRVIMGNME L PG+KQFHPSS+DFDSGVD LQ+P+HYIVWNMNMNTHI+PEFVVSF Sbjct: 1 MVLCRVIMGNMEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSF 60 Query: 248 KITSNTEGHLIGTENKLGASGVGTSCQGPQG----SSAVDTGSETQPLSDSGKSHGNNSQ 303 K +SN EGHLI +E++ S + TS QG QG S+ D G + P+SDSG S Sbjct: 61 KFSSNVEGHLIRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGS------ 114 Query: 304 MISKPGRFQGETTNTGSAPQRTPKSPWMPFPMLFSAIENKVPPEDMKQVNVHYDLFRERK 363 QG+ +T S+ R PKSPWMPFPMLF++I NKV P+ M+Q++ Y+LFR +K Sbjct: 115 --------QGKAPSTSSSTPRAPKSPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKK 166 Query: 364 ITRDEFVKKLRLVVGDTLLRSTITELQCKIPHK 396 + RD+FVKKLRL+VGD LLRSTIT LQCKIP K Sbjct: 167 VNRDDFVKKLRLIVGDDLLRSTITALQCKIPSK 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25452 (419 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27972 (434 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 158 1e-40 >Cs30681 Length = 257 Score = 158 bits (399), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 87/199 (43%), Positives = 119/199 (59%), Gaps = 4/199 (2%) Query: 211 VPNGTLRQHLECLYGQILDLAARLDVAIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTEN 270 +PN +++ HL + L RL +A D A + YLH D II RD KSSNILL E Sbjct: 1 MPNRSVQDHLTSRFQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLDEQ 60 Query: 271 FRAKVADFGFARLAADSDSGETHVSTQVKGTAGYLDPEYLRTYQLTEKSDVFSFGVLLVE 330 + AK++DFG ARL G +HVST V GT GY PEY++T +LT KSD++SFGV L E Sbjct: 61 WNAKLSDFGLARLGPSD--GLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYE 118 Query: 331 LVTGRRPIEPKREIKERITAKWAMKKFTDGDALS-ILDPRLEQTAANNVAIEKILELALQ 389 L+TGRRP++ R E+ +W TD + ILDP+LE + +A +K+ +A + Sbjct: 119 LITGRRPLDRNRPKSEQKLLEWVRPHLTDAKKFTMILDPKLEGKYSIKLA-QKLAAVANK 177 Query: 390 CLAPRRQNRPSMRRCAEIL 408 CLA + + RP M E+L Sbjct: 178 CLARQAKGRPKMSEVVEVL 196 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19075 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13126 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48857 214 6e-58 >Cs48857 Length = 229 Score = 214 bits (546), Expect = 6e-58, Method: Compositional matrix adjust. Identities = 106/147 (72%), Positives = 131/147 (89%) Query: 4 LSRTVLAPLVPVIGQRAVLGLSGYVINNIGFVFGAVYLYRLSVVILKDQEAAVRASLLFC 63 LSR+VLAPL+ VIG RAVLGL+GY+++N+ F+F AVY YRLSV+ILKD +AA+ ASLLFC Sbjct: 56 LSRSVLAPLIGVIGYRAVLGLAGYIVSNVAFLFAAVYFYRLSVMILKDPDAALCASLLFC 115 Query: 64 FNPASIFYSSIYSETLFALFSVGGLYHLISGKDVIAVLWFALSGFSRSNGVLNAGYFCFQ 123 FNPASIFY+SIYSE+L+ALFSVGGLY+L+SG I+VLW A+SG +RSNGVLNAGYFCFQ Sbjct: 116 FNPASIFYTSIYSESLYALFSVGGLYYLMSGALNISVLWLAISGCARSNGVLNAGYFCFQ 175 Query: 124 TMHQAYDAVFLRKRPFLALQAVVGGAL 150 TMHQAYDA+FL+KR FLA+ +V G++ Sbjct: 176 TMHQAYDALFLKKRHFLAMWILVCGSV 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26571 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12515 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs106138 107 7e-26 >Cs106138 Length = 131 Score = 107 bits (267), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 49/110 (44%), Positives = 73/110 (66%) Query: 52 EIGVIPQVASATATFVMTFSASLSVVEFYLLKRFPIPYAIYLTSVSILAGFWGQFLVRRV 111 E+G+ PQVASAT+TF MTFS+S+SVV++YLL RFP+PYA + T V+ A F GQ +VR++ Sbjct: 20 ELGIPPQVASATSTFAMTFSSSMSVVQYYLLDRFPVPYAAFFTLVATFAAFAGQHVVRKI 79 Query: 112 VSILKRXXXXXXXXXXXXXXXAITMGVIGIKMSLQMISNHEFMGFLDFCN 161 +++L R AI++G GI+ ++ + N E+MGF + C Sbjct: 80 IAVLGRASIIVFILALTIFVSAISLGGFGIENMVKKLKNQEYMGFENLCQ 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32253 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59303 60 2e-11 >Cs59303 Length = 175 Score = 59.7 bits (143), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 4/150 (2%) Query: 10 VSSTQFTRLAKLLDED-KVSNKIVLGGQ-MDEKQLKIAPTILLDVPEDAQIMQEEIFGPL 67 + S QF ++ K + K+ GG+ + K I PT+ V +D I ++EIFGP+ Sbjct: 19 IDSEQFEKILKYIRSGVDGGAKLETGGERLGAKGYYIKPTVFTGVKDDMLIAKDEIFGPV 78 Query: 68 MPIVTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSIGG 127 I+ + +++ N+ LA FT+N + + G + IN V Sbjct: 79 QSILKYKDLDEVIQRSNASQYGLAAGVFTHNLDTANTLMRALRVGSVWIN--CFDVFDAA 136 Query: 128 LPFGGVGESGMGSYHGKFSFDGFSHKKAVL 157 +PFGG +SG G G +S + KAV+ Sbjct: 137 IPFGGYKQSGQGREKGSYSLSNYLQVKAVV 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32576 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30618 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046348 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs91001 98 9e-23 >Cs91001 Length = 164 Score = 97.8 bits (242), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 10/104 (9%) Query: 124 IAYPSSMNAIASTYSPWDETSILTNPASDQILLSHEEFTNLHGTEAD-IGSKGLSRINTC 182 +AYPS +NA+A ++ WD+ S+L N +++++ S +++TNLH EAD IGSKG+S I Sbjct: 1 MAYPS-VNALAHGFAAWDDASMLVN--AEKMMPSQDKYTNLHAIEADDIGSKGISGIGNS 57 Query: 183 SLSG------PLPSSEIPNQGKQAPGHHGLPDFAEVYSFIGSVF 220 ++ G PS+++P QG Q P HG+PDFAEVYSFIGSVF Sbjct: 58 TVGGIGSSTRTQPSTDMPKQGNQVPVLHGIPDFAEVYSFIGSVF 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10590 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823815 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 152 3e-39 >Cs47542 Length = 355 Score = 152 bits (383), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 81/212 (38%), Positives = 126/212 (59%), Gaps = 7/212 (3%) Query: 3 FAPNVQEMVISNPLQVPETFLVSKKEENEPKSTADVLDLSSKIPILDL-SMLSREHKE-E 60 P VQE+V + L VP ++ +E+ P ++ D L S+IP++D+ S+LS E + E Sbjct: 9 LVPCVQELVKNPMLVVPPRYICP--DEDSPLNSDDTL--ISQIPVIDMQSLLSEESMDSE 64 Query: 61 LNKLDQACKEWGFFHVVNHGVATELLHEMKDATAKFFELPLEEKNKR-RMSGGREGYGQA 119 L KLD ACKEWGFF +VNHGV++ L ++K FF L +EEK K + G EG+GQA Sbjct: 65 LAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQA 124 Query: 120 YAISEGQTMDWSDTLILSLYPAQSRDLHVWPTAPNGFKETIEAYSSEVKRIGEELITSLS 179 + +SE Q +DW+D + P R H++P P ++T+E YS E+K + LI+ + Sbjct: 125 FVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKMG 184 Query: 180 TIMELEKDALLGLHKEVLQALRVNYTPPCSMP 211 ++ ++ + L + Q++R+NY PPC P Sbjct: 185 KVLNIKDEELREFFENGFQSMRMNYYPPCPQP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18443 (118 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25354 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60808 385 e-109 >Cs60808 Length = 244 Score = 385 bits (990), Expect = e-109, Method: Compositional matrix adjust. Identities = 181/241 (75%), Positives = 205/241 (85%) Query: 2 AASAVENAGVSALRSVMLRVRQAAERSGRDPALVRVVAVSKTKPVSLIRQVYNFGHRCFG 61 A++A + +ALRSV+ RV QAAERS R P +R+VAVSKTKPVS+IRQVY GHRCFG Sbjct: 3 ASAATDGVAATALRSVIQRVHQAAERSSRPPDRIRIVAVSKTKPVSVIRQVYEAGHRCFG 62 Query: 62 ENYVQEILEKAPQLPDDIEWRFVGHLQTNKAKLLLAGVPNLALVEGVDNEKIANHLDRAV 121 ENYVQEI+EKA QLPDD+EW F+G+LQ+NK K LLAGVPNLA+VE VDNEKIA L+R V Sbjct: 63 ENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMV 122 Query: 122 SNLGRNPLKVLVQVNTSGEESKSGIHPSGCVELAKHVKFQCPNLQFSGLMTIGMPDYTST 181 +GR PLKVLVQVNTSGEESKSG+ PSGC+EL KHV CPNL+F GLMTIGMPDYTST Sbjct: 123 ETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTST 182 Query: 182 PENFRMLSKCRTEVCKALAMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPK 241 PENF+ L+KCR+EVCKAL + EE C+LSMGMSGDFE AIEMGSTNVRIGSTIFG REYPK Sbjct: 183 PENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPK 242 Query: 242 K 242 K Sbjct: 243 K 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813426 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27448 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9628 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27265 (486 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1830 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41729 86 1e-19 >Cs41729 Length = 181 Score = 86.3 bits (212), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 39/87 (44%), Positives = 53/87 (60%), Gaps = 1/87 (1%) Query: 38 STWCVANAKAGEEKLQAALDYACGEGGADCRPIQEGSTCFTPNTLEAHASYAFNSFYQKR 97 + WCV G+ LQ ALDYACG GADC PI C+ PNT++AH SYA NS++Q++ Sbjct: 19 ANWCVCKDGVGDPVLQKALDYACG-AGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRK 77 Query: 98 ARGTGTCNFGGAAYVVAQPPKYGTCEF 124 + G+C+F G+A V P C + Sbjct: 78 GQAQGSCDFSGSATVATTDPSTAGCSY 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17017 (103 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27182 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6439 (450 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19588 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9420 (377 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88949 132 9e-33 >Cs88949 Length = 156 Score = 132 bits (331), Expect = 9e-33, Method: Compositional matrix adjust. Identities = 63/134 (47%), Positives = 91/134 (67%) Query: 156 LGATYSAILFLGXXXXXXXXXXXXXERTVFYRERAAGMYSELPYAFAQVAIETIYVAIQT 215 +G+ ++A+LFLG ERTVFYRE+AAGMY+ +P+A AQV IE Y+ +Q+ Sbjct: 1 MGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQS 60 Query: 216 FVYSCLLFFMIGYNFKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPGHQIAAIVMSFFLS 275 VY +++ MIG+ + KF ++ +F++ +F+ YGMM VALTP H IAAIV + F Sbjct: 61 VVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYG 120 Query: 276 FWNLFSGFLIPRPL 289 WN+FSGF+IPRP+ Sbjct: 121 LWNVFSGFIIPRPV 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11611 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24960 (93 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23203 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52432 79 4e-17 >Cs52432 Length = 359 Score = 79.3 bits (194), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 69/262 (26%), Positives = 110/262 (41%), Gaps = 52/262 (19%) Query: 1 GHVWHVGVKKVDNKFWFHSGWQDFIEHYSIRVGYFLTFRHEGRSSFTVHIFNLKTAEINY 60 G+V +G+ K + K WF GW +F++++SI VGYF+ F++ S F V +FN T EI Y Sbjct: 61 GYVVRIGITKKEGKIWFDDGWNEFVQYHSIGVGYFVVFQYRKNSKFQVFVFNTTTFEIQY 120 Query: 61 --------------QPNALSSTGGSVYRYQVF--EEMEDDDSVEILGSSPTSIVTDSLKD 104 N+ S G + + + EE+E +D ++ V DS++D Sbjct: 121 PSRNMFPPSRQNQATVNSSKSKNGCKMQSKTYRMEELEVNDELD--------NVNDSIQD 172 Query: 105 KCFGDSANQLTPGKNCTPPSLHNLFNGSKPKNCVNWSDAGNLHLSKGDDLQAGEDIRSIK 164 G + + S+H +HLS+ L E I Sbjct: 173 ----------IIGTSNSEGSVH-----------------AKVHLSETQCLSVQETDLKID 205 Query: 165 KTVRKKRKVNPNVEESSSQHEKEVEIRFRFYESASARKRTVTAEERERAINAAKTFEPVN 224 T KK K N E + ++ I + +T EE++ AIN A+ +P Sbjct: 206 STKFKKAKHNLKYELRADSVDQIKSIALLEDMDTYDCESRMTLEEKQEAINVARFLKPEK 265 Query: 225 PFCRVVLRPSYLYRGCIMYLPS 246 P V LR S + C+ Y+P+ Sbjct: 266 PSFLVFLRASNMQLNCV-YVPN 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24121 (439 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30197 310 3e-86 >Cs30197 Length = 247 Score = 310 bits (793), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 152/233 (65%), Positives = 190/233 (81%), Gaps = 7/233 (3%) Query: 208 LAGYLPFDDSNLMNLYKKISAAEFTCPPWLSFGAMKLIARILDPNPMTRVTIAEILEDEW 267 +AGYLPF++SNLM LYKKI A+F PPW S A KLI+RILDPNP+TR+T+AE++E+EW Sbjct: 1 MAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEW 60 Query: 268 FKKDYKAPVFEEKENTNLDDVEAVFKDSEEHH--VTEKKEEQPVA---MNAFELISMSKG 322 FKK YK P FE+ N +LDDV+++F +S + V E++EE PVA MNAFELIS S+G Sbjct: 61 FKKGYKPPSFEQP-NIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQG 119 Query: 323 LNLGNLFDVEQGF-KRETRFTSKCPANEIIHKIEEAAKPLGFDVHKKNYKLRLENMKAGR 381 LNL +LF+ + G KRETRFTSK P NEII KIEEAA PLGFDV K N+KL+L+ K GR Sbjct: 120 LNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGR 179 Query: 382 KGNLNVATEIFQVAPSLHMVEVRKAKGDTLEFHKFYKNLATGLEDVVWKTEED 434 KG+L+VATEIF+VAPSL+MVE+RK+ GDTLEFHKFYKNL+TGL+DVVWK+ ++ Sbjct: 180 KGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGDE 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13065 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs117106181 143 2e-36 >Cs117106181 Length = 221 Score = 143 bits (360), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 69/188 (36%), Positives = 121/188 (64%), Gaps = 3/188 (1%) Query: 2 AILYAVVARGTVVLAEFSAVTGNTGAVARRICEKLPSEADARVCFSQDRYIFHILRADGL 61 +++YA VARG VVLAE++ +GN ++A + +KLP+ ++ + ++ D + F+ L +G Sbjct: 5 SLIYAFVARGNVVLAEYTEFSGNFNSIAYQCLQKLPA-SNNKFTYNCDAHTFNYLVDNGY 63 Query: 62 TFLCMANDTFGRRIPFSYLEDIHMRFMKNYGR-VAPYAPAYAMNDEFSRVLHQQMEFFSS 120 T+ +A+++ GR+IP ++LE + F+ YG A APA +N EF L + M++ Sbjct: 64 TYCVVADESSGRQIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVD 123 Query: 121 NPSA-DTLNRVRGEVGEIRTVMVDNIEKILDRGDRIDLLVDKTATMQDGAFHFKKQSKRL 179 +P L +V+ +V E++ VM++NIEK+LDRG++I+LLVDKT + A F+ ++ Sbjct: 124 HPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKM 183 Query: 180 RRALWMKN 187 RR +W++N Sbjct: 184 RRKMWLQN 191 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18545 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41944 127 2e-32 >Cs41944 Length = 375 Score = 127 bits (320), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 58/75 (77%), Positives = 69/75 (92%) Query: 1 MAINLIDRMLTFDPTKRITVEQALAHPYLERLHDIADEPICTKPFSFDFEQQPLGEEQMK 60 +AI+L+DRMLTFDP KRITV++ALAHPYL RLHD ADEP+C +PFSFDFEQQ LGEEQ+K Sbjct: 301 LAIDLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIK 360 Query: 61 DMIYREAIALNPEYA 75 DMIY+EA+ALNP +A Sbjct: 361 DMIYQEALALNPGFA 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30481 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990148 (123 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30021 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27653 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780478 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279658 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12837 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4505 (254 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15768 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6543 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18023 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22878 (358 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6942 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48398376 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs183106187 103 1e-24 >Cs183106187 Length = 300 Score = 103 bits (258), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 70/192 (36%), Positives = 97/192 (50%), Gaps = 34/192 (17%) Query: 30 IGKLRHPNVVTLKAYY---WSVDEKLLIYDYIPNGSLATALHGKPGLVSFTPLSWSVRLN 86 + KL+HP++VTL WS L+Y+Y+PNGSL L K + +PL W R Sbjct: 3 LSKLQHPHLVTLLGACPEAWS-----LVYEYLPNGSLQDRLFRKSNV---SPLLWKDRAR 54 Query: 87 IMKGIAKGLVYLHEFSPKKYVHGDLKPNNILLGQNMEPRISDFGLGRLANIAGGSPTLQS 146 I IA GL +LH P+K VHGDLKP NILL + +I DFG+ RL T + Sbjct: 55 IAAEIASGLCFLHSSKPEKIVHGDLKPQNILLDSELSSKICDFGICRLV-------TEDT 107 Query: 147 NRIPTEKSQERQQKSAAPXXXXXXXXXXNLGSCYQAPESLKVVKPSQKWDVYSYGVILLE 206 +P+ +S AP Y PE + + K D YS+G+I+L+ Sbjct: 108 LYLPS------FHRSTAPKGSFP----------YADPEYHRTGVLTPKSDSYSFGLIILQ 151 Query: 207 MITGRLPIVQVG 218 ++TGRLP+ G Sbjct: 152 LLTGRLPVGLAG 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5915 (298 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36939 60 2e-11 >Cs36939 Length = 275 Score = 60.5 bits (145), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 24/45 (53%), Positives = 34/45 (75%) Query: 78 MILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNI 122 MI+ L + GNRW+ IA +LP RTDN+IKNYW T ++K+ R+L + Sbjct: 1 MIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKVRKLQL 45 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226744329 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11086 169 1e-44 >Cs11086 Length = 145 Score = 169 bits (428), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 81/114 (71%), Positives = 93/114 (81%), Gaps = 1/114 (0%) Query: 7 QIVIAXXXXXXXPVIHGWGNDGHVTICRIAQSRLSKAAADAVKQLLPDYAENDWSSLCIW 66 QI+ PVIH WGNDGHV +CRIAQSRLS+AAADAVKQLLP+ A+ND S+C W Sbjct: 5 QILTCVSFFVLFPVIHCWGNDGHVAVCRIAQSRLSEAAADAVKQLLPESADNDLGSVCTW 64 Query: 67 ADRVKFIFPWSSALHYINTPE-VCNYQYSRDCKDEDGEKGRCVAGAINNYTTQL 119 AD VKF + WSSALH+I+TP+ +C YQY+RDCKDEDG KGRCVAGAINNYTTQL Sbjct: 65 ADHVKFHYHWSSALHFIDTPDNLCTYQYNRDCKDEDGVKGRCVAGAINNYTTQL 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9270 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26633 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812699 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10801 (276 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5650 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24526 (193 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1988 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7897 201 1e-54 >Cs7897 Length = 156 Score = 201 bits (512), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 93/100 (93%), Positives = 97/100 (97%) Query: 11 MGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF 70 +G +SQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF Sbjct: 57 LGIGDSQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILKLQEKF 116 Query: 71 RLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR 110 RLDLDDEA +HFFQDLINESVSALFPQMVETIHRWAQYWR Sbjct: 117 RLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2558 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70317 121 1e-30 >Cs70317 Length = 100 Score = 121 bits (304), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 58/76 (76%), Positives = 65/76 (85%) Query: 2 FRCCPLDWPEGATSRESIKAVLKLHRLQNIVMQHVDHSAGDLIDLLQGLLKFDPSSRLTA 61 R LDWPEGA SRESIK+V+KL RLQN++MQHVDHSAGDL LLQGLL++DP+ RLTA Sbjct: 25 VRRGRLDWPEGAASRESIKSVMKLPRLQNLIMQHVDHSAGDLTHLLQGLLRYDPTDRLTA 84 Query: 62 PEALRHPFFTRDHYRR 77 EALRHPFFTRDH RR Sbjct: 85 REALRHPFFTRDHLRR 100 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4842 (401 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5097 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746547 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16576 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24820 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26371 (388 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2343 (585 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21714 209 6e-56 >Cs21714 Length = 286 Score = 209 bits (532), Expect = 6e-56, Method: Compositional matrix adjust. Identities = 114/275 (41%), Positives = 156/275 (56%), Gaps = 6/275 (2%) Query: 141 AECVGSVCPAATSAQYAVLIAGLYLIALGTGGIKPCIWPFGADQFDDTDPKERVKKGSYF 200 ++ +GS C A S Q L LY+ G GI+PC+ FGADQFD+ + +F Sbjct: 15 SQLLGS-CEPAKSWQMLYLYTVLYITGFGAAGIRPCVSSFGADQFDERSKDYKTHLDRFF 73 Query: 201 NWFYFSQNIGAIIASSLLVWIQENVGWGIGFGIPTALMGVCIASLLIGTPLYRFQKPGGS 260 N+FY S +GAI+A +L+V+IQ GWG FG MG+ IGTPLYR + PGGS Sbjct: 74 NFFYLSVTVGAIVAFTLVVYIQMEHGWGSAFGALAIAMGISNMLFFIGTPLYRHRLPGGS 133 Query: 261 PLTRIFQVLVAAFRKRNVKVLGDSV--LYETQDKSSAIEGSRKLDHSNELRCLDKAALIT 318 PLTR+ QVLVAAFRKR+ + LYE K SAI+GS K+DH+++ RCLDKAAL Sbjct: 134 PLTRVAQVLVAAFRKRHAAFSSSELIGLYEVPGKHSAIKGSGKIDHTDDFRCLDKAALEL 193 Query: 319 NTEIAYGNFSDPWRLCTVTQVEELKILVRMFPIWATGIVFSAVFAQMSTLFVVQGKLMDR 378 ++ PW+LCTVTQVEE K LVR+ PI A I+ + + TL V Q M+ Sbjct: 194 KEDVIN---PSPWKLCTVTQVEESKTLVRLVPIPACTIMLNVNLTEFLTLSVQQAYTMNT 250 Query: 379 TVGSVTIPAASLSFFDFVSVIIWVPIYDRVITPIA 413 +G + + F ++ +Y ++ +A Sbjct: 251 HMGKLKTSVTCMPVFPGLAXFYTGSLYSNIVPHVA 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig926 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146429 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 107 6e-26 >Cs25776 Length = 104 Score = 107 bits (266), Expect = 6e-26, Method: Compositional matrix adjust. Identities = 46/88 (52%), Positives = 63/88 (71%) Query: 7 LRNEPSDEKSDIYSYGVILWELATEKIPWDNLNSMQVIGAVGFMDQRLEIPKDVDPQWTC 66 LR EPS+EKSD+YS+GVILWEL T + PW+ L+ QV+GAV F ++RL IP++ P Sbjct: 6 LRGEPSNEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQNTSPVLAS 65 Query: 67 LIESCWQSDAASRPTFQELLEKLRDLQR 94 L+ESCW D A RP+F ++E L+ L + Sbjct: 66 LMESCWADDPAQRPSFANIVESLKKLLK 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9502 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs78778 240 1e-65 >Cs78778 Length = 170 Score = 240 bits (612), Expect = 1e-65, Method: Compositional matrix adjust. Identities = 113/144 (78%), Positives = 128/144 (88%), Gaps = 1/144 (0%) Query: 30 TKASFFGGRKLRVRSFTAPTGSSSSFTVRAAAADPDRPLWFPGSTPPPWLDGSLPGDFGF 89 TKASF GG+KL++R A T + S +V AAAADP+RPLWFPGSTPP WLDGSLPGDFGF Sbjct: 28 TKASFLGGKKLKLRKNGA-TAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGF 86 Query: 90 DPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFT 149 DPLGL SDP++L+WN Q+E+VHCRWAMLGAAGIFIPE LTK+GILNTPSWYTAGE EYFT Sbjct: 87 DPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFT 146 Query: 150 DTTTLFVVELVLIGWAEGRRWADI 173 DTTTLF+VE++ IGWAEGRRWADI Sbjct: 147 DTTTLFIVEMIFIGWAEGRRWADI 170 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53858449 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23341 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13739 (485 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10093 (272 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26388 (74 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14657 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs75309 172 2e-45 >Cs75309 Length = 133 Score = 172 bits (436), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 83/131 (63%), Positives = 96/131 (73%), Gaps = 13/131 (9%) Query: 52 VNLRVAAGALKKYGAEVICADSGKKAISLLTPPHHFDACFMDIQMPEMDGFEATRRIRDL 111 VN RVA GALKK+GA V C D G+ A+ LTPPH+FDACFMD+QMPEMDGF+AT +IR L Sbjct: 2 VNRRVAEGALKKHGAIVTCVDCGRAAVDKLTPPHNFDACFMDLQMPEMDGFQATWQIRHL 61 Query: 112 ERNISNSIQA-------------WHVPILAMTADVIQATHEECTKCGMDGYVSKPFEAEQ 158 E I+ I + WHVPILAMTADVIQA++E+C KCGMD YVSKPFE EQ Sbjct: 62 ENEINEQIASGESSAEMFGNVGLWHVPILAMTADVIQASNEQCMKCGMDDYVSKPFEDEQ 121 Query: 159 LYREVSRFFQS 169 LY V+RFF S Sbjct: 122 LYTAVARFFMS 132 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4228 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27691 (210 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6436 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22760 (313 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10532 (387 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32220 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790710 (50 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18465 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17475 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31690 (159 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42555 302 1e-84 >Cs42555 Length = 159 Score = 302 bits (774), Expect = 1e-84, Method: Compositional matrix adjust. Identities = 146/159 (91%), Positives = 150/159 (94%) Query: 1 MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKARPCKVVEVSTSKTGKHGHAKCHF 60 MSDEEHHFESKADAGASKT+PQQAGTIRKNGYIVIK RPCKVVEVSTSKTGKHGHAKCHF Sbjct: 1 MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHF 60 Query: 61 VGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 VGIDIF KKLEDIVPSSHNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD Sbjct: 61 VGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD 120 Query: 121 DSLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159 ++LL+QIKDGF GKDLVVSV AMGEEQI ALKDIGPK Sbjct: 121 ENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6829 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56038 143 9e-37 >Cs56038 Length = 183 Score = 143 bits (361), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 67/110 (60%), Positives = 82/110 (74%) Query: 64 PAEAGFLSGSTGKKSVPGPELPQIDFLKRFNEENQKKYAENDARFRSTQXXXXXXXXXXX 123 PA+AGFLSG +G +SVPGPELPQI+FL RFNEENQKKYAE DARF+ + Sbjct: 74 PAKAGFLSGFSGIESVPGPELPQIEFLNRFNEENQKKYAEFDARFKESPLLKKLLEKSKE 133 Query: 124 XXXXXXXXIQDKYCIRGAEWGVGDCSAEGMTPNEKDKFIAMLKEKAGVKD 173 I++KYC+RGAEWGVGDCSAEGM+P E++ FI+MLK+KAGV + Sbjct: 134 NKEKNRQEIENKYCLRGAEWGVGDCSAEGMSPEERENFISMLKQKAGVNE 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5373 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5471 (348 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489103 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754887 (71 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814953 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226811488 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17294 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6531 (406 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19136 (108 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs87016 63 7e-13 >Cs87016 Length = 154 Score = 63.2 bits (152), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 27/40 (67%), Positives = 34/40 (85%) Query: 22 EKRVMVAIDESDCSHYALMWVLDNLKDSITNSPLIIFTAQ 61 +K+VMVAIDES+C HYAL W L+NL D+I+ S LIIFTA+ Sbjct: 3 KKKVMVAIDESECRHYALQWALENLGDAISKSDLIIFTAR 42 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6902 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14679 (327 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30197 130 2e-32 >Cs30197 Length = 247 Score = 130 bits (328), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 72/167 (43%), Positives = 103/167 (61%), Gaps = 2/167 (1%) Query: 158 LAGCLPFQDSNLMEMYRKIGKAEFKCPNFFSPEARRLLYRMLDPNPNSRISIAKVGESSW 217 +AG LPF++SNLM +Y+KI KA+FK P +FS A++L+ R+LDPNP +RI++A+V E+ W Sbjct: 1 MAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEW 60 Query: 218 YRKGPYSKNMKSEIGNKDAARMSAEASGSSENSMASEEKQEPGRPPNMNAFDIISLSAGF 277 ++KG + + + D S S N + ++ P P MNAF++IS S G Sbjct: 61 FKKGYKPPSFEQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGL 120 Query: 278 DLSGLFEKDP--FHRVVRFTSRQPATVIISKLEEMAKQLELKVKKKD 322 +LS LFEK R RFTS++P IISK+EE A L VKK + Sbjct: 121 NLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNN 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18502 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27642 (351 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59902 503 e-145 >Cs59902 Length = 247 Score = 503 bits (1296), Expect = e-145, Method: Compositional matrix adjust. Identities = 241/247 (97%), Positives = 245/247 (99%) Query: 105 MIDNVVLIVTGTLHERDVQELLEKCHPLGMFDSIATLAVAQNMRELYRLVLVDTPLAPYF 164 MIDNVVLIVTGTLHERDVQELLEKCHP GMFDSIATLAVAQNMRELYRLVLVDTPLAPYF Sbjct: 1 MIDNVVLIVTGTLHERDVQELLEKCHPWGMFDSIATLAVAQNMRELYRLVLVDTPLAPYF 60 Query: 165 SECITSDDLDDMNIEIMRNTLYKAYLEDFYRFCQKLGGATAEIMSDLLAFEADRRAVNIT 224 SECITS+DLDDMNIEIMRNTLYKAYLEDFY+FCQKLGGATAEIMSDLLAFEADRRAVNIT Sbjct: 61 SECITSEDLDDMNIEIMRNTLYKAYLEDFYKFCQKLGGATAEIMSDLLAFEADRRAVNIT 120 Query: 225 INSIGTELTRDDRRKLYSSFGLLYPYGHEELAVCEDIDQVRGCMEKYPPYQSIFSKLSYG 284 INSIGTELTRDDRRKLYS+FGLLYPYGHEELAVCEDIDQVRG MEKYPPYQSIFSKLSYG Sbjct: 121 INSIGTELTRDDRRKLYSNFGLLYPYGHEELAVCEDIDQVRGVMEKYPPYQSIFSKLSYG 180 Query: 285 ESQLLDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH 344 ESQ+LDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH Sbjct: 181 ESQMLDKAFYEEEVKRLCLAFEQQFHYGVFFAYMRLREQEIRNLMWISECVAQNQKSRVH 240 Query: 345 DSVVFIF 351 DSVVFIF Sbjct: 241 DSVVFIF 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17962 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20731 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32826 (455 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41998 387 e-109 >Cs41998 Length = 349 Score = 387 bits (994), Expect = e-109, Method: Compositional matrix adjust. Identities = 179/345 (51%), Positives = 240/345 (69%), Gaps = 1/345 (0%) Query: 1 MSNLHIIAVPFPAQGHVLPLMELSQCLVNHGFKVTFVNTEFNHKRIVNALAGETHVGDRI 60 M+ H++ +P PAQGHV+PL+E SQCL GF+VTFVNT+++HKRI+ +L G+ +G++I Sbjct: 1 MNRPHVLVLPIPAQGHVIPLLEFSQCLAKQGFRVTFVNTDYDHKRIMESLEGKNDLGEQI 60 Query: 61 HLVSLPDGLEPKEDRNDLGLLCEGIQRVMPGXXXXXXXXXXXXXXXXVACVLADENSGWA 120 LVS+PDG+EP EDRND G L E + +VMPG + C +AD W+ Sbjct: 61 RLVSIPDGMEPWEDRNDFGKLFEKVLQVMPGKLEELIEDINSREDEKLDCFIADGYMAWS 120 Query: 121 LDVAAKMKIRRVAFWPXXXXXXXXXXNIPKLIHEGIIDNDDGTPLKSQEIELAKNQPKMK 180 ++VA KM +R FWP +IPKLI +GIID++ GTP+ Q +A N P+M Sbjct: 121 MEVAKKMNVRGALFWPSSAASVALLFHIPKLIDDGIIDSN-GTPMSKQMFRIAPNMPEMN 179 Query: 181 TANLLWTCFHTLDTQKIIFQLLVRNNKYAKAADWLVCNSAYDLEPAAFTLAPEILPIGPL 240 + + WT L+TQKIIF LL RN + +A ++ +C+S Y+LE AFT+ PE+LPIGPL Sbjct: 180 SGDCFWTNIGDLNTQKIIFDLLDRNMRAMRAVNFQLCHSTYELESEAFTVVPELLPIGPL 239 Query: 241 LASSRLENSQGNFWPQDSTCLDWLDQQKPRSVIYVAFGSLTVFDQTQFQELALALELSGR 300 LA +RL NS G+FW +DS+CL+WLDQQ+P SV+Y FG+LT+ DQ FQELA L+L R Sbjct: 240 LAGNRLGNSAGHFWREDSSCLEWLDQQQPSSVLYAPFGNLTILDQVHFQELAFGLKLCNR 299 Query: 301 PFLWVVRPDTTDGASDPYPEGYQERVGSRGLMVGWAPQQKVLSHP 345 PFLWVVRPD T A+D YP+G+QERV +RG M+GWAPQQK L+HP Sbjct: 300 PFLWVVRPDITTDANDRYPDGFQERVSARGRMIGWAPQQKGLTHP 344 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16051 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14383 (381 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig732 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11499 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9097 (113 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42616 176 9e-47 >Cs42616 Length = 265 Score = 176 bits (445), Expect = 9e-47, Method: Compositional matrix adjust. Identities = 88/111 (79%), Positives = 92/111 (82%) Query: 1 MLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQV 60 MLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QV Sbjct: 106 MLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQV 165 Query: 61 VLMGFIEGYRVXXXXXXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKE 111 VLMGF+EGYR+ AFDPLGLADDP+ FAELKVKELK Sbjct: 166 VLMGFVEGYRIGGGPLGEGLDPLYPGGAFDPLGLADDPDQFAELKVKELKN 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24488 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs183106187 74 1e-15 >Cs183106187 Length = 300 Score = 74.3 bits (181), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 39/104 (37%), Positives = 60/104 (57%), Gaps = 5/104 (4%) Query: 203 LLQKIRHPNVVQFLGAVTQSSPMMIVIEYLSKGDFRAYLKRKGALKP---PSALKFSLDI 259 +L K++HP++V LGA ++ +V EYL G + L RK + P + + +I Sbjct: 2 VLSKLQHPHLVTLLGACPEA--WSLVYEYLPNGSLQDRLFRKSNVSPLLWKDRARIAAEI 59 Query: 260 ARGMNYLHEHKPEAIIHRDLEPSNILRDDSGHLKVADFGVSKLL 303 A G+ +LH KPE I+H DL+P NIL D K+ DFG+ +L+ Sbjct: 60 ASGLCFLHSSKPEKIVHGDLKPQNILLDSELSSKICDFGICRLV 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12777 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54686638 (89 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51913309 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21254 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24662 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2612 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54530 396 e-112 >Cs54530 Length = 247 Score = 396 bits (1017), Expect = e-112, Method: Compositional matrix adjust. Identities = 203/245 (82%), Positives = 221/245 (90%) Query: 4 IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAH 63 IAFGRFDDSFSLGS KAYLAEFISTLLFVFAGVGSAIA+NK+T+DAALDP+GLVA+AI H Sbjct: 3 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFNKVTADAALDPSGLVAIAICH 62 Query: 64 GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILKFVT 123 GFALFVAV++GANISGGHVNPAVTFGLALGGQITILTGIFYWIAQL+G+IVA+F+LK VT Sbjct: 63 GFALFVAVAVGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVT 122 Query: 124 GGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA 183 GGL +P H++AAGVGAI+GVV EIIITF LVYTVYATAADPKKGSLGTIAPIAIGFIVGA Sbjct: 123 GGLAVPTHNVAAGVGAIEGVVMEIIITFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGA 182 Query: 184 NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVXXXXXXXXXXXXXXNVFIHSEHAP 243 NILAAGPFSGGSMNPARSFGPAVASG+F DNWIYWV NVF+HSEHAP Sbjct: 183 NILAAGPFSGGSMNPARSFGPAVASGNFQDNWIYWVGPLIGGGLAGLIYGNVFMHSEHAP 242 Query: 244 LVNEY 248 L +Y Sbjct: 243 LSYDY 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5506 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265055 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9175 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855795 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990137 (83 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040385 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2474 (420 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824629 (100 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3444 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16040 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25324 (400 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200602 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23023 (350 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs29712 177 2e-46 >Cs29712 Length = 119 Score = 177 bits (448), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 85/97 (87%), Positives = 92/97 (94%) Query: 237 DVWQGTQLLAIDVGAATGLLRRVLIGDELTEKEKKVLQRTLTDLASVVPIGVLMLLPVTA 296 DVWQGTQLLA+DVGAA LLRR L+GDELT+KEK+ LQRTLTDLASVVPIGVLMLLPVTA Sbjct: 2 DVWQGTQLLAVDVGAAMELLRRALVGDELTQKEKQALQRTLTDLASVVPIGVLMLLPVTA 61 Query: 297 VGHAAMLAAIQRYVPALIPSTYGPERLNLLRQVEKLK 333 VGHAAMLAAIQRYVP LIPSTYGPERL+LLRQ+EK+K Sbjct: 62 VGHAAMLAAIQRYVPGLIPSTYGPERLDLLRQLEKVK 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1157 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283027 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815794 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5396 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59910 111 3e-27 >Cs59910 Length = 135 Score = 111 bits (277), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 45/80 (56%), Positives = 66/80 (82%) Query: 6 KLYTMQEASQHNTKDNCWVVIDGKVYDVSTYLDDHPGGDDVLLDATGRDATEDFEDAGHS 65 K++T+ E S HN +CW++I+GKVYDV+ +L+DHPGGD+VLL ATG+DAT+DFED GHS Sbjct: 7 KVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS 66 Query: 66 KTAREEMEAFCIGELDTTSL 85 +ARE M+ + +GE+D +++ Sbjct: 67 PSAREMMDQYYVGEIDVSTI 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813500 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48270958 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48266188 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10758 (436 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27440 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098616 (168 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10326 (54 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55699223 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13485 (397 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27045 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48290058 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22668 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71919120 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26134 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11451 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23306 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25856 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8669 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764647 (176 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25753 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24056 (423 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs77739 245 8e-67 >Cs77739 Length = 182 Score = 245 bits (625), Expect = 8e-67, Method: Compositional matrix adjust. Identities = 122/164 (74%), Positives = 134/164 (81%), Gaps = 5/164 (3%) Query: 105 KGHITDLLNAWPGKGVGVHSIGDHTAIELIGRDRPGLLSEISAVLANLHFNVIAADVWTH 164 +GHIT WP K VGVHS+GDHTAIELIGRDRPGLLSEISAVLANL FNV AA+VWTH Sbjct: 4 EGHITAGAKTWPSKQVGVHSVGDHTAIELIGRDRPGLLSEISAVLANLRFNVAAAEVWTH 63 Query: 165 NERIACVVYVNDDTTCQTMEDQARLSTMEEQLKNILRGC--EDDEKVGRTSFSMGFTHVD 222 N RIACV+YVNDDTTC+ + DQ RLS MEEQLKNILRGC ED EKV RTSFSMGFTHVD Sbjct: 64 NRRIACVLYVNDDTTCRAVGDQTRLSLMEEQLKNILRGCDDEDSEKVARTSFSMGFTHVD 123 Query: 223 RRLHQMLFADRDYEGGGL--AHEVDHFPPCFQPKIAIERCEEKG 264 RRLHQM FADRDYEGGG+ A VDH P F+ +I +E ++KG Sbjct: 124 RRLHQMFFADRDYEGGGVTTADPVDH-TPSFKLEITVEPSKKKG 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2660 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990485 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99914 125 9e-32 >Cs99914 Length = 157 Score = 125 bits (315), Expect = 9e-32, Method: Compositional matrix adjust. Identities = 61/101 (60%), Positives = 77/101 (76%), Gaps = 2/101 (1%) Query: 14 YEDPATLAAATPFAVTVNEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNKNQRNLFA 73 + D LA +PF T+NEVEALYELFK+LSSS+IDDGLIHKEE +LAL + + NLF Sbjct: 55 FNDLVRLANNSPF--TINEVEALYELFKELSSSLIDDGLIHKEELRLALLKTTSGENLFP 112 Query: 74 DRIFDLFDVKRNGVIEFGEFVRSLGVFHPHAPVEDKISFAF 114 DR+FDLFD K+NGVIE EFVR+L +FHP P+E +++ F Sbjct: 113 DRVFDLFDEKKNGVIEIEEFVRALSIFHPSTPLEGQMTLHF 153 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20929 (331 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21889 (267 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60403 148 8e-38 >Cs60403 Length = 93 Score = 148 bits (373), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 71/87 (81%), Positives = 76/87 (87%) Query: 124 LVSIDILHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTALDSRIIPRYLLPE 183 L+ + + VFSAFGFVHKITTFEKTAGFQALVQFSD ETA+SAK ALD R IPRYLLPE Sbjct: 7 LLKVIFILQVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPE 66 Query: 184 YVGPCTLRITYSGHTDLSVKFQSHRSR 210 +GPCTLRITYS HTDLSVKFQSHRSR Sbjct: 67 NMGPCTLRITYSAHTDLSVKFQSHRSR 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28510 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31715 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24371 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7694 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19908 (110 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765319 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27416 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9536 (425 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6621 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27007 (207 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80871 244 4e-67 >Cs80871 Length = 324 Score = 244 bits (624), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 125/206 (60%), Positives = 152/206 (73%), Gaps = 9/206 (4%) Query: 1 MGLKFEEEEFLACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHP 60 M + +EEE L CC STKFAKEMA ASPF+SL++AV+AAR IWFN VDVNGWL +FSAHP Sbjct: 1 MMVVLDEEELLGCCGSTKFAKEMASASPFASLNQAVSAARHIWFNLVDVNGWLDAFSAHP 60 Query: 61 QIGNXXXXXXXXXXAQWSKGEQXXXXXXXXXXXLQELAEWNAKYRQKFGFVFLICASGKS 120 QIG +QWSK EQ QEL++WN +YR +FGF+F+ICASG++ Sbjct: 61 QIGQSPS-------SQWSKAEQSTALATANESSSQELSDWNNRYRLRFGFIFIICASGRT 113 Query: 121 SDGILAELKKRYPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKKA 180 + ILAELKKRY NRPI+EFEIAAQEQMKITELRLAKLF+AK +S + + AK A Sbjct: 114 AAEILAELKKRYTNRPIIEFEIAAQEQMKITELRLAKLFSAKAKASSATFQY-SATAKTA 172 Query: 181 EDRVSIIGGHLTATASEASSVKLSQL 206 EDRVSII GHL A+ +EAS+ K+SQ+ Sbjct: 173 EDRVSIIEGHLCAS-TEASAGKISQI 197 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27018 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4029 60 2e-11 >Cs4029 Length = 266 Score = 59.7 bits (143), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 29/52 (55%) Query: 146 KSSDQDECAVCLERLRPGETLVHLPCAHRFHSGCMVPWLHNNAHCPCCRMEI 197 K D CAVCL P E ++ PC H FH C+VPW+ +NA CP C + Sbjct: 173 KEEDAMRCAVCLXDFEPKEKVMLTPCNHMFHEDCIVPWVKSNAQCPVCXFSL 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7377 (65 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20275 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15114 (306 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs31373 61 2e-11 >Cs31373 Length = 293 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Query: 18 KQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYR 71 K ++ WT ELH RFV AV QLG D+A P +L +MG+ LT +++ SHLQKYR Sbjct: 85 KMKVDWTPELHRRFVQAVEQLGV-DKAVPSRILELMGIDCLTRHNIASHLQKYR 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27589 (543 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95626 148 1e-37 >Cs95626 Length = 191 Score = 148 bits (374), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 80/147 (54%), Positives = 93/147 (63%), Gaps = 19/147 (12%) Query: 3 TVAPPVEQAADLLQKMSLDSQTKTLEIPEPTKK-------------------VPSERSVT 43 TVAP VE+A+DLLQK+SLDSQTK+LEI E TKK +PSERS T Sbjct: 4 TVAPAVEKASDLLQKLSLDSQTKSLEISEHTKKPSANQYGSVDSVNAAANGQIPSERSGT 63 Query: 44 PLLPDFVDPSMCYLPNGYPSTAXXXXXXXXXXNEWDDYSRYVNPEGVEMTSGVYGDNGSL 103 P L DF+DP+MCY+PNGYPSTA EWDDY+RYV+ +GV+MTSGVYGDNGSL Sbjct: 64 PFLNDFMDPNMCYVPNGYPSTAFYYGGYDGNVGEWDDYTRYVSQDGVDMTSGVYGDNGSL 123 Query: 104 LYHHXXXXXXXXXXXXXXXXVPTMGND 130 +YHH VPTMG D Sbjct: 124 MYHHGYGYAPYPPYSPATSPVPTMGTD 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20884 (490 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74106183 200 3e-53 >Cs74106183 Length = 155 Score = 200 bits (508), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 96/140 (68%), Positives = 119/140 (85%), Gaps = 2/140 (1%) Query: 345 MENCMENTRMLKQGLEKTGRFKILSKDIGVPLVAFSLKDSSKHTVFEVADSLRKFGWTVP 404 MENCM N R L++GLEKTGRF+ILSKD+GVPLVAFSLKDSS HTVFE+++ LRKFGW VP Sbjct: 1 MENCMGNARALREGLEKTGRFEILSKDVGVPLVAFSLKDSSAHTVFEISEGLRKFGWIVP 60 Query: 405 AYTMPANAEHVAVLRVVIREDFSRGLAERLISDIDKVMREVDTLPSQVSSKTAHVTATVD 464 AYTMPANAE+VAVLRVV+REDFSR L ERLIS I++V++E+D+LPS+VS+KTAHVT V+ Sbjct: 61 AYTMPANAENVAVLRVVVREDFSRSLVERLISHIEEVLKEIDSLPSRVSTKTAHVTPMVN 120 Query: 465 EVVRDSEVAVKSTVHKSETE 484 E D +K +V +++ E Sbjct: 121 ETQGDK--PLKKSVRETQEE 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6166 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10034 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15529 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30951 70 3e-14 >Cs30951 Length = 59 Score = 69.7 bits (169), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 32/44 (72%), Positives = 38/44 (86%) Query: 13 NKGLLQSDELYQYILETSVYPREPEPLKELRAATASHPRAEMAT 56 +KGLLQS++LY+YILETSVYPREPEPLK++R TA HP A M T Sbjct: 16 SKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGT 59 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30388 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 62 1e-11 >Cs17782 Length = 216 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 7/70 (10%) Query: 83 SDFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPG-------AETKFKEISNAYEVL 135 S+FY+VLG+++ + +E+++AY+KLA +HPD G A+ KF+ I +AY VL Sbjct: 9 SNFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVL 68 Query: 136 SDDEKRSLYD 145 SD KR LYD Sbjct: 69 SDANKRLLYD 78 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21658 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105558 318 4e-89 >Cs105558 Length = 358 Score = 318 bits (816), Expect = 4e-89, Method: Compositional matrix adjust. Identities = 168/348 (48%), Positives = 233/348 (66%), Gaps = 19/348 (5%) Query: 13 FLLACLVAFSLQIYFXXXXXXXXXXXXXXXXXQNNILQKVIKLGDGVLLEPEDVDVD-KE 71 FLLACL+AF+LQ +F +++ ++ +IKLG+G + PEDV V ++ Sbjct: 6 FLLACLLAFTLQFFFSPPVSSSASLLSTSK--ESSSMKDLIKLGEGCVSHPEDVSVVVRK 63 Query: 72 GTLYTATRDGWIKR--LHKNGSWENWKKVNTDTVLGITFTKDGDLVACDTDQGLLKITEA 129 G LYTAT DGW+K LH N + NWK +++ ++LG+T TK+GD+V CD+ +GL K+TE Sbjct: 64 GALYTATNDGWVKYFILH-NETLVNWKHIDSQSLLGLTTTKEGDVVICDSKKGLFKVTEE 122 Query: 130 GVTVLTSHVNGSKIRFADDVIEGPDGSLYFSVASTKFGPHDGYLDMLEAKPHGQLLKYDP 189 GV VL V RFA+DVI+ DG+LYF+V+STK+ P D Y DM E P+GQLLKYDP Sbjct: 123 GVKVLDPDV-----RFANDVIDASDGTLYFTVSSTKYTPADFYKDMAEGNPYGQLLKYDP 177 Query: 190 SSGETSILLDHLGFANGVAVSKDQDYLVVCETWK-----YWLEGKNKGKTEIFVENLPGG 244 S +T++L + FANGVA+SKD+D++VVCE+WK YWL+G G + F ENLPGG Sbjct: 178 KSNQTTVLQEGFYFANGVALSKDEDFVVVCESWKFRCRRYWLKGDRNGTLDTFAENLPGG 237 Query: 245 PDNINLAPDGSFWIALLQLTREGFEFVHTSKAAKHLVAASRKLTELVSGMRTEAMAVNVA 304 PDNINLAPDGSFWIAL+++ + G + + + L+ A L L+ M ++A A V Sbjct: 238 PDNINLAPDGSFWIALIKMNQTGVKAIQNCREKWELLEAYPGLISLLLPMGSDAGARVVK 297 Query: 305 A---DGKIIKKLMDPDGSVISFVTNALEFEDHLYLGSLNTNFIGKLPL 349 DGKII+ DP+ + +SFVT+A+E+ D+L+L SL +NFIG LPL Sbjct: 298 VDGIDGKIIRDFNDPNATYLSFVTSAVEYNDNLFLASLQSNFIGVLPL 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2260 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17022 (443 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25479 (392 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746565 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs93789 100 2e-23 >Cs93789 Length = 294 Score = 99.8 bits (247), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 53/153 (34%), Positives = 82/153 (53%), Gaps = 1/153 (0%) Query: 48 LHCKGWISVYYDPKRPQFLGSGTTNLDEFLVQGTRWSSGLVDVAISKFSPLIYGPFKTRN 107 +H +GW S+Y PKRP F GS NL + L Q RW+ G V++ S+ P+ YG Sbjct: 1 MHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLK 60 Query: 108 FLHSMCYAELALFPIFYFLSLWGFATIPQLCLLNGIPLYPQVSNTYFIVFSFIFLSSHSK 167 FL Y ++P+ + L + T+P +CLL + PQ+SN IVF +FLS + Sbjct: 61 FLERFAYVNTTIYPL-TAIPLLMYCTLPAVCLLTNKFIMPQISNLASIVFISLFLSIFAT 119 Query: 168 HLYEVLATGLTFRHWVNEERIWMMKSVTSHLYG 200 + E+ +G+ W E+ W++ V+SHL+ Sbjct: 120 GILEMRWSGVGIDEWWRNEQFWVIGGVSSHLFA 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51864488 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7983 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226749360 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226755800 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14484 (459 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6468 (410 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48285622 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24495 (144 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21292 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48120635 (91 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012308 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7380 (55 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10660 (324 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs7972 76 4e-16 >Cs7972 Length = 279 Score = 76.3 bits (186), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 4/104 (3%) Query: 44 LFEKMLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRIQDV-KGKEW--MFQFRFWP 100 L +K+L SD G +GR+VLPK AE + P + +G+ + ++D+ + W + FRFWP Sbjct: 173 LLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWP 232 Query: 101 NNNSRMYVLEGVTPCIQSMQLQAGD-TVTFSRMDPEGKLIMGFR 143 NN SRMY+LE +++ LQ GD V +S + LI G + Sbjct: 233 NNKSRMYLLENTGDFVKANGLQEGDFIVIYSDLKCGKYLIRGVK 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25085 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19740 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10557 (394 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1788 (83 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29655 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2545 (305 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs92660 174 1e-45 >Cs92660 Length = 206 Score = 174 bits (440), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 78/104 (75%), Positives = 92/104 (88%) Query: 1 MTIKPAVRISERKLIVKDRTILTGLPDNVVATSGSSSGPVDGVFLGANFSEEKSRHVVSL 60 MTIKP VRI+ERKLIVKDRTILTG+PDN++ TSGS+SGPV+GVF+GA F EE SRHV+ + Sbjct: 96 MTIKPVVRIAERKLIVKDRTILTGVPDNLITTSGSTSGPVEGVFIGAAFDEESSRHVLPI 155 Query: 61 GTLTGVRFMACFRFKLWWMAQKMGDQGRDIPLETQFLLLETKHG 104 G L +RF+ACFRFKLWWMAQKMGD G +IPL+TQFLL+ETK G Sbjct: 156 GALRDIRFLACFRFKLWWMAQKMGDHGSEIPLQTQFLLVETKRG 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286232 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9678 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990673 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8651 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 143 2e-36 >Cs48454 Length = 244 Score = 143 bits (360), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 73/168 (43%), Positives = 117/168 (69%), Gaps = 1/168 (0%) Query: 17 LGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANN 76 +GRG++++KRIEN NRQVTF KRR+GLLKKA+E+SVLCDAEVALIVFS +G+L+EY+ + Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 77 S-VKGTIERYKKASADSSNTGSVSEASTQYYQQEAAKLRAQIVKLQNDNRNMMGDALSSM 135 S ++ +ERY++ + + E +KL+A++ LQ + ++ MG+ L+ + Sbjct: 61 SCMERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADL 120 Query: 136 SVKDLKSLENKLEKAISRIRSKKNELLFAEIEYMQKRELDLHNNNQLL 183 S+K+L+S+E +++ + IRS+KN+L+ I +QK++ L N LL Sbjct: 121 SLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQNNLL 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698717 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774982 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21596 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 141 1e-35 >Cs24180 Length = 294 Score = 141 bits (355), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 97/304 (31%), Positives = 154/304 (50%), Gaps = 28/304 (9%) Query: 32 DDYEVVRKVGRGKYSEVFEGINVNTNERCVXXXXXXXXX-----XXXXXXXXXLQNLCGG 86 D YE V K+G G Y V++ N TNE L+ + G Sbjct: 2 DQYEKVEKIGEGTYGVVYKARNCVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHG 61 Query: 87 PNVVKLLDIVRDQHSKTPSLIFEFVNSTDFKVLYPTLTDYD-----IRYYIYELLKALDY 141 N+V+L D+V + K L+FE+++ D K + D+ I+ ++Y++L+ + Y Sbjct: 62 -NIVRLQDVVHSE--KKLYLVFEYLD-LDLKKHMDSCPDFANDPRLIKTFLYQILRGIAY 117 Query: 142 CHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAE-FYHPGKEYNVRVASRYFKGPELLVD 200 CHS ++HRD+KP N++ID L+L D+GLA F P + + V + +++ PE+L+ Sbjct: 118 CHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLG 177 Query: 201 LQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDELNAYLNKYHLEL 260 + Y +D+WS+GC+FA M+ + P F G D+L KI +VLGT + + Sbjct: 178 SRHYSTPVDVWSVGCIFAEMV-NQRPLFPGDSEIDELFKIFRVLGTPNEDTW-------- 228 Query: 261 DPQLDALVGRHSRKP-W-SKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAKEAMGHPY 318 P + +L S P W SK + ++L P ID L K+L D R+TA+ A+ H Y Sbjct: 229 -PGVTSLPDFKSAFPKWPSKELGTVVRNL-EPAGIDLLSKMLCMDPSRRITARSALEHEY 286 Query: 319 FSQV 322 F V Sbjct: 287 FRDV 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54623103 (62 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27311 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29022 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32890 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25471 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18129 114 4e-28 >Cs18129 Length = 217 Score = 114 bits (285), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 59/86 (68%), Positives = 68/86 (79%), Gaps = 3/86 (3%) Query: 34 VWKEIEEPVKVEAKDESKDDLDEFSVKMFFKGMSIAGYGDASCGLSGIGVVMERSTNVRA 93 VWKE E+ V K+ K+DLDEFSVKMFFKGMSI G++S G SGIGVVMERS N+ Sbjct: 37 VWKETED---VAVKEVVKEDLDEFSVKMFFKGMSITEVGESSSGFSGIGVVMERSFNIPI 93 Query: 94 IQVQKTLDFYVEEPVADYLALMDGLM 119 +QVQK LDF+VEE VADYLALMDGL+ Sbjct: 94 MQVQKKLDFFVEESVADYLALMDGLI 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265276 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1122 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs32325 75 4e-16 >Cs32325 Length = 165 Score = 74.7 bits (182), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 40/107 (37%), Positives = 64/107 (59%) Query: 1 MSPEYAIDGFYSIKSDVYSFGVMVLEIVSGSRNRGFSHPDHKLNLLGHAWVLHTEGRPLE 60 ++PEYA +G SI++DVY+FG+++L+++SG + + + + +L A L + E Sbjct: 42 LAPEYAENGIVSIRTDVYAFGIILLQLMSGRKVVDMNGEEPQQSLRQWAEPLIEKLALHE 101 Query: 61 LLDTSVEDSITLHEVVRTIHVGLLCVQRNPEDRPSMSAAVLMLGGEG 107 L+D +E+S +E+ LCVQRNPE RPSM V +L GE Sbjct: 102 LIDPRIENSYDTYELYLMAKTAYLCVQRNPEGRPSMGEVVRLLEGEN 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11672 (507 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27449 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48411817 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 247 5e-68 >Cs81333 Length = 370 Score = 247 bits (630), Expect = 5e-68, Method: Compositional matrix adjust. Identities = 118/134 (88%), Positives = 122/134 (91%) Query: 21 EITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDMT 80 EITNV EYEAIAKEKLPKMV+DYYASGAEDQWTL ENRNAF+RILFRPRILIDVS+IDM Sbjct: 3 EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62 Query: 81 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTGP 140 TTVLGFKISMPIMIAPTAMQKMAHPEGEY GTIMTLSSW+TSSVEEVASTGP Sbjct: 63 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP 122 Query: 141 GIRFFQLYVYKDRN 154 GIRFFQLYVYKDRN Sbjct: 123 GIRFFQLYVYKDRN 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18537 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15234 (240 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26935 (201 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52976 344 5e-97 >Cs52976 Length = 206 Score = 344 bits (882), Expect = 5e-97, Method: Compositional matrix adjust. Identities = 167/206 (81%), Positives = 183/206 (88%), Gaps = 5/206 (2%) Query: 1 MVLTEEEITRLYRVRKTVMQMLKDRNYLVGDFEINMSKEQFKDKYGENMKREDLIINKTK 60 M L++EEI RL+R+R+TVMQML+DR Y VGDFEINMSKEQF K+GENMKREDL+INK Sbjct: 1 MTLSDEEIKRLFRIRRTVMQMLRDRGYFVGDFEINMSKEQFIAKFGENMKREDLVINKAL 60 Query: 61 RTDTNDQIYVFFPDEPKVGVKTMKTYTNRMKSENVFRAILVTQQSLTPFAKTCISEISGK 120 R D++DQIYVFFPDE KVGVKTMKTYTNRMKSENVFRAILV QQ+LTPFA+TCI EIS K Sbjct: 61 RNDSSDQIYVFFPDEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCIQEISAK 120 Query: 121 FHLEVFLEAELLVNIKEHVLVPEHRVLTNEEKKTLLERYTVKETQL-----TQPIAKYYG 175 FHLEVF EAELLVNIKEHVLVPEH+VLTNEEKKTLL+RYTVKETQL T P +YYG Sbjct: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTNEEKKTLLKRYTVKETQLPRIQVTDPXCRYYG 180 Query: 176 LKRAQVVKIIRPSETAGRYVTYRYVI 201 LKR QVVKIIRPSETAGRYVTYRYV+ Sbjct: 181 LKRGQVVKIIRPSETAGRYVTYRYVV 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825938 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16031 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992451 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417129 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26436 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27141 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs12983 67 2e-13 >Cs12983 Length = 76 Score = 67.0 bits (162), Expect = 2e-13, Method: Composition-based stats. Identities = 30/41 (73%), Positives = 35/41 (85%) Query: 176 PSSVATKVVCLTQVVTADELRDDTEYDDILEDMRLEGEKFG 216 P SV +KVVCLTQVV+ADEL+DD EY++ILEDMR EG KF Sbjct: 4 PGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFA 44 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743385 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55091 182 2e-48 >Cs55091 Length = 151 Score = 182 bits (461), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 83/109 (76%), Positives = 98/109 (89%), Gaps = 2/109 (1%) Query: 4 MKNLTKEEFVHILRRQSTGFSRGSSRYRGVTLHKCGRWEARMGQFLGKKYIYLGLFDSEV 63 M NLTKEEFVH+LRRQSTGF RGSS+YRGVTLHKCGRWEARMGQFLGKKY+YLGLFD+EV Sbjct: 1 MSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEV 60 Query: 64 EAARAYDKAAIKCNGREAITNFEPSTYEGEMMSEAGNEDGNHNLDLNLG 112 EAARAYD+AA+KCNG++A+TNF+PS Y+ E+ +A +HNLDL+LG Sbjct: 61 EAARAYDRAAVKCNGKDAVTNFDPSLYQDEL--KASGHGVDHNLDLSLG 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14654 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs84538 81 2e-18 >Cs84538 Length = 216 Score = 80.9 bits (198), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 37/50 (74%), Positives = 44/50 (88%) Query: 1 MTLEKLLHYGQMLVQEQDNVKRVQLADKYLADAALGDANQDSINRGEFYG 50 MT+EKLL YG M+VQEQ+NVKRVQLADKYL++AALG+AN D+I G FYG Sbjct: 167 MTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32383 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs60159 65 6e-13 >Cs60159 Length = 242 Score = 64.7 bits (156), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 45/172 (26%), Positives = 76/172 (44%), Gaps = 15/172 (8%) Query: 1 MFAAQDTTASLLTWMIKYIHDDSKLQEAIQIEQKTIFESNEGGSHSLSWSQTRNMPLTSR 60 + DTT+ LTW I + ++ + E + G ++ S T+N+ Sbjct: 33 ILGGSDTTSGTLTWAISLLLNNRHALKRAHEE----LDQQVGKERAVDESDTQNLVYLQA 88 Query: 61 AIKESLRMASIVSFTF-REAVEDVEYKGYLIPKGWKVLPLFRNIHHNPEFFVDPHKFNPS 119 IKE+LR+ REA+ED GY +P G +++ I +P + +P F P Sbjct: 89 IIKETLRLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPE 148 Query: 120 RF--------ELGVKPNTF--MPFGNGLHICPGNEVAKLEMLIFIHHLVNKF 161 RF ++ V+ F +PFG+G CPG A + + + L++ F Sbjct: 149 RFLPGHGAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAF 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801430 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs26492 114 6e-28 >Cs26492 Length = 262 Score = 114 bits (286), Expect = 6e-28, Method: Compositional matrix adjust. Identities = 66/187 (35%), Positives = 105/187 (56%), Gaps = 11/187 (5%) Query: 5 MLFSATFPKEIQRLASDFLAKYIFLAVGRVGSSTDLIVQRVEFVHESD---KRSHLMDLL 61 M+FSAT P I+ L + +L L V VG S + + + ++ ++ L Sbjct: 1 MMFSATMPPWIRSLTNKYLKNP--LTVDLVGDSDQKLADGISLYSIATSMYEKPSIIGQL 58 Query: 62 HAQRANGAQGKQALTLVFVETKKGADSLEHWLCMNGFPATTIHGDRSQQEREQALRSFKS 121 + A G + +VF +TK+ AD L H + + + +HGD SQ +RE+ L +F+ Sbjct: 59 ITEYAKGGK-----CIVFTQTKRDADRLAHAMAKS-YNCEPLHGDISQSQRERTLSAFRD 112 Query: 122 GNTPILVATDVAARGLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNENN 181 G IL+ATDVAARGLD+P+V +++++LPN + +VHR GRTGRAGK G A + + Sbjct: 113 GRFNILIATDVAARGLDVPNVDLIIHYELPNTSETFVHRTGRTGRAGKKGSAILIYTDQQ 172 Query: 182 SSLARSL 188 + +S+ Sbjct: 173 ARQVKSI 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30126 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 289 8e-81 >Cs169106187 Length = 148 Score = 289 bits (740), Expect = 8e-81, Method: Compositional matrix adjust. Identities = 135/148 (91%), Positives = 145/148 (97%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPAESPFSGGVFLVSIHFPPDY 60 MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP++SP++GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYETTARSWTQKYAMG 148 PEIAHMYK+D+ KYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48276288 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs42867 62 2e-12 >Cs42867 Length = 334 Score = 62.4 bits (150), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 9/138 (6%) Query: 5 SIERYLKYHVQEFERALQEKFPACSIAAKRQICSTTTILDVQGLGMKNFTRTAANLLSAM 64 S+ Y++ H+Q E + P+ S R I ++ +LD+ GL + + L++ + Sbjct: 116 SVNYYVQSHIQMNEYRDRVVLPSASKKHGRYIGTSLKVLDMTGLKLSALNQIK--LMTVI 173 Query: 65 SKIDTNYYPETLHRMYIVNAGPGFKKMLWPAAQKFLDVKTIAKIQVLDPKSLSKLLEVID 124 + ID YPE YIVNA P W + L +T KIQVL +LL+++D Sbjct: 174 TTIDDLNYPEKTETYYIVNA-PYIFSACWKVVKPLLQERTRRKIQVLQGNGRDELLKIMD 232 Query: 125 SCQLPDFLGGSCTCSAEG 142 LP F C EG Sbjct: 233 YASLPHF------CRKEG 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24372 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 300 4e-84 >Cs169106187 Length = 148 Score = 300 bits (769), Expect = 4e-84, Method: Compositional matrix adjust. Identities = 142/148 (95%), Positives = 146/148 (98%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYEATARSWTQKYAMG 148 PEIAHMYK+D+AKYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793997 (135 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25128 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50891356 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2908 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10432 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7950 (326 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855564 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7270 (365 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 179 4e-47 >Cs47542 Length = 355 Score = 179 bits (454), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 100/316 (31%), Positives = 176/316 (55%), Gaps = 5/316 (1%) Query: 20 KFVRDEDERPKVAYNDFSNEIPIISLAGIDEVEGRRGEICKKIVAACEDWGIFQIVDHGV 79 +++ +++ P + + ++IP+I + + E E+ K + AC++WG FQ+V+HGV Sbjct: 27 RYICPDEDSPLNSDDTLISQIPVIDMQSLLSEESMDSELAK-LDFACKEWGFFQLVNHGV 85 Query: 80 DAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYP 139 + + ++ + FF L EEK ++ G GF + + E DW +I + + P Sbjct: 86 SSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAFVVSEEQKLDWADIFSMITLP 145 Query: 140 IRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMDQKV 199 + R +P P R+ + YS EL LA L+ + + + + E L + + Q + Sbjct: 146 VHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFENGFQSM 205 Query: 200 VVNFYPKCPQPDLTLGLKRHTDPGTITLLLQ-DQVGGLQATRDDGKTWITVQPVEGAFVV 258 +N+YP CPQP+ +GL H+D +T+LLQ ++V GLQ ++DGK WI + P+ AF+V Sbjct: 206 RMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQ-IKNDGK-WIPITPLPNAFIV 263 Query: 259 NLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIVYPLSVREGEK-PILEA 317 N+GD +++NG +++ +H+A+VNS RLSIATF + +YP S EK P L Sbjct: 264 NIGDTLEIITNGTYRSIEHRAIVNSLQERLSIATFYTKRLDGEIYPASSLISEKTPALFR 323 Query: 318 PITYTEMYKKKMSKDL 333 +T E ++ + +++L Sbjct: 324 RVTVEEYFRNRYAREL 339 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13504 (334 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 365 e-103 >Cs66175 Length = 260 Score = 365 bits (936), Expect = e-103, Method: Compositional matrix adjust. Identities = 173/223 (77%), Positives = 191/223 (85%), Gaps = 16/223 (7%) Query: 1 MQGWRATMEDAHAAYPDLDASTSFFGVYDGHGGKVVAKFCAKYLHQQVLKNEAYAAGDIG 60 MQGWRATMEDAHAAYPDLD+STSFFGVYDGHGGK VAKFCAKYLHQQVLK+EAY+AGD+ Sbjct: 29 MQGWRATMEDAHAAYPDLDSSTSFFGVYDGHGGKAVAKFCAKYLHQQVLKHEAYSAGDLV 88 Query: 61 TSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQADDWAFEE 120 TS QKAF RMDEMMRGQRGWRELA+LGDK++KF+GMIEG IWSP+ ++ND DDW EE Sbjct: 89 TSAQKAFLRMDEMMRGQRGWRELAILGDKMDKFSGMIEGFIWSPKGGEANDHFDDWTSEE 148 Query: 121 ----------------GPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAY 164 GPHSDF GPTSG TACVAI+R+KQLVVANAGDSRCV+SRKGQA Sbjct: 149 YKQHGFLRYLINRLLIGPHSDFHGPTSGSTACVAIIRDKQLVVANAGDSRCVLSRKGQAL 208 Query: 165 NLSRDHKPDLELEKERILKAGGFIHAGRVNGSLNLARAIGDME 207 NLS+DHKPDLE+EK+RILKAGGFI GRVNGSLNLARAIGD+E Sbjct: 209 NLSKDHKPDLEVEKDRILKAGGFIQVGRVNGSLNLARAIGDVE 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48125617 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48123095 (58 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27846 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2194 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91021444 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80110 275 2e-76 >Cs80110 Length = 255 Score = 275 bits (704), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 136/211 (64%), Positives = 155/211 (73%), Gaps = 27/211 (12%) Query: 1 KKVEKFQTEEEVAVRLAKYTADLSAKFVK---------------------------DTVE 33 K V+ F +EE++AV LAKYTADLSAKF K D++E Sbjct: 10 KNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIE 69 Query: 34 WGKWHVFWLDERVVKKDHPDSNYKLAFDGLLCKVPIPPGQVYAINDALSAEAAAEDYETC 93 W KWHVFW+DERVV KDH DSNYKLA+DG L +VPI G VYAINDALSAE AAEDYETC Sbjct: 70 WAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETC 129 Query: 94 LKHLVQRNVIATSKATGFPKFDLILLGMGPDGHLASLFPGHALCNEKKKWVTHIMDSPKP 153 LKHL + N++ATS ATGFPKFDL+LLGMGPDGH+ASLFPGH L E +KWVT I DSPKP Sbjct: 130 LKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKP 189 Query: 154 PPQRITFTFPVISSAAYNAMVVTGHDTADAV 184 PP+RITFTFPVI+S+AY AMVV G + AV Sbjct: 190 PPERITFTFPVINSSAYIAMVVCGAGKSSAV 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10435 (487 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20819 (82 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20329 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753789 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26969 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27214 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48118301 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23333 (356 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801981 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16295 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27986 (115 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91037763 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12395 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027550 (109 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48016 95 2e-22 >Cs48016 Length = 254 Score = 94.7 bits (234), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 41/75 (54%), Positives = 59/75 (78%) Query: 35 LCRTAEDHPEILFLKVNFDENKPMCKSMNVKVLPYFHFYRGSEGQLESFSCSLAKLQKLK 94 +C+ AE +P++ FL+VN++E+K MC S+NV VLP+F FYRG+ G+L SFSC+ A ++K K Sbjct: 105 ICQLAEMNPDVQFLQVNYEEHKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNATIKKFK 164 Query: 95 DAIALHNTDRCSIGP 109 DA+A H DRC +GP Sbjct: 165 DALAKHTPDRCGLGP 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11148 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27629 (312 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2209 (219 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591033 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48385879 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30530 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48484945 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22340 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24312 (482 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs23635 150 2e-38 >Cs23635 Length = 278 Score = 150 bits (379), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 83/216 (38%), Positives = 117/216 (54%), Gaps = 7/216 (3%) Query: 41 VADLPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIA 100 + LPG +L F +GY+ V ++ LFY+F+E+ P P+VLWL GGPGCS + Sbjct: 24 ITTLPGFDGDLPFKLETGYIGVGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFS 83 Query: 101 YGMAEEIGPFHIEADGKTL-----YLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSN 155 G+ EIGP + + + LNPYSW +VAN++F D+PVG GFSY+NT + N Sbjct: 84 -GLVFEIGPLSFDYEKSKVNLPKFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGYIMN 142 Query: 156 GDKRTANDSLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLKTKEKTVN 215 D +A + FL +W P + YI G+SY G VP + Q I +N Sbjct: 143 -DTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRMN 201 Query: 216 LKGYMVGNALTDDYHDHLGVFQFMWSAGLISDQTYK 251 LKGY++GN LTD + V F + LIS + Y+ Sbjct: 202 LKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYE 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27916 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13382 (530 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24051 514 e-148 >Cs24051 Length = 316 Score = 514 bits (1324), Expect = e-148, Method: Compositional matrix adjust. Identities = 250/314 (79%), Positives = 282/314 (89%), Gaps = 1/314 (0%) Query: 218 LDDVVMEKLMEFDLLKHANKPSFSLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK 277 +DDVVMEKL+EFDLLKHA KPSF+LSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK Sbjct: 1 MDDVVMEKLVEFDLLKHAKKPSFTLSGGNKRKLSVAIAMIGDPPIVILDEPSTGMDPIAK 60 Query: 278 RFMWEVISRLSTRRGKTAVILTTHSMNEAQALCTRMGIMVGGRLRCIGSPQHLKTRFGNH 337 RFMWEVISRLSTR+GKTAVILTTHSMNEAQALCTR+GIMVGG+LRCIGSPQHLKTRFGN Sbjct: 61 RFMWEVISRLSTRQGKTAVILTTHSMNEAQALCTRIGIMVGGQLRCIGSPQHLKTRFGNF 120 Query: 338 LELEVKPFEVSSVDLQNLCRVIQEWLSSVPSHPRSLLDGLEICIGA-DSILAENATVAEI 396 LELEVKP EVSSVDL++LC++IQE + +PS RSLLD LE+CIG DSI +ENAT AEI Sbjct: 121 LELEVKPTEVSSVDLEDLCQIIQERVFDIPSQRRSLLDDLEVCIGGIDSISSENATAAEI 180 Query: 397 SLSREMIIMIGRWLGNEERIKTLISPLPISDGVIGEQLIEQLVRDGGIPLPIFSEWWLSN 456 SLS+EM++++G WLGNEERIKTLIS D + GEQL EQLVRDGGI LPIFSEWWL+ Sbjct: 181 SLSQEMLLIVGCWLGNEERIKTLISSSSSPDRIFGEQLSEQLVRDGGIQLPIFSEWWLAK 240 Query: 457 EKFSAIDSFVLTSFPGAIFQGFNGLSAKYQLPYGQGLSLADVFGHLERSRHQLGIAEYSI 516 EKF+ IDSF+L+SFPG+ FQG NGLS KYQLP+ +GLS+ADVFG LE++R++LGIAEYSI Sbjct: 241 EKFAVIDSFILSSFPGSTFQGCNGLSVKYQLPFSEGLSVADVFGLLEQNRNRLGIAEYSI 300 Query: 517 SQSTLETIFNHFCG 530 SQSTLETIFNHF Sbjct: 301 SQSTLETIFNHFAA 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32683 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26713 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489810 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs24180 65 5e-13 >Cs24180 Length = 294 Score = 65.1 bits (157), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 7/147 (4%) Query: 45 KIGEGAHGKVYEGR--YGDRIVAVKVLHRGSTTEERAALESRFAREVNMMSRVKHENLVK 102 KIGEG +G VY+ R + +A+K + +E + S RE++++ ++H N+V+ Sbjct: 9 KIGEGTYGVVYKARNCVTNETIALKKIR---LEQEDEGVPSTAIREISLLKEMQHGNIVR 65 Query: 103 FIGAC-KEPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFSLDIAHAMECLHANGII 161 E + +V E L + L+K++ S + + F I + H++ ++ Sbjct: 66 LQDVVHSEKKLYLVFEYL-DLDLKKHMDSCPDFANDPRLIKTFLYQILRGIAYCHSHRVL 124 Query: 162 HRDLKPDNLLLYANQKHVKLADFGLAR 188 HRDLKP NLL+ +KLADFGLAR Sbjct: 125 HRDLKPQNLLIDRRTNALKLADFGLAR 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6102 (212 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs37739 194 7e-52 >Cs37739 Length = 121 Score = 194 bits (492), Expect = 7e-52, Method: Compositional matrix adjust. Identities = 92/121 (76%), Positives = 104/121 (85%) Query: 1 MKIAAGAAKGLKYLHDKASPPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVS 60 MKIAAGAAKGL+YLHDKA+PPV++R+ K SNILL EG+HPKLS FGLAKLGP GD +HVS Sbjct: 1 MKIAAGAAKGLEYLHDKANPPVIYRDFKSSNILLEEGFHPKLSDFGLAKLGPVGDKSHVS 60 Query: 61 KWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWART 120 VMGTYGYCAPEYAMTGQLT+KSD+YSFGVV LE+ITGR AID++R GEQ LV W Sbjct: 61 TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSSRPHGEQNLVTWVIY 120 Query: 121 L 121 L Sbjct: 121 L 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595520 (151 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1486 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27009 (178 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7364 (99 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810834 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925431 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24826 (447 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26130 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800902 (78 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20504 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264387 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs75192 71 4e-15 >Cs75192 Length = 239 Score = 71.2 bits (173), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 42/124 (33%), Positives = 69/124 (55%), Gaps = 11/124 (8%) Query: 5 SSWDALRKQARKLEAQLDEQMNSYRKFVSA--------KGSTKVGTAEN--DLESGIDRL 54 S W+ LRK+ARK+E LD +++SY K + GS VG+ + +E I L Sbjct: 11 SGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGYVDTGSPTVGSGRSWKSMEMEIQSL 70 Query: 55 LKQLQQVNSQM-QAWVSSGGSEMVSHTLTRHQEIFQDITQEFYRLRNSLRAKQEHASLLE 113 L++L +N M + S+ + V+ L RH++I + TQEF R++ ++ + +EHA LL Sbjct: 71 LEKLLDINDAMSRCAASAAPTTSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLS 130 Query: 114 DFRE 117 R+ Sbjct: 131 SVRD 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17480 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040450 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20803 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8550 (198 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12321 (226 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36641 214 9e-58 >Cs36641 Length = 261 Score = 214 bits (544), Expect = 9e-58, Method: Compositional matrix adjust. Identities = 116/211 (54%), Positives = 145/211 (68%), Gaps = 7/211 (3%) Query: 2 ADTVRRYAVVTGANKGIGFGTVKQLASNGIVVVLTARDEKRGLEALEKLKDFGISDLVVF 61 A+T +RYAVVTGANKGIG+ V+QLA NGI+ VLTARDEK GLEA+EKLK G D V+F Sbjct: 9 AETAKRYAVVTGANKGIGYEVVRQLALNGIITVLTARDEKGGLEAVEKLKHSGF-DNVIF 67 Query: 62 HQLDVTDSVSAARLADFVKTQFGKLDILVNNAAVVGSIVTPEDFKSASSGKRLEEINWSE 121 HQLDV D + +ADF+++ FGKLDILVNNA + G I + D S E + Sbjct: 68 HQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITG-ISSDADTLSG-----FIEEGVAR 121 Query: 122 IPTIPNDEVAEQCLKTNYYGTKSVTEALLPLLQLSDSPRIVNVSSGVGKLMNFPNGWAKE 181 E AE+CL+TNY G K + EAL+PLLQLSDS RIVNVSS +GKLM + WAK Sbjct: 122 GKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMYVTHEWAKG 181 Query: 182 VLSDAERLTEEKIDSVLIRFWKTSKKETPKS 212 V SDAE LTEE++D VL ++ K+ +P++ Sbjct: 182 VFSDAENLTEERVDEVLSQYLNDYKEGSPET 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19775 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44263 59 9e-12 >Cs44263 Length = 324 Score = 59.3 bits (142), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 25/54 (46%), Positives = 38/54 (70%) Query: 10 IHMVQHLIEKCLIYHMTKEECMEALSKHANIQPVITSTVWNELEKVNKEFFEAY 63 I +VQ+LIE+CL +M ++E +E L A I+P T VW +LE+ N++FF+AY Sbjct: 14 IQLVQNLIERCLQLYMNQKEVVETLLAQAKIEPGFTELVWQKLEEENQDFFKAY 67 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14225 (170 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46148 83 2e-18 >Cs46148 Length = 148 Score = 82.8 bits (203), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 14/132 (10%) Query: 24 PVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNAIMSFPEDYPCNPPIVRFTSEMWH 83 P SAG V ED +F W TI+GPPD+ Y GG F + FP DYP PP V F ++++H Sbjct: 17 PPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFH 75 Query: 84 PNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTVEXXXXXXXXXXXXPNDESPANVD 143 PN+ ++G +C+ IL E+W+P T+ PN + P + Sbjct: 76 PNINSNGSICLDILK-------------EQWSPALTISKVLLSICSLLTDPNPDDPLVPE 122 Query: 144 AAKQWRESRDEF 155 A ++ + ++ Sbjct: 123 IAHMYKSDKAKY 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26655 (223 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6613 142 3e-36 >Cs6613 Length = 344 Score = 142 bits (358), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 65/86 (75%), Positives = 79/86 (91%) Query: 138 MQDRETGESKGYAFIGFKTKEVAQKAIEELHSKVFKGKTLRCSLSETKYRLFIGNVPKIW 197 M+D+E+GESKG+AF+ F++KE A+KAI+ELHSK KGKT+RCSLSETK RLFIGNVPK W Sbjct: 1 MKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNW 60 Query: 198 TEDEFRKVIDEVGPGIEHVELIKDPQ 223 TEDEFRKVI++VGPG+E +ELIKDPQ Sbjct: 61 TEDEFRKVIEDVGPGVETIELIKDPQ 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50701423 (54 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16686 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs51829 86 5e-19 >Cs51829 Length = 262 Score = 85.9 bits (211), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 63/104 (60%), Gaps = 6/104 (5%) Query: 178 MNSLVRVSAIISNAPYILNVDCDHYINNSKALREAMCFMMDPQSGKKICYVQFPQRFDGI 237 MN L RVS +++NAP++LNVDCD Y NN + + +AMC + ++ + ++Q PQ F Sbjct: 1 MNVLTRVSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYF--- 57 Query: 238 DLHDRYSNRNVVFFDINMKGLDGIQGPIYVGTGCVFRRQALYGF 281 +DR N ++ I KG+ GIQGP Y GTG RR +YG Sbjct: 58 --YDRPENLCILNEYIG-KGIVGIQGPFYQGTGTFHRRDVVYGL 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2867 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283176 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775772 (56 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10173 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76629 65 7e-13 >Cs76629 Length = 283 Score = 64.7 bits (156), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 53/154 (34%), Positives = 72/154 (46%), Gaps = 38/154 (24%) Query: 41 SALNITSPAPAQLTIFYAGSVSVFDAITAEKVRELMLIAAAAADKKTSDVKNTATSGPPS 100 S+LN +P AQ+TIFY G V F+ A+K E+M +A+ + + T+ PP Sbjct: 110 SSLNKPAPQTAQMTIFYGGQVIAFNDFPADKANEIMQLASNGSSL------SHGTAYPPM 163 Query: 101 PLVRTGSSSLQNSSAPGSPV-----VQPYPDQ----------KSSTSKLEAG-------- 137 L G +S +S P SPV V P P + S S G Sbjct: 164 QLPAQGYNSFA-ASLPKSPVESTPPVSPGPPKILTEPSCSVPPRSNSIPNFGNNLIPECA 222 Query: 138 --------FPIARRHSLQRFLEKRRDRLVSNSPY 163 PIARR+SL RFLEKR+DR+V+ +PY Sbjct: 223 QPPSRPCDLPIARRNSLHRFLEKRKDRIVARAPY 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1609 (111 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30601 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs57118 418 e-119 >Cs57118 Length = 242 Score = 418 bits (1075), Expect = e-119, Method: Compositional matrix adjust. Identities = 198/242 (81%), Positives = 218/242 (90%) Query: 33 MHELDIKPNVVTFSAILNACSRCNSFDDASMLLEELRLFDNQVYGVAHGLLMGYRDNVWV 92 MH+L IKPNVVTFSAILNACSRCNSF+DASMLLEELRLFDNQVYGVAHGLLMGYRDN+WV Sbjct: 1 MHKLKIKPNVVTFSAILNACSRCNSFEDASMLLEELRLFDNQVYGVAHGLLMGYRDNIWV 60 Query: 93 KAQSLFDEVKQMDSSTASAFYNALTDMLWHFGQKQGAQLVVLEGKRRNVWESVWSDSCLD 152 +A SLFDEVK MDSSTASAFYNALTDMLWHFGQK+GAQLVVLEGKRR VWE+VWS+SCLD Sbjct: 61 QALSLFDEVKLMDSSTASAFYNALTDMLWHFGQKRGAQLVVLEGKRRQVWENVWSESCLD 120 Query: 153 LHLMSPGAARAMVHAWLLNIRTIVFKGQQLPNLLSILTGWGKHSKVVGDSTLRRAIEALL 212 LHLMS GAARAMVHAWLLNI +IVF+G +LP LLSILTGWGKHSKVVGD LRRA+E LL Sbjct: 121 LHLMSSGAARAMVHAWLLNIHSIVFEGHELPKLLSILTGWGKHSKVVGDGALRRAVEVLL 180 Query: 213 TSMGAPFHIAKCNLGRFISTGSVAAAWLKESGTLEVLVLHDDRTYPKGAHLDQISNFQAL 272 T MGAPF +A CNLGRFISTG + A+WL+ESGTL+VLVLHDDRT+ + A D++ N Q L Sbjct: 181 TGMGAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTL 240 Query: 273 AL 274 L Sbjct: 241 TL 242 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19591 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13112 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70351 259 3e-71 >Cs70351 Length = 142 Score = 259 bits (662), Expect = 3e-71, Method: Compositional matrix adjust. Identities = 128/141 (90%), Positives = 131/141 (92%), Gaps = 1/141 (0%) Query: 160 MAPGALVGSGLLDPVHKLASGGCDNTVKVWKLYNGIWKMDCFPALQMHSDWVRDVAWAPN 219 MAPGALVG GLLDPV KLAS GCDNTVKVWK+YNGIWKMDCFPALQMHSDWVR VAWAPN Sbjct: 1 MAPGALVGLGLLDPVQKLASCGCDNTVKVWKMYNGIWKMDCFPALQMHSDWVRSVAWAPN 60 Query: 220 LGLPKSTIASASQDGTVVIWIVAKEGEQWEGKVLKDFKTPVWRVSWSLTGNLLAVADGDN 279 LGLPKSTIASASQDGTVVIW AKEGEQWEG+VLKDFKTPVW VSWSLTGNLLAVAD N Sbjct: 61 LGLPKSTIASASQDGTVVIWTCAKEGEQWEGRVLKDFKTPVWSVSWSLTGNLLAVADA-N 119 Query: 280 NVTLWKESVDGEWQQVSTVEP 300 NVTLWKE+VDGEWQQVS VEP Sbjct: 120 NVTLWKEAVDGEWQQVSVVEP 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26179 (200 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226745693 (195 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280866 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6152 (382 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25947 127 2e-31 >Cs25947 Length = 258 Score = 127 bits (319), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 82/238 (34%), Positives = 126/238 (52%), Gaps = 17/238 (7%) Query: 25 PYSKPPFSLGEVKKAIPPHCFQRSVIRSFSYVFYDLTIASILYYIASTYIQNLSQPLSFL 84 P + PPF +GE++ AIP HC+ ++ RS SYV DL + L A+ + ++ Sbjct: 25 PAAPPPFKIGEIRAAIPKHCWVKNPWRSLSYVLRDLLVVLALLAAATHFN-------TWF 77 Query: 85 AWPIFWYVQGCVLTGVWVIAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRH 144 WP++W QG + ++V+ H+CGH +FS+ L+ VG ILHS +LVPY W+ SHR H Sbjct: 78 FWPLYWVAQGTMFWAIFVLGHDCGHGSFSESPLLNSFVGHILHSSILVPYNGWRISHRTH 137 Query: 145 HSNTGSLERDEVFVPKQKFEIGWHAKYLNNPPGRFLTLLIQL-TLGWPLYLAFNVSGRPY 203 H N G++E DE +VP + ++K + R L + L L +P YL + G+ Sbjct: 138 HQNHGNVEHDESWVPMPE---KIYSKL--DSSTRILRFSLPLPMLAYPAYLWYRSPGKD- 191 Query: 204 KGFACHFHPYGPIYSDRERLQIFVSDAGVLAVFYGLYRLAVAKGLAWVICFYGGPLMV 261 HF+PY ++S ER + +S A +F L L+ G + YG P +V Sbjct: 192 ---GSHFNPYSSLFSPGERKAVVISTACWTFMFGLLVYLSFVFGPITMFKLYGVPYLV 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4343 (182 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29071 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs45360 216 2e-58 >Cs45360 Length = 378 Score = 216 bits (549), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 103/146 (70%), Positives = 120/146 (82%), Gaps = 3/146 (2%) Query: 49 AGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFLKYRWQPFSCALPRF 108 GKCN F+G WVYDAS P YS CPFVDP+FDC KYGRPD +LKYRWQPFSC++PRF Sbjct: 60 GGKCNIFQGKWVYDASY--PLYSH-CPFVDPEFDCQKYGRPDDIYLKYRWQPFSCSIPRF 116 Query: 109 NGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKKDGLASVTFQDYGV 168 NGLYFLEK+RGKKIMFVGDSLS NQW SL CM+H+WVP ++ S V+ L+S+TFQ++G+ Sbjct: 117 NGLYFLEKFRGKKIMFVGDSLSLNQWQSLACMIHSWVPKTKYSVVRTAVLSSITFQEFGL 176 Query: 169 QILLYRTPYLVDLVNEKVGRVLKLDS 194 QILLYRT YLVDLV E G VL+LDS Sbjct: 177 QILLYRTTYLVDLVREPAGTVLRLDS 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3227 (191 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4687 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16217 (330 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11970 239 2e-65 >Cs11970 Length = 151 Score = 239 bits (611), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 1/141 (0%) Query: 190 YGFSPADTNLVLPEFEKCGVILKHVPGPRDANWMHILYQSYSDAQKALSKNGMQINGALI 249 + F PADTNLVL EFEKCGVILKHVPGPRDANWMHILYQ+ SDAQKALSKNGMQING LI Sbjct: 12 FRFPPADTNLVLREFEKCGVILKHVPGPRDANWMHILYQNRSDAQKALSKNGMQINGVLI 71 Query: 250 IGVKPLDPMQRHALNERVNNQGFMTFPPQPSMKHAEVNASRAPPHPYYLQNGNTSTQKSG 309 +GVKPLDPMQR ALNER+N+QGFMT PP PS + +E+N+ RA PYYLQNGNTST +SG Sbjct: 72 VGVKPLDPMQRQALNERINSQGFMTLPP-PSSRTSELNSFRASSRPYYLQNGNTSTGQSG 130 Query: 310 GAIASPAKSLVSKVMDLMFGM 330 GAIASPAKS+VSK+MDLMFG+ Sbjct: 131 GAIASPAKSMVSKIMDLMFGI 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9508 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7629 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922754 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13333 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24583 (259 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27584 (348 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs80727 77 3e-16 >Cs80727 Length = 341 Score = 77.0 bits (188), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 78/302 (25%), Positives = 128/302 (42%), Gaps = 33/302 (10%) Query: 74 DDSLPM----------KTIAGGSVANTIRGLSAGFGV--SCGIIGACGDDEQGQLFVSNM 121 D LPM + IAGG+ N+I+ + + IG G D+ G+ N Sbjct: 41 DKHLPMYDELASKETVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNS 100 Query: 122 SSHAVNLSRLRMKKGPTAQC-VCLVDALGNRTMRPCLSSAVKLQSQADDLTRADF----K 176 ++ VN+ + PT C VC+V G R++ LS+A +S+ L R + + Sbjct: 101 TAAGVNVKYYEDESAPTGTCAVCVVG--GERSLVANLSAANCYKSE--HLKRPEIWSIVE 156 Query: 177 GSKWLLLR--YGIINLEVIQAAISIAKQEGLFVSLDLASFEMVRNFRSPLLQLLESGDID 234 +K+ + + ++ E IQ A + ++L++ + FR P + L +D Sbjct: 157 KAKYYYIAGFFLTVSPESIQMVAEHAAAKNKVFMMNLSAPFICEFFREPQEKALPY--MD 214 Query: 235 LCFANEDEATELLRGSEGEQKADPDVALEFL------AKHCRWAVVTLGSNGCIAKHGKE 288 F NE EA + E ++AL+ H R V+T G++ + + Sbjct: 215 YVFGNETEARTFAKVHGWETDNVEEIALKISQWPKASGTHKRITVITQGADPVVVAEDGK 274 Query: 289 IVRVPAI--GKANAVDATGAGDLFASGFLYGLVKGLSLEECCKVGSCSGGSVIRSLGGEV 346 + P I K VD GAGD F GFL LV+ +E+C + G + VI+ G Sbjct: 275 VKLFPVILLPKEKLVDTNGAGDAFVGGFLSQLVQEKPVEDCVRTGCYAANVVIQRSGCTY 334 Query: 347 TP 348 P Sbjct: 335 PP 336 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17640 (84 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91014122 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs32845 157 4e-41 >Cs32845 Length = 185 Score = 157 bits (397), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 80/118 (67%), Positives = 96/118 (81%), Gaps = 4/118 (3%) Query: 1 IQDYI-KSGKNVLLEFYAPWCGHCKKLAPILDEVAASYEKDSEVVIAKFDATANDVPSD- 58 +QD + SGKNVLLEFYAPWCGHCKKLAPILDEVA SY+ D++VVIAKFDATAND+P D Sbjct: 70 LQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDT 129 Query: 59 FDVKYYPTLYFKTGSGKVLSYDEEDRTKEAITAFIEKNRDKIEKQAESEKQESGKDEL 116 F+V+ YPT++F++ SGK + Y E DRTKE I FIE NRDK + E+ K+ESGKDEL Sbjct: 130 FEVQGYPTVFFRSASGKTVPY-EGDRTKEDIVDFIENNRDKAAPK-ETVKEESGKDEL 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6300 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs44596 202 1e-54 >Cs44596 Length = 224 Score = 202 bits (515), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 93/184 (50%), Positives = 130/184 (70%), Gaps = 1/184 (0%) Query: 6 IWVFGYGSLIWKAGFNYDERLVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEVC 65 WVFGYGSL+W GF YDE+++GFIK YRRVF DHRGTP++P RT TLE ++ +C Sbjct: 3 FWVFGYGSLVWNPGFEYDEKILGFIKDYRRVFDLACIDHRGTPQHPARTCTLEKSQETIC 62 Query: 66 WGVAYKI-SNKEDQEVAITYLEVREKQYDKKAYLDFFTDPMATTAAVSGVMVYIASPDKK 124 WGVAY + E + +A+ YLE RE +YD K +DF+ + + A++GV+V+ ++PDK Sbjct: 63 WGVAYCVRGGPEKERLAMEYLERRECEYDSKTLVDFYREGEPSQPALTGVIVFTSTPDKV 122 Query: 125 HNVNYLGPASTEEISKQIVQAEGPSGPNRDYLFRLEEALLQLGCKDRHVLDLANEVRRIL 184 N YLGPA EE+++QI A GP G NRDYLF+LE+A+ +G +D ++++LANEVR+ L Sbjct: 123 SNKYYLGPAPLEEMARQIATAVGPCGNNRDYLFKLEKAMFDIGHEDDYIIELANEVRKEL 182 Query: 185 SERE 188 E Sbjct: 183 GTAE 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25573 (308 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4740 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19697 (310 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 111 9e-27 >Cs47542 Length = 355 Score = 111 bits (278), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 81/316 (25%), Positives = 144/316 (45%), Gaps = 30/316 (9%) Query: 15 SQVTTIDVSQLHQDSHTRSVLVKSIHHACQEMGFFQVINHGISKTVTENALGSLSNFFDL 74 SQ+ ID+ L + S L K + AC+E GFFQ++NHG+S E + FF+L Sbjct: 45 SQIPVIDMQSLLSEESMDSELAK-LDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNL 103 Query: 75 PMDQKKLFL---SDDISKPVRFVTNSRDSIKLYANPIENWID---------------LWP 116 M++KK + D FV + + +W D L+P Sbjct: 104 SMEEKKKYWQHPGDVEGFGQAFVVSEEQKL--------DWADIFSMITLPVHLRKPHLFP 155 Query: 117 HNPTEFRESLGRYAAEVKRLSIDILGAIVESLGLSPTYLRSSLGQGMQMIVGSRYPRCXX 176 P R++L Y+ E+K L+++++ + + L + LR G Q + + YP C Sbjct: 156 KLPPLLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFENGFQSMRMNYYPPCPQ 215 Query: 177 XXXXXXXXXXXXXXXXXXXLESTSGVEIMDFTDNSAWKSVPATDGTLKVLVGNHLEILSN 236 L+ + VE + ++ W + V +G+ LEI++N Sbjct: 216 PEKVMGLTPHSDGSALTILLQ-INEVEGLQIKNDGKWIPITPLPNAFIVNIGDTLEIITN 274 Query: 237 GLYKSVFHRVVPNPERNRVSIGSFLSLPMEEIMEPAMELIDEQHPKRYKASSLDEYIKLL 296 G Y+S+ HR + N + R+SI +F + ++ + PA LI E+ P ++ +++EY + Sbjct: 275 GTYRSIEHRAIVNSLQERLSIATFYTKRLDGEIYPASSLISEKTPALFRRVTVEEYFRNR 334 Query: 297 SSKE--EKSYIESLKI 310 ++E KS ++ L+I Sbjct: 335 YARELRGKSQLDDLRI 350 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14832 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26684 (446 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66689 151 2e-38 >Cs66689 Length = 145 Score = 151 bits (381), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 79/166 (47%), Positives = 95/166 (57%), Gaps = 24/166 (14%) Query: 283 MKEFDDNIPARAFDNFQFVNFTEIMAKNMDRSRKEAEFALAALMEIPSQYKATLELNILG 342 M++FDD IPAR FDNFQFVNFT IM+KN S KE FALAALMEIP QYKA +EL I+G Sbjct: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 Query: 343 ATRGKATDRIPLPPPHYGXXXXXXXXXXXXXXXXXXXXXXQRDEFVSTASPTGS--ASDN 400 T G+A P PPP R GS ++ Sbjct: 61 RTTGRAKKIAPRPPP----------------------APYSRRALPERQPSRGSTPVAET 98 Query: 401 HACPICLTDPKNMAFGCGHQTCCDCGQDLDLCPICRTSIHTRIKLY 446 ACPICLT+ K++AFGCGH TC +CG + CPICR I R++L+ Sbjct: 99 QACPICLTNAKDLAFGCGHMTCRECGSRVSNCPICRQRITNRLRLF 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27736 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11692 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48404361 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28502 (246 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26404 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13487 (663 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12632 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15312 (461 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12391 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27225 (424 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10583 (90 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28787 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28707 (375 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs28459 146 3e-37 >Cs28459 Length = 237 Score = 146 bits (369), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 75/120 (62%), Positives = 89/120 (74%), Gaps = 3/120 (2%) Query: 258 LIRGKNFLMLMDSCLEGHFSNDDGTELVKLASRCLQYEPRERPNAKSLVTALIPLQKETE 317 +IRGKN L LMDS LEG+FS+++ T + LASRCLQYEPRERPN K LV+ L PLQ + Sbjct: 1 MIRGKNILHLMDSHLEGNFSSEEATVVFDLASRCLQYEPRERPNTKDLVSTLAPLQNRPD 60 Query: 318 VPSYVLLGIAHGNTL--LNQTSLSPLGEACSRLDLTAIHEILEKLGYKDDEGVTNDLSFQ 375 VPSYV+LGI Q LSP+G+ACSR+DLTAIH+IL YKDDEG TN+LSFQ Sbjct: 61 VPSYVMLGIPRHEEAPPTPQHPLSPMGDACSRMDLTAIHQILVMTHYKDDEG-TNELSFQ 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56163217 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22842 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28371 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33140 109 3e-26 >Cs33140 Length = 153 Score = 109 bits (272), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 4/152 (2%) Query: 4 NENLPPNVIKQLAKELKSLDESPPEGIQVGLNDDDFSIIYADIEGPAGTPYENGVFHMKL 63 N NLP +IK E + L P GI ++D+ I GP +PYE GVF ++L Sbjct: 3 NSNLPRRIIK----ETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLEL 58 Query: 64 LLSRDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPF 123 L ++P + PK FLTKI+HPNI G IC++ LK W+P+L +R VL+ ++ LL P Sbjct: 59 FLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPN 118 Query: 124 PESALNEQAGKMLLENYEEYARHARLYTGIHA 155 P+ L+E K N E A+ +T ++A Sbjct: 119 PDDPLSENIAKHWKTNEAEAVETAKEWTRLYA 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18624 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1906 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8012 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81139 128 4e-32 >Cs81139 Length = 104 Score = 128 bits (322), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 53/81 (65%), Positives = 69/81 (85%) Query: 130 KILDSPGLGSKHAKVASCGARHSVILTEDGQLFSWGWNKYGQLGLGDAVDRNIPSQVSIE 189 ++LD+P L + H+K SCGARH+ ++ +DG++F WGWNKYGQLGLGD +DRNIPSQV+IE Sbjct: 23 RLLDAPSLENVHSKSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQVTIE 82 Query: 190 GCLLKNIACGWWHTLLLAERP 210 GC+ +N+ACGWWHTLLLA P Sbjct: 83 GCVPRNVACGWWHTLLLAVPP 103 Score = 62.4 bits (150), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Query: 35 KEIACGGRHSAVITDAGALLTFGWGLYGQCGQGNTIDQLRPSYVKSLSETKVKNIAAGLW 94 K ++CG RH+AVI D G + +GW YGQ G G+ ID+ PS V ++ +N+A G W Sbjct: 36 KSVSCGARHTAVIADDGKVFCWGWNKYGQLGLGDVIDRNIPSQV-TIEGCVPRNVACGWW 94 Query: 95 HTLCVSV 101 HTL ++V Sbjct: 95 HTLLLAV 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3749 (131 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13481 (300 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25734 (346 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26993 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30488 139 2e-35 >Cs30488 Length = 99 Score = 139 bits (350), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 66/81 (81%), Positives = 76/81 (93%) Query: 9 RVGKYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLI 68 RVGKYE+GRT+GEG+FAKVKFARN+ETGE VA+KILDKEKVLKHKM QIKREI TMKLI Sbjct: 12 RVGKYELGRTLGEGSFAKVKFARNTETGENVAIKILDKEKVLKHKMIGQIKREISTMKLI 71 Query: 69 KHPNVVQLYEVMGSKTKIFIV 89 +HPNV+++YEVM SKTKI+IV Sbjct: 72 RHPNVIRMYEVMASKTKIYIV 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22982 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20455 (117 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14522 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040172 (141 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12845 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 77 2e-16 >Cs169106187 Length = 148 Score = 76.6 bits (187), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%) Query: 8 KRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPFK 67 KR+ KE + L K+P + A P D+ W + G +P+AGG + I FPP+YPFK Sbjct: 4 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFK 63 Query: 68 PPGISMTT----PNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP 120 PP ++ T PN + ICL D E W+P ++S +L + S + D +P Sbjct: 64 PPKVAFRTKVFHPN--INSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30489 (199 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16733 (229 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11285 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763976 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430896 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26529 (148 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs169106187 290 5e-81 >Cs169106187 Length = 148 Score = 290 bits (742), Expect = 5e-81, Method: Compositional matrix adjust. Identities = 136/148 (91%), Positives = 144/148 (97%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPGDSPFSGGVFLVSIHFPPDY 60 MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP DSP++GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYEATARSWTQKYAMG 148 PEIAHMYK+D+ KYE+TARSWTQKYAMG Sbjct: 121 PEIAHMYKSDKAKYESTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12264 (261 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21069 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12750 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12600 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6851 (169 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13659 (521 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23286 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768534 (94 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26661 (146 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65106187 82 2e-18 >Cs65106187 Length = 201 Score = 82.0 bits (201), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/85 (45%), Positives = 59/85 (69%) Query: 32 LKRRVWIEIKKMWLVAGPAIFTRVASFGTNVVSQAFIGHIGSLELAAFSLVFTVLVRFGN 91 +K+ WIE+K ++ +A PAI + + + +Q F GH+G+LELAA SL T + F Sbjct: 46 IKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAY 105 Query: 92 GILLGMASALETLCGQSHGAKQYNM 116 G++LGM SA ETLCGQ++GA++Y+M Sbjct: 106 GLMLGMGSATETLCGQAYGAQKYDM 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28295 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs52138 114 5e-28 >Cs52138 Length = 120 Score = 114 bits (285), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 65/110 (59%), Positives = 75/110 (68%), Gaps = 20/110 (18%) Query: 1 MSGANMDEVKEQEVADSTPMXXXXXXXXXXXQKASNENHGNPMPSAQQEEAAIKKKYGGI 60 MSG +EVK+QE+ D + E +PS+++EEAA+KKKYGGI Sbjct: 1 MSG--TEEVKDQEMVDGN----------------APEESQKTIPSSEEEEAALKKKYGGI 42 Query: 61 LPKKTPLISKDHERAYFDSADWALGKQGA--KPKGPLEALRPKLQPTPHQ 108 +PKK PLISKDHERAYFDSADWALGKQ KPKGPLEALRPKLQPT Q Sbjct: 43 VPKKPPLISKDHERAYFDSADWALGKQQGVEKPKGPLEALRPKLQPTQQQ 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17149 (123 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30271 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31982 (239 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11570 (633 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2190 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28687 (433 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17496 (197 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28727 (154 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17836 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011528 (161 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25115 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775946 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5398 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs43783 306 9e-86 >Cs43783 Length = 180 Score = 306 bits (784), Expect = 9e-86, Method: Compositional matrix adjust. Identities = 151/177 (85%), Positives = 159/177 (89%) Query: 1 MEKGKGVMGAGRRWAVDLTDNSTSPSSRDFPDPPGFSRASLEQDDSTVSRQKKDAESTWK 60 MEKGKGVMG+GRRWAVD TDNST+PS+RD DPPGFSRAS +QDDST+SRQKKDAE+ WK Sbjct: 1 MEKGKGVMGSGRRWAVDFTDNSTTPSTRDIADPPGFSRASQDQDDSTLSRQKKDAEANWK 60 Query: 61 AQKAWEVAQAPVKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD 120 +QKAWEVAQAP KNL AGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD Sbjct: 61 SQKAWEVAQAPFKNLMMMGFMMWMAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKD 120 Query: 121 GKVDLIAPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPAQEVEYSGGGI 177 KVDL+ PKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPA EVEYSGGGI Sbjct: 121 SKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGI 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig743 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6223 (295 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28758 (73 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28013 (107 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7367 (571 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16913 (54 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2376 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1188 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6233 (164 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9226 223 1e-60 >Cs9226 Length = 217 Score = 223 bits (567), Expect = 1e-60, Method: Compositional matrix adjust. Identities = 113/164 (68%), Positives = 126/164 (76%), Gaps = 4/164 (2%) Query: 1 MRWWAFTGLTDLILEGYFAIAPEFYKDKTAWYPAEVWKEYSKGDSRYAARDAGVVAVEGL 60 M WWAFTGLT +ILEGYFA +PEFYKDK+ +Y AEVWKEYSKGDSRYAARDAGVVAVEG+ Sbjct: 58 MCWWAFTGLTHIILEGYFAFSPEFYKDKSGFYLAEVWKEYSKGDSRYAARDAGVVAVEGI 117 Query: 61 TAVIEGPASLLAVYAISKGKSYSYILQFAISLGQLYGTAVYFITAYLDGDQFXXXXXXXX 120 TAV+EGPASLL+VYAI+ GKSYSYILQFAISLGQLYGTAVYF+T+YL+GD F Sbjct: 118 TAVLEGPASLLSVYAIATGKSYSYILQFAISLGQLYGTAVYFMTSYLEGDNFAASPYYYN 177 Query: 121 XXXXXXXXXWVVIPTLISIRCWKKISXXXXXXXXXXXXKKNKTR 164 WVVIP+LI+IRCWKKI KKNK R Sbjct: 178 LYYIGANASWVVIPSLIAIRCWKKIC----AAPQLQGQKKNKVR 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91041825 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs53149 239 1e-65 >Cs53149 Length = 737 Score = 239 bits (610), Expect = 1e-65, Method: Compositional matrix adjust. Identities = 104/162 (64%), Positives = 133/162 (82%) Query: 31 FKPFNVSYDHRALIIDGKRRMLVSAGIHYPRATPEMWPDLIAKSKEGGADVIQTYAFWSG 90 F +VSYDH+A+II+G++R+L+S IHYPR+TPEMWPDLI K+K+GG DVIQTY FW+G Sbjct: 34 FVKASVSYDHKAVIINGQKRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYVFWNG 93 Query: 91 HEPVRGQYNFEGRYDIVKFANLVGASGLYLHLRIGPYVCAEWNFGGFPVWLRDIPGIEFR 150 HEP +G Y F+ RYD+V+F LV +GLY+HLRIGPYVCAEWN+GGFPVWL+ +PGIEFR Sbjct: 94 HEPTQGNYYFQDRYDLVRFIKLVQQAGLYVHLRIGPYVCAEWNYGGFPVWLKYVPGIEFR 153 Query: 151 TNNALFKEEMQRFVKKMVDLMQEEELLSWQGGPIIMLQIENE 192 T+N FK M +F +K+V +M+ E+L QGGPII+ QIENE Sbjct: 154 TDNGPFKAAMHKFTEKIVSMMKAEKLFQTQGGPIILSQIENE 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18919 (282 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30681 158 8e-41 >Cs30681 Length = 257 Score = 158 bits (399), Expect = 8e-41, Method: Compositional matrix adjust. Identities = 88/205 (42%), Positives = 130/205 (63%), Gaps = 8/205 (3%) Query: 58 MHNGTLKEHLYGPLTHEQSINWIKRLEIAEDAAKGIEYLHTGCVPAIIHRDLKSSNILID 117 M N ++++HL + ++ W RL+IA+DAA+G+ YLH G II RD KSSNIL+D Sbjct: 1 MPNRSVQDHLTS--RFQATLPWNTRLKIAQDAARGLAYLHEGMDFQIIFRDFKSSNILLD 58 Query: 118 KHMRAKVSDFGLSKLAV-DGASHVSSIVRGTVGYLDPEYYISQQLTDKSDVYSFGVILLE 176 + AK+SDFGL++L DG SHVS+ V GT+GY PEY + +LT KSD++SFGV L E Sbjct: 59 EQWNAKLSDFGLARLGPSDGLSHVSTAVVGTIGYAAPEYIQTGRLTYKSDIWSFGVFLYE 118 Query: 177 LISGQEAISNENFGVNCRNIVQWAKLHI-ESGDIQGIIDPSLDGEYDIQSMWKIAEKALM 235 LI+G+ + + N + + +++W + H+ ++ I+DP L+G+Y I+ K+A A Sbjct: 119 LITGRRPL-DRNRPKSEQKLLEWVRPHLTDAKKFTMILDPKLEGKYSIKLAQKLAAVANK 177 Query: 236 CVQAHGFMRPSMS---EVLKEIQDA 257 C+ RP MS EVL +I DA Sbjct: 178 CLARQAKGRPKMSEVVEVLNKIVDA 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768527 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25470 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30395 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs79560 403 e-114 >Cs79560 Length = 319 Score = 403 bits (1035), Expect = e-114, Method: Compositional matrix adjust. Identities = 187/276 (67%), Positives = 226/276 (81%), Gaps = 5/276 (1%) Query: 4 DLLDTVDKMTKDHYKKTMEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEI 63 + +DTV+++TK HY+K MEQRFKE+VA++ L+ +Q+E++D+DWESTF++RHLP S I+E+ Sbjct: 44 EFMDTVERLTKAHYRKCMEQRFKELVASRALEGIQTEVNDMDWESTFYVRHLPQSTINEV 103 Query: 64 PDLEEEYRKTMKEFAVXXXXXXXXXXXXXXXXXXXXXGYLKKVFYGSKGPNFGTKVSNYP 123 PDL+EEYRK MKEFA+ GYLKKVF+G+ GP FGTKVSNYP Sbjct: 104 PDLDEEYRKVMKEFALKLEKLAEELLDLLCENLGLEKGYLKKVFHGANGPTFGTKVSNYP 163 Query: 124 PCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLKDGEWVDVPPMHHSIVINLGDQIEV 183 PCPKPDLIKGLRAH+DAGGIILLFQDDKVSGLQLLKDG+W+DVPP+ HSIV+NLGDQIEV Sbjct: 164 PCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEV 223 Query: 184 ITNGKYKSVMHRVIAQSDGT-RMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFVFD 242 ITNGKYKSV HRV++Q+DG RMS+ASFYNPG+D+ I PAPA+LEK+ E YPKFVF+ Sbjct: 224 ITNGKYKSVEHRVVSQTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKKQVYPKFVFE 283 Query: 243 DYMKLYSGLKFQAKEPRFEAMKAKEST----PVATA 274 DYMKLY LKFQAKEPRFEAMKA E+ P+ATA Sbjct: 284 DYMKLYVPLKFQAKEPRFEAMKAVETNVNLGPIATA 319 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31678 (529 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs99051 724 0.0 >Cs99051 Length = 533 Score = 724 bits (1869), Expect = 0.0, Method: Compositional matrix adjust. Identities = 358/528 (67%), Positives = 401/528 (75%), Gaps = 1/528 (0%) Query: 2 DNHPISEDPKTPLLPLHDQIQRSQSFHSSLKSILTLKNFFVLLGPLLCTIICLCVKLDGP 61 + HP S D K PLLP H QIQRS S H +LK+I T NF++LLGPLLC +IC+CVKLDG Sbjct: 6 EAHPNSGDIKAPLLPSHRQIQRSPSSHFTLKTIFTPNNFYILLGPLLCAVICVCVKLDGQ 65 Query: 62 VASRNMLAVLVWVFAWWLTEAVPMPITSMSPLFLFPLFGIASADDVAHSYMDDVIALLLG 121 SRNML VL WVFAWWLTEAVPMPITSM+PLFLFPLFGI+SAD VAHSYMDDVIAL+LG Sbjct: 66 ATSRNMLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLG 125 Query: 122 SFILALAVEHYNIHRRLALNITLVFCGDXXXXXXXXXGICGTAAFISMWMHNVATAVMMM 181 SFILALAVEHYNIH+RLALNIT++FCG+ GICGT AF+SMWMHNVA AV+MM Sbjct: 126 SFILALAVEHYNIHKRLALNITILFCGEPMNPPLLLLGICGTTAFVSMWMHNVAAAVIMM 185 Query: 182 PVATGILRRFPTGPDQSVVASNFCKAVILGMLYSITIGGMSTLTGTGVNLILVGMWKSYF 241 PVATGIL+ P P QS + +CKAV+LG++YS +GGMSTLTGTGVNLILVGMWK+YF Sbjct: 186 PVATGILQNLPEVPLQSTLVRKYCKAVVLGVIYSAAVGGMSTLTGTGVNLILVGMWKTYF 245 Query: 242 PQAAPITFSTWFCFAFPSXXXXXXXXXXXXXXXYCSRSSGQALSVYLDKAHLKKELELLG 301 P+A PI+FSTWFCF FP YC R SG ALS YLDKA+LK+EL++LG Sbjct: 246 PEANPISFSTWFCFGFPLALVIFVALWAILCLFYCPRGSGPALSEYLDKANLKRELDMLG 305 Query: 302 PMAFAEKMVLALFSMLIVLWMTRSITEDIPGWGVLFNGRAGDGTVSVMVATFLFIFPSKK 361 PMAFAEKMVLA+F MLI LWMTRSIT+DIPGWG LFN RAGDGT SV++AT LFI PS K Sbjct: 306 PMAFAEKMVLAVFGMLIALWMTRSITDDIPGWGALFNDRAGDGTASVVMATLLFIIPSMK 365 Query: 362 EKGEKLMDWEKCKKLPWNXXXXXXXXXXXXXXVRSSGLANILSETLDFLEAVPYVAIAPA 421 +KGEKLMDW KCKKLPWN VR+SGLA+ LS+ LDFLEA PY+AIAP Sbjct: 366 QKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPI 425 Query: 422 VCXXXXXXXXXXXXNNAXXXXXXXXXXQIARNMHVHPLLLMIPGGIGAQFAFLLPTATPS 481 VC NNA QIA+ MHVHPLLLM+PG IGAQF+FLLPT TPS Sbjct: 426 VC-LISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPS 484 Query: 482 NTVGFATGRIEIQDMIKIGLPLKIVGIAVLSLLMPTLGAYVFKTSEPV 529 N VGF TG IEIQDMIK GLPLKI GIA L+ LMPTLGAYVF T V Sbjct: 485 NIVGFTTGHIEIQDMIKTGLPLKIAGIAALAFLMPTLGAYVFGTDGDV 532 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7066 (217 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27492 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9195 331 3e-93 >Cs9195 Length = 211 Score = 331 bits (849), Expect = 3e-93, Method: Compositional matrix adjust. Identities = 154/200 (77%), Positives = 175/200 (87%) Query: 3 DERPLRKIAEAFKELEAAVNSPAADVEVAPFSHACSLVSPLFGCLGIAFKFAEMDYVAKV 62 +++PL KI+E+FKEL A VNS AADVE+A FS ACS VSPLFGCLGIAFKFAEMDYV KV Sbjct: 6 NDKPLTKISESFKELAATVNSQAADVELAAFSRACSYVSPLFGCLGIAFKFAEMDYVTKV 65 Query: 63 HDLSEASDSISTLQVLLDRDIEADCVRKAGSHSRNLLRVKRGIDMVRVLFEQIIVTKGNS 122 DL+EAS SI TLQ ++DRDIE +CVRKAGSH+RNLLRVKRG+DMVRVLFEQI+ +GNS Sbjct: 66 DDLAEASKSILTLQSVIDRDIEGNCVRKAGSHTRNLLRVKRGLDMVRVLFEQILAAEGNS 125 Query: 123 LKDPASKAYAQVFAPHHGWVIRKAVAAGMYALPTREQLMNKLNEDDNSAKVQMQSYIAAS 182 LKDPASKAY QVFAPHHGW IRKAVAAGMYALPTR QL+ KLNED+ SA++QMQ YI S Sbjct: 126 LKDPASKAYTQVFAPHHGWAIRKAVAAGMYALPTRAQLLRKLNEDETSARIQMQDYITTS 185 Query: 183 APLSLYIDKLFHSRKLGVDW 202 AP+ LYIDKLF SR+LG+DW Sbjct: 186 APVILYIDKLFLSRELGIDW 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752822 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9739 89 1e-20 >Cs9739 Length = 198 Score = 89.4 bits (220), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 53/122 (43%), Positives = 77/122 (63%), Gaps = 15/122 (12%) Query: 2 NSVAVELLKQVGKYGQRKQPWKGFESEKSSGNRSNDQTGDEEYHTVSVKHNDARTIDEED 61 N + V+LLK++G YGQR+Q W+G + EK++ R++D G+EE+ + +++D T DEE+ Sbjct: 66 NGLRVKLLKRMGNYGQRRQAWRGSDYEKNNSGRTSDPAGNEEHQNSNDRYDD--TPDEEE 123 Query: 62 GERVPKEKTGHRGRNRGQSGRQKYLGT--------NGFGHGTTTANHGIEPWKPPPGPRM 113 GE + K +N GQ GR + NG GHGTT++ H +EP KPPPGPRM Sbjct: 124 GEHLSNSKE----KNDGQKGRNRGRSRRQRYRGGPNGLGHGTTSS-HALEPTKPPPGPRM 178 Query: 114 PD 115 PD Sbjct: 179 PD 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31491 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31834 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs32325 92 5e-21 >Cs32325 Length = 165 Score = 91.7 bits (226), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 51/137 (37%), Positives = 84/137 (61%), Gaps = 3/137 (2%) Query: 3 PKIADFGLARIFTHTELEANTSRIVGTLGYMPPETIE-GRVSVKTDVYSFGVLILEIIRG 61 P + DFGLAR T + ++I+GTLGY+ PE E G VS++TDVY+FG+++L+++ G Sbjct: 14 PMLGDFGLAR--WKTTDDPVQTKILGTLGYLAPEYAENGIVSIRTDVYAFGIILLQLMSG 71 Query: 62 RKINRLCNDDGLLNLVGYAWELWKKNAALELKDPTLGDSCNGNQLLRCIHISLLCVEENA 121 RK+ + ++ +L +A L +K A EL DP + +S + +L + LCV+ N Sbjct: 72 RKVVDMNGEEPQQSLRQWAEPLIEKLALHELIDPRIENSYDTYELYLMAKTAYLCVQRNP 131 Query: 122 ADRPTMSDVISMLTNES 138 RP+M +V+ +L E+ Sbjct: 132 EGRPSMGEVVRLLEGEN 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8613 (612 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 119 7e-29 >Cs68010 Length = 146 Score = 119 bits (299), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 65/150 (43%), Positives = 89/150 (59%), Gaps = 8/150 (5%) Query: 462 MKANLGSFAGAL--KNKDVWVMNVVPEDGPNTLKIIYDRGLIGSVHNWCEAYSTYPRTYD 519 M A+ F AL K K VWVMNVVP G N L +I DRG +G +H+WCEA+ TYPRTYD Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVPTIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTYD 60 Query: 520 LLHAWTVFS--DIERKECSGVDLLIEMDRILRPKGFIIVRDKRKVVEFINKYMKALHWEA 577 L+HA + S R CS +D+ E+DRILRP+G++I+RD +++E L W+A Sbjct: 61 LVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWDA 120 Query: 578 VATADAEGGSELDDDVVFIIQKKIWRTSES 607 + E S D+ + I QK ++ S Sbjct: 121 -RVIEIESNS---DERLLICQKPFFKRQAS 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3830 (92 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32140 (294 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91020211 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25516 (301 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22624 (280 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6613 257 1e-70 >Cs6613 Length = 344 Score = 257 bits (656), Expect = 1e-70, Method: Compositional matrix adjust. Identities = 127/244 (52%), Positives = 168/244 (68%), Gaps = 5/244 (2%) Query: 1 MKKAVTDIGPGVISVELLKDPQNSSRNRGFAFIEYYNHACAEYSRQKMSTPKFKLDTNAP 60 +K + D+GPGV ++EL+KDPQN SRNRGF+F+ YYN+ACA+YSRQKM FKLD N P Sbjct: 65 FRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTP 124 Query: 61 TVSWADPKNT--ESSAASQVKAVYVKNLPKDITQDQLKDLFEHHGKITKVVLPPAKAGQE 118 T+SWADPK+T S+AASQVKA+YVKN+P + + +++K+LF+ HG++TKVV+PP K+G Sbjct: 125 TISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSG-- 182 Query: 119 KSRFGFVHFAERACAMKALKNTEKYEIDGQVLECSLAKPQSDQKSSGSSNHQKSALLPTY 178 K FGF+H+AER+ A+KA+K+TEKYEIDGQVLE LAKPQ+D+K+ G+ + L+PT+ Sbjct: 183 KRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYS-PGLVPTH 241 Query: 179 PPRLXXXXXXXXXXXXXXXXXXXXXXXXQPLIYGRXXXXXXXXXXXXXXXDGRIGYVLQQ 238 P QP+IYGR DG+IGYVLQQ Sbjct: 242 LPHAGYGGFAGTPYGSVGTGFGVAAGFQQPMIYGRGPMPSGMHMVPMVLPDGQIGYVLQQ 301 Query: 239 PGVQ 242 PGVQ Sbjct: 302 PGVQ 305 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25883 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48388896 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30236 (185 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226766586 (181 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs59910 183 1e-48 >Cs59910 Length = 135 Score = 183 bits (464), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 85/109 (77%), Positives = 98/109 (89%) Query: 73 LSSMVYDVTKFLEDHPGGDDVLVSATGKDATDDFEDVGHSDNARDMLKDFYVGEIDASTI 132 ++ VYDVTKFLEDHPGGD+VL+SATGKDATDDFEDVGHS +AR+M+ +YVGEID STI Sbjct: 27 INGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTI 86 Query: 133 PKSTTYTPPKQPHYNQDKTSEFIVKLLQFLVPIAILGLAFGVHLYTKSS 181 PK YTPPKQPHYNQDKTSEFI++LLQFLVP+AILGLA G+ +YTKSS Sbjct: 87 PKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13408 (385 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595162 (76 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31441 (441 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12295 (403 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs9266 460 e-131 >Cs9266 Length = 266 Score = 460 bits (1183), Expect = e-131, Method: Compositional matrix adjust. Identities = 219/263 (83%), Positives = 240/263 (91%) Query: 141 GEPAAIGTIFEGAAFDVVLDNNGKDLDTVRPVADWAKSSGAKQFLFISSAGIYKPTEEPP 200 G+P A+G + G FDVVLDNNGK+LD VRPVADWAKSSG KQFLFISSAGIYKP +EPP Sbjct: 4 GDPVAVGNVVGGVTFDVVLDNNGKNLDAVRPVADWAKSSGVKQFLFISSAGIYKPADEPP 63 Query: 201 HVEGDAVKADAGHVAVEKYIAEIFGSWAIFRPQYMLGSGNNKDCEEWFFDRIVRDRPVPI 260 HVEGD VK DAGHV VEKYI+E F +WA FRPQYM+GSGNNKDCEEWFFDRIVR RPVPI Sbjct: 64 HVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPI 123 Query: 261 PGSGMQLTNISHVRDLSSMLTLAVENPDAASGNIFNIVSERAVTLDGLAKLCAQAAGRPA 320 PGSGMQ TNI+HVRDLSSMLTLAVENP+AAS NIFN+VS+RAVTLDG+AKLCAQAAG P Sbjct: 124 PGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPV 183 Query: 321 NIVHYDPKAAGVDAKKAFPFRNMHFYAEPRAAKEILGWKSTTNLAEDLKERFEEYLKIGR 380 IVHYDPKAAG+DAKKAFPFRNMHFYAEPRAAK+ILGW+STTNL EDLKERFEEY+KIGR Sbjct: 184 EIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGR 243 Query: 381 DKKAIKFELDDKILESLKVPVAV 403 DKKA++FE+DDKILESLKVP+ V Sbjct: 244 DKKAMQFEIDDKILESLKVPIPV 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29128 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29772 (363 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8 (262 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs55995 91 9e-21 >Cs55995 Length = 204 Score = 91.3 bits (225), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 54/164 (32%), Positives = 92/164 (56%), Gaps = 5/164 (3%) Query: 27 HYGVSVFIISNFLSSFPFLVAVSLSTGTITYYLVKFRPEFSHYVYFCLDIYLSISVIESL 86 H G VF++ LSS PFL +S+S+ + Y+LV R EFS +YF L+ ++ + V E L Sbjct: 2 HSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGL 61 Query: 87 MMVVASLVPNFXXXXXXXXXXXXXXXXXSGFFRLLPDLPKPFWRYPISYIGYGSWALQGS 146 M+VVAS+ + +G+FR+ LP P W YPISY+ + +++++G Sbjct: 62 MLVVASIWKDVYWSILTLISIHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKGL 121 Query: 147 YKNDLIGLEFEPMTPGEPK-LTGEYIIRHIFGIPI-DHSKWWDL 188 +N+ +G F P+ G+ + ++G ++ + I +SKW +L Sbjct: 122 LENEYLGTSF-PV--GQVRTISGYQALQSAYDISSKSNSKWGNL 162 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226809872 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11638 (66 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48278324 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24234 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs57664 110 1e-26 >Cs57664 Length = 171 Score = 110 bits (274), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/176 (42%), Positives = 96/176 (54%), Gaps = 7/176 (3%) Query: 1 MLENPPSXXXXXXDPGAVVKRYAXXXXXXXXXXXXKSADRFDRTNNPHGGSDMEKSQISS 60 MLENP AVVKRYA KS DR ++N +G +D EK+Q+++ Sbjct: 1 MLENPAQAAAAADSAPAVVKRYAPPNQRNRSLNRRKSGDR---SSNLYG-NDGEKNQLAA 56 Query: 61 SRNISVMDHGDGSSSSLLNENSR-GLIALEGCCTSEAFQLLHSRWAAAMRCFNDPSVDLP 119 RN +V DHGD SS+ N NS+ L+ LEG SE QLL R A F+DPS+DL Sbjct: 57 LRNAAVTDHGDSGSSNFANVNSQPRLVPLEGFSRSEGAQLLKDRGRAIWNLFHDPSIDLS 116 Query: 120 ERPVMYTGSSSAWGPFLLPHQLMASTVGAGSP-GSPMDFLSEPCRSKNISSAGFET 174 ERPV+Y+ +S G LPHQ+ T GS G+ MDFL+E R S A F+ Sbjct: 117 ERPVLYSSGASHLG-VKLPHQMQPPTNSMGSTSGTQMDFLAELRRKMQASGASFDN 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27882 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24436 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48126970 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992020 (120 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7991 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789991 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 82 2e-18 >Cs48454 Length = 244 Score = 82.0 bits (201), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Query: 1 MMREKIQIKKIDYLPARQVTFSKRRRGIFKKAGELSVLCDSEVAIIIFSQTGKLFDFSSS 60 M R ++Q+K+I+ RQVTFSKRR G+ KKA E+SVLCD+EVA+I+FS GKLF++S+ Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 61 STKD-VIARY 69 S + ++ RY Sbjct: 61 SCMERILERY 70 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11079 (285 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20290 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32859 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761629 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30017 118 2e-29 >Cs30017 Length = 90 Score = 118 bits (295), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 55/68 (80%), Positives = 61/68 (89%) Query: 30 EVIDTSGGCGASFAIEIVSVQFEGKKLLERHRLINSCLEEEMKEIHALSIKKALTPEQWK 89 EVIDTSGGCGA F IEIVS QFEGK+LL RHRL+N+ LEEEMK+IHALSIKKA+TPEQWK Sbjct: 22 EVIDTSGGCGAKFEIEIVSEQFEGKRLLARHRLVNAALEEEMKQIHALSIKKAMTPEQWK 81 Query: 90 QQQESQVS 97 QQQES + Sbjct: 82 QQQESNAA 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55858404 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28657 (174 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18163 (236 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280500 (162 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48558 197 4e-53 >Cs48558 Length = 186 Score = 197 bits (502), Expect = 4e-53, Method: Compositional matrix adjust. Identities = 102/150 (68%), Positives = 119/150 (79%), Gaps = 4/150 (2%) Query: 13 SEEKPAEPDSMKEQVVPHVSKNERSVSPNPSPDAATIGLPREAAGQSGPFGSGGDHTVFP 72 +E++PA+ D MKEQ P + NE SVSPN S A T+G REAA QSG FG GDH+V+ Sbjct: 3 AEDQPADTDKMKEQ--PLSATNESSVSPNSSQGALTVGHTREAAVQSGSFGPVGDHSVYS 60 Query: 73 PNVYAPQAQPFYYRGYENGTGEWDEYSPYINTEGLEINSPGVYNENPSLVFHSGYGYNPQ 132 N+YAPQAQ FYYRGY+N GEWDEY Y+N EGLE+ S GVYN+NPSLV+H+GYGY+PQ Sbjct: 61 SNIYAPQAQAFYYRGYDNVPGEWDEYPSYVNAEGLELGSTGVYNDNPSLVYHTGYGYSPQ 120 Query: 133 MPYGPYSPVTTPMPSVGGDAQLYSPQQYPF 162 MPYGPYSPVTT PSVGGDA LYSPQQ+PF Sbjct: 121 MPYGPYSPVTT--PSVGGDAHLYSPQQFPF 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814092 (140 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73702 258 2e-71 >Cs73702 Length = 143 Score = 258 bits (659), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 123/140 (87%), Positives = 129/140 (92%) Query: 1 MWEDDNEGFVGCFLIKKDGSKTGQGRRGYLQEGAWDAIHVIEVGPEEEGTAHYRLTSTVM 60 MWEDDNEGFV CFLIKKDGSKT QGRR +L+EGAWDAIHVIEV PEEEG A Y LTSTVM Sbjct: 1 MWEDDNEGFVACFLIKKDGSKTAQGRRRHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVM 60 Query: 61 LSLTTDNESSGTFSLSGSIRRQMNMHLSTEEGHLCNMGRMIEEMESKLRNSLDQVYFGKT 120 LSLTTD+ESSGTFSLSGSIRRQMNM LS EGHLCNMG+MIEEME KLRNSLDQVYFGKT Sbjct: 61 LSLTTDHESSGTFSLSGSIRRQMNMDLSVSEGHLCNMGKMIEEMEGKLRNSLDQVYFGKT 120 Query: 121 KEMVCTLRPPSDVVMRLPDS 140 KEMVCTLRPPS+V+MRLPDS Sbjct: 121 KEMVCTLRPPSEVIMRLPDS 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18003 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18692 (209 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18802 (63 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746226 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29059 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28992 (832 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22855 (237 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67549 187 9e-50 >Cs67549 Length = 158 Score = 187 bits (475), Expect = 9e-50, Method: Compositional matrix adjust. Identities = 96/152 (63%), Positives = 108/152 (71%), Gaps = 4/152 (2%) Query: 80 MARSYLPGKVSEIVAIWRKDLSKVNPKAAESLADPEEYPNLFDDWQVALSVESKAAETRG 139 MARSYLP KVSEIVAIWRKDL KVNPKAAESLADPEEY NLFDDWQVAL+VESKAA TRG Sbjct: 1 MARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRG 60 Query: 140 VYPPAEEYVNHVDKAHITLVEAFRNMQLXXXXXXXXXXASHEVPXXXXXXXXXXXXXXXX 199 V+PPAE+YVNH DK+++TLVEAFR+MQ+ +HE Sbjct: 61 VHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHE----GSEQNGEENAEEQN 116 Query: 200 XXXXXXXXXVVVDADSTDGAELINGNEADEEW 231 VVVDADSTDGA L+NGNEA+E+W Sbjct: 117 GEEGSQEEPVVVDADSTDGAVLVNGNEAEEQW 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226756907 (114 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33540 103 4e-25 >Cs33540 Length = 185 Score = 103 bits (258), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 48/97 (49%), Positives = 68/97 (70%) Query: 18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPL 77 MRILMVGLD +GKTTI+ K+ + PT+GFN++TV Y+ + +WDVGGQ IR Sbjct: 17 MRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSY 76 Query: 78 WRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNED 114 WR+YF+ T GL++VVDS+D R+ + + EL +L E+ Sbjct: 77 WRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEE 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4316 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7291 (257 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18083 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs47542 162 4e-42 >Cs47542 Length = 355 Score = 162 bits (410), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 92/288 (31%), Positives = 147/288 (51%), Gaps = 22/288 (7%) Query: 1 MSAGSNSKAVEELAAKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKV 60 M + + ++++ AK+ AC+ WGFF ++NHGV S ++ + + FF L +EEKKK Sbjct: 52 MQSLLSEESMDSELAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKY 111 Query: 61 SREAHNTAGFHN----DEHSKDFKDWKEVYDFYVNDGMLMPASHEPDDPEIVPWYTPWPE 116 + + GF E K DW +++ + +P P + P P Sbjct: 112 WQHPGDVEGFGQAFVVSEEQK--LDWADIFSM-----ITLPVHLR--KPHLFPKLPPL-- 160 Query: 117 NLSKFRETCEEYGRACEKXXXXXXXXXXXXXXXPPTRLHGYFENQASFARLNYYAPCPKP 176 R+T E Y + L +FEN R+NYY PCP+P Sbjct: 161 ----LRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFENGFQSMRMNYYPPCPQP 216 Query: 177 DLVLGTGGHRDPSALTVLAQ-EDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSN 235 + V+G H D SALT+L Q +VEGL + K+DG W+ + P+P++F++N+GD L++ +N Sbjct: 217 EKVMGLTPHSDGSALTILLQINEVEGLQI--KNDGKWIPITPLPNAFIVNIGDTLEIITN 274 Query: 236 DLYESVEHRAMVHAETERYSIPIFFHPSHDITMKPLDELVDERSPAKY 283 Y S+EHRA+V++ ER SI F+ D + P L+ E++PA + Sbjct: 275 GTYRSIEHRAIVNSLQERLSIATFYTKRLDGEIYPASSLISEKTPALF 322 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30449 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4263 62 5e-12 >Cs4263 Length = 239 Score = 62.4 bits (150), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 6/130 (4%) Query: 137 EEASWWVWITDDMI--PGKVEERSGIDNXXXXXXXXXXXXDGIANFMAKCIVSNPKARNL 194 EE S W ++D+ + G ++ +D DGIA FMA ++S +A+NL Sbjct: 114 EEGSSWDMVSDNDLWESGNID----LDREDYVLVSEEDIVDGIACFMAAYLLSLKQAKNL 169 Query: 195 TPEELQKIVAKAMGGVGKLEKVLGIWHAGKLFYTLSTWGLALTGLYRSRAVLKFAAMGLH 254 TP +LQ+ ++K + K+ W K+ Y +++WG G+Y++ +L+ A+ Sbjct: 170 TPNQLQEALSKTFSVKKRKGKLRKAWDGSKVIYNVASWGATAVGIYQNPVILRAASKAFW 229 Query: 255 TTSKAIMRAM 264 T+ I + + Sbjct: 230 TSCHVISKLL 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31420 (330 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88194 127 2e-31 >Cs88194 Length = 241 Score = 127 bits (319), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 62/97 (63%), Positives = 77/97 (79%) Query: 59 KRRLNVEQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVSVWFQNRRARWKTKQLERD 118 KR L V+Q + LEK+FEVENKLEPERK++LA++LGLQPRQV++WFQNRRARWKTKQLE+D Sbjct: 5 KRLLTVDQGQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKD 64 Query: 119 YGVLKADYDSLKCSYDILQHDNEALLKEIKQLKAKFQ 155 Y VL+ Y+SLK YD L + E L E+ +L K Q Sbjct: 65 YDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQ 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812598 (122 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14009 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs67005 95 4e-22 >Cs67005 Length = 126 Score = 95.1 bits (235), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 41/83 (49%), Positives = 58/83 (69%) Query: 9 AAGPSAQPLANPVTVVSPQFLAAYPVDLVITEKMMTIKEGAFTVSDVNGNLMFNIKGSLF 68 A P+ +NPV+V+ PQ+ YPVDL I K +T+ +G+F V+D+N NLMF +K L Sbjct: 31 APTPAPTIYSNPVSVIGPQYCLPYPVDLSIVRKFLTLTDGSFAVTDINDNLMFKVKEKLI 90 Query: 69 SLHDRRVLVDNAGNPIVSFRQKI 91 SLHD+R L+D AGNPIV+ +K+ Sbjct: 91 SLHDKRTLLDPAGNPIVTITEKV 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18371 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs94106186 127 2e-32 >Cs94106186 Length = 70 Score = 127 bits (320), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 59/70 (84%), Positives = 65/70 (92%) Query: 1 MVNAVKGLFISCDIPMAQFIINYDNSLPASQRFIIHVLDSTHLFVQPHAAEMIRSAIAEF 60 MVNA+KGLFISCDIPMAQFIIN + S+P SQ+FIIH+LDSTHLFVQP+ AEMIRSAIAEF Sbjct: 1 MVNAIKGLFISCDIPMAQFIINMNASMPQSQKFIIHILDSTHLFVQPNMAEMIRSAIAEF 60 Query: 61 RDQNSYEKPT 70 RDQNSYEKP Sbjct: 61 RDQNSYEKPA 70 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28458 (350 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25687 (244 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14838 (316 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22204 (302 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5247 (235 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs8647 417 e-119 >Cs8647 Length = 235 Score = 417 bits (1073), Expect = e-119, Method: Compositional matrix adjust. Identities = 199/234 (85%), Positives = 220/234 (94%) Query: 1 MSTLDATRAELALAVLYLNKAEARDKICRAIQYGSKFLSNGEPGTAQNVDKSTSLARKVF 60 MSTLDATRAELAL VLYLNKAEARDKICRAIQYGSKFLS+G+PGTAQNVDKSTSLARKVF Sbjct: 1 MSTLDATRAELALVVLYLNKAEARDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVF 60 Query: 61 RLFKFINDLHGLISPTAPGTPLPLVLLGKSKNALLSTFLFLDQIVWLSRTGIYKNKERAD 120 RLFKF+NDLH LISP GTPLPLVLLGKSKNALLSTFLFLDQ+VWL R+GIYKNKERA+ Sbjct: 61 RLFKFVNDLHALISPVPQGTPLPLVLLGKSKNALLSTFLFLDQVVWLGRSGIYKNKERAE 120 Query: 121 LIGRISLFCWMGSSICTTLVEIGEIGRISGQLKKLEKDLKNSEKYHNEQYRAKLKKSNER 180 L+GRISLFCWMGSS+C+TLVE+GE+GR+S +KKLEK+LK+S+K+ NEQY+AKLKKSNER Sbjct: 121 LLGRISLFCWMGSSVCSTLVELGELGRLSTSMKKLEKELKDSDKHKNEQYQAKLKKSNER 180 Query: 181 SLALVKAALDTVVAVGLLQLAPKKVTSRVTGALGFTTSLISCYQLLPAPAKSKA 234 SLALVK+A+D VVAVGLLQLAPKKVT RVTGA GF TSLISCYQLLPAP K+KA Sbjct: 181 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAKA 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24758 (354 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs70246 66 4e-13 >Cs70246 Length = 301 Score = 66.2 bits (160), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 67/249 (26%), Positives = 122/249 (48%), Gaps = 22/249 (8%) Query: 105 VFVAGATGQAGVRIAQTLLREGFSVRAGVPELGAAQELARVASKYKIISNEESKRLNAVE 164 +FVAGATG +G RI + LL +GF+V+AGV +L K K ++++ L V+ Sbjct: 69 IFVAGATGSSGKRIVEQLLAKGFAVKAGVRDL----------DKAKTTLSKDNPSLQIVK 118 Query: 165 S-VFQDAESIAKAIGNASKVVVTIGPAENG----PTTEVTPFDALQVIQAAQLAGVGHVA 219 + V + + +++AIG+ S+ VV G +V F + +++A + GV Sbjct: 119 ADVTEGSAKLSEAIGDDSEAVVCATGFRPGWDLFAPWKVDNFGTVNLVEACRKRGVNRFI 178 Query: 220 IIYDGNSVGSSTNNVLDGISSFFNNLFSQTQLLTVAEFLQKVIEMDVSYTFIKTSLTEDF 279 +I G++ +L+ + F N+F T L+ + Q + + ++YT I+ + Sbjct: 179 LISSILVNGAAMGQILNP-AYIFLNVFGLT-LIAKLQAEQYIRKSGINYTIIRPGGLRNE 236 Query: 280 SPESSYNIVMSAEGGGGANDYKVAKSQIAALVADVFSNTSMAENKVVEVYTDPSAPMRPV 339 P NIVM E + +++ Q+A + + + + KVVE+ + AP R Sbjct: 237 PPTG--NIVMETE--DTLYEGTISRDQVAEVAVEALLHPE-SSYKVVEIISRVDAPKRSY 291 Query: 340 DQLFGTIPE 348 + LFG+I + Sbjct: 292 EDLFGSIKQ 300 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414076 (145 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31944 (143 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16162 (291 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226773227 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8554 (379 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27709 (155 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29757 (470 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48693757 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20292 (56 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3705 (158 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21457 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14295 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23013 (203 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16690 (243 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs810 111 9e-27 >Cs810 Length = 224 Score = 111 bits (277), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 75/239 (31%), Positives = 114/239 (47%), Gaps = 27/239 (11%) Query: 3 GTDVDDRQLRDDLMTMLIAGHETTAAVLTWAVFFLAQNPSKMKKAQEEIDSVLGQDGPTY 62 G D ++ + +++ G E+T + W + L +P ++KKAQEE+D +G+D Sbjct: 2 GGHTRDIVVKATALILILTGSESTYLGIIWTLSLLLNHPKELKKAQEELDVHVGRDRWVN 61 Query: 63 ES-IKKLEYTRLIAVESLRLFPQPPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISV 121 ES +K L+Y R I E+LR++P P+ R D GGY+ VP GT L +++ Sbjct: 62 ESDMKNLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYH-------VPKGTRLIVNI 114 Query: 122 YNLHRSPYFWDNPNEFEPERFLVEKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGG 181 + LHR P W+NP EF PERFL A D + F ++PF Sbjct: 115 WKLHRDPRMWENPCEFRPERFLTTH-------ADVDVNTQ-----------HFEYIPFSF 156 Query: 182 GPRKCVGDQFALMESTVALAMLLQKFTV-ELKGSPDSVEQVTGATLHTKNGLWCKLQKR 239 G R C G L + LA +LQ F + + G+P ++ G L N L ++ R Sbjct: 157 GRRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVGMQIGLGLALPKSNPLEVIIKPR 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6201 (190 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs81333 240 9e-66 >Cs81333 Length = 370 Score = 240 bits (612), Expect = 9e-66, Method: Compositional matrix adjust. Identities = 113/186 (60%), Positives = 139/186 (74%), Gaps = 3/186 (1%) Query: 3 SEPVNVNEYQELARQALPKMYYDYYTGGAEDQHTLKENVEAFRRITLRPRILVDVSRVDM 62 E NV EY+ +A++ LPKM +DYY GAEDQ TL+EN AF RI RPRIL+DVS++DM Sbjct: 2 GEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDM 61 Query: 63 STTVLGYKISAPIMLAPTAMHQLAHPEGEVXXXXXXXXCNTIMILSYMSTCTVEEVASSC 122 +TTVLG+KIS PIM+APTAM ++AHPEGE TIM LS ST +VEEVAS+ Sbjct: 62 NTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTG 121 Query: 123 NAVRFFQIYVYKRRDISAQMVRRAEKNGYKAIVLTADTPRLGRREADIKNKMVAP---QL 179 +RFFQ+YVYK R++ AQ+VRRAE+ G+KAI LT DTPRLGRREADIKN+ P L Sbjct: 122 PGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTL 181 Query: 180 RNFEGL 185 +NF+GL Sbjct: 182 KNFQGL 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48413346 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29184 (255 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 112 4e-27 >Cs25776 Length = 104 Score = 112 bits (280), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 50/79 (63%), Positives = 60/79 (75%) Query: 117 MAPEVLRNENSNEKCDVYSFGVILWELATLKLPWSGMNPMQVVGAVGFQNRRLEIPKELD 176 MAPE LR E SNEK DVYSFGVILWEL T++ PW+G++P QVVGAV FQNRRL IP+ Sbjct: 1 MAPEFLRGEPSNEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQNTS 60 Query: 177 PLVARIIWECWQTDPNLRP 195 P++A ++ CW DP RP Sbjct: 61 PVLASLMESCWADDPAQRP 79 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32866 (129 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs11942 86 2e-19 >Cs11942 Length = 289 Score = 85.5 bits (210), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/69 (57%), Positives = 46/69 (66%) Query: 54 FSLFLLRAAGFLLPCYIMAWAISILXXXXXXXXXXXXXXXXXXFVLQSGQHRGLQFAVAP 113 FSLFLLRAAGFLLPCYIMAWA+SIL F++Q+GQ RGL F +AP Sbjct: 218 FSLFLLRAAGFLLPCYIMAWAVSILQRRRQRQEAAALAATEVAFMIQAGQRRGLHFTIAP 277 Query: 114 GPSGTPHPE 122 GP+ TPH E Sbjct: 278 GPAVTPHQE 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25664 (718 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6452 (283 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65357 373 e-105 >Cs65357 Length = 271 Score = 373 bits (958), Expect = e-105, Method: Compositional matrix adjust. Identities = 187/282 (66%), Positives = 216/282 (76%), Gaps = 13/282 (4%) Query: 1 MGALTAASVLPWDFKPSVSLSRHRGSLFHYTRTPKKRNRAIVPVARLFGPAIFEASKLKV 60 M +L AA LP K S + +LF R KK+N++ PVARLFGPAIFEASKLKV Sbjct: 1 MASLVAALGLPSKLK--ASPYEQQNALFVSRRRSKKKNQSFAPVARLFGPAIFEASKLKV 58 Query: 61 LFLGVDEKKHPGKLPRTYTLTHSDITSKLTLAISQTIDNSQLQGWYSKLQRDEVVAQWKK 120 LFLGVDE+KHPGKLPRTYTLTHSDITSKLTLAISQTI+NSQLQGWY++LQRDEVVA+WKK Sbjct: 59 LFLGVDEEKHPGKLPRTYTLTHSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKK 118 Query: 121 VKDKMSLHVHCHISGGHFLLDLFARLRYFIFCKELPVVLKAFVHGDGNLFNSYPELQDAM 180 VK KMSLHVHCHISGGHFLLD+ ARLR+FIF KELPVVLKAFVHGDGNL N++PELQ+A+ Sbjct: 119 VKGKMSLHVHCHISGGHFLLDICARLRFFIFSKELPVVLKAFVHGDGNLLNNHPELQEAL 178 Query: 181 VWIYFHSSIPEFNKVECWGPLVDXXXXXXXXXXXXHHQENNSGGEGEEATSPSNWDLPET 240 VW+YFHS+IPEFNKVECWGPL + H E + TS SNW+LPE Sbjct: 179 VWVYFHSNIPEFNKVECWGPLKEAVAGSSEAGGTRH--------EIRQETSISNWELPEP 230 Query: 241 CQEECNCCFPQLTSIAWSQELPRANQTRVGT--HQSFQGQTQ 280 CQE CNCCFP ++ I WS++LP + R GT +S Q QT+ Sbjct: 231 CQETCNCCFPPMSLIPWSEKLPLQTENR-GTQGQESLQQQTR 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27375 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27515 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs17782 111 3e-27 >Cs17782 Length = 216 Score = 111 bits (278), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 53/121 (43%), Positives = 80/121 (66%), Gaps = 3/121 (2%) Query: 11 SYYSVLGVGSDSSVEEIRRAYRKLAMKWHPDRWTRTPS--LLGEAKRKFQQIQEAYSVLS 68 ++Y+VLG+ + + E+R AY+KLA++WHPDR + + + + EAK+KFQ IQ AYSVLS Sbjct: 10 NFYAVLGLNKECTATELRNAYKKLALRWHPDRCSASGNAKFVDEAKKKFQTIQHAYSVLS 69 Query: 69 DQRKRSMYDVGLYXXXXXXXXXGFCDFVQEMVSLMAESR-REAKSYTMEDLQAMFREMVK 127 D KR +YDVG+Y G DF+ EM ++M++++ E T E+LQ +F EM + Sbjct: 70 DANKRLLYDVGVYDSDDDGDNNGMGDFLNEMAAMMSQTQTNENGEETFEELQNLFEEMFQ 129 Query: 128 G 128 G Sbjct: 130 G 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig661 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs30197 87 7e-20 >Cs30197 Length = 247 Score = 86.7 bits (213), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 47/108 (43%), Positives = 69/108 (63%), Gaps = 3/108 (2%) Query: 2 SSCLDLSGFFEKE-DVSERKIRFTSNHSAKDLLKKIEEIVMEMGYCVQKKNGRLKVMQEH 60 S L+LS FEK+ + +R+ RFTS +++ KIEE +G+ V+K N +LK+ E Sbjct: 117 SQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEK 176 Query: 61 KGVRSLGSLSVAAEVFEISPSLFVVELRKSYGDSFAYRQLCKKLSNDL 108 G + G LSVA E+FE++PSL++VELRKS GD+ + + K LS L Sbjct: 177 TGRK--GHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGL 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15534 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3000 (172 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5731 (329 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22090 (464 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789661 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46597440 (79 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25132 (319 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs101477 226 4e-61 >Cs101477 Length = 242 Score = 226 bits (575), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 137/295 (46%), Positives = 172/295 (58%), Gaps = 58/295 (19%) Query: 25 LNLKATELRLGLPGSQSPERDXXXXXXXXVEEKATGFSVCGVKGLVSGAKRGFSDAIDGA 84 +N +ATELRLGLPG EKA ++ +G KRGF+D + Sbjct: 2 INFEATELRLGLPGGNG-----GSSEGGGGGEKAKNNNI-------NGMKRGFADTV--- 46 Query: 85 SGKWVFSGSGGSEVELGKGGNLLSPRGVNAGKALAAGCEPSNQPTGLAGSAVKDGVQQSP 144 V+L +N + G + + G + SA Sbjct: 47 -------------VDLK----------LNLSTKESGGIDVIEKTKGKSASAT-------- 75 Query: 145 KPLHEKKPQGSAGSTAPAAKAQVVGWPPIRSFRKNSMA-SVPSKNGDD-AEGKMGAGCLY 202 G+ + P AK+QVVGWPP+RSFRKN MA ++ GD+ A + + Sbjct: 76 ---------GATDLSKPPAKSQVVGWPPVRSFRKNIMAVQKDNEEGDNKASSSSSSNVAF 126 Query: 203 VKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGSHGASRDGLSESRLMDLL 262 VKVSMDGAPYLRKVDLK Y SY +LS AL KMFS FTIG CGS G +D ++ES+L+DLL Sbjct: 127 VKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGM-KDFMNESKLIDLL 185 Query: 263 HGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMQKCKN 317 +G++YV TYEDKDGDWMLVGDVPW+MF DSCKR+RIMK SEAIGLAPRA++KCKN Sbjct: 186 NGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28932 (323 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8605 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46873003 (101 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10641 (343 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799765 (77 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24216 (426 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66689 188 1e-49 >Cs66689 Length = 145 Score = 188 bits (477), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 91/148 (61%), Positives = 108/148 (72%), Gaps = 3/148 (2%) Query: 278 MRKFDDKIPSRDFDNFQFVNFTEIMSKRATSTEKEAAFALAALMEIPIQYKAAIELSLLG 337 M+KFDDKIP+R+FDNFQFVNFT IMSK AT +EKE AFALAALMEIPIQYKAA+EL ++G Sbjct: 1 MQKFDDKIPAREFDNFQFVNFTAIMSKNATPSEKETAFALAALMEIPIQYKAAVELGIMG 60 Query: 338 RTAGNGNRIVXXXXXXXXXXXXXXTREPSGLSAPGGDERSELVCPICLTNPKDLAFGCGH 397 RT G +I R+PS S P + ++ CPICLTN KDLAFGCGH Sbjct: 61 RTTGRAKKIAPRPPPAPYSRRALPERQPSRGSTPVAETQA---CPICLTNAKDLAFGCGH 117 Query: 398 MSCRDCGPRLSACSICRQPIRSRLRVFA 425 M+CR+CG R+S C ICRQ I +RLR+FA Sbjct: 118 MTCRECGSRVSNCPICRQRITNRLRLFA 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5971 (318 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13617 (359 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs65146 195 5e-52 >Cs65146 Length = 173 Score = 195 bits (496), Expect = 5e-52, Method: Compositional matrix adjust. Identities = 98/148 (66%), Positives = 111/148 (75%), Gaps = 1/148 (0%) Query: 193 SSKLEGRSPRCRLSDKASDQLRTWFEDDDALERAIDGEWYLIPCGQDNDASQLICLN-RD 251 SSKLEGRSP C+LSDKASD LRTWF DDDALERA++GEW+L+P G +N SQ I L+ Sbjct: 26 SSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSGSH 85 Query: 252 EKTSCIIGSIPHGDASGTSITIRSPQVSEMHARISYKDGAFYVTDLQSEHGTWIADIEEK 311 E +IGS H D S TSI I S QVS+MHARISYKDGAFY+ DLQSEHGT++ D E + Sbjct: 86 ENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGR 145 Query: 312 RYRVPPNFPARIHPSDAIEIGSQKVAFR 339 RYRV NFPAR PSD IE GS K FR Sbjct: 146 RYRVSSNFPARFRPSDTIEFGSDKKQFR 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32239 (289 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs74272 169 2e-44 >Cs74272 Length = 299 Score = 169 bits (429), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 83/118 (70%), Positives = 93/118 (78%), Gaps = 1/118 (0%) Query: 140 GSNARKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKL 199 G +RKKLRL+K+QSA+LEESFK+H+TLNPKQK ALA+QL LRPRQVEVWFQNRRARTKL Sbjct: 129 GDTSRKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKQLGLRPRQVEVWFQNRRARTKL 188 Query: 200 KQTEVDCEFLKKCCETLTDENRRXXXXXXXXXXXXXNQPLYMHM-PTATLTMCPSCER 256 KQTEVDCEFLK+CCE LT+ENRR + YM M P TLTMCPSCER Sbjct: 189 KQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMQMTPPTTLTMCPSCER 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19169 (175 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51097873 (70 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48938679 (124 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2703 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18533 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011098 (133 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48384743 (152 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs96674 71 6e-15 >Cs96674 Length = 186 Score = 70.9 bits (172), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 37/52 (71%), Positives = 41/52 (78%), Gaps = 5/52 (9%) Query: 96 LSSAKKELHEVKRKSAALQMQQFVGEEKNDLLDYLRSLQPEES-----NSCP 142 S+ KEL EVKRKS+ALQMQQFVGEEKNDLLDYLRSLQPE+ +CP Sbjct: 26 FSALFKELCEVKRKSSALQMQQFVGEEKNDLLDYLRSLQPEKVVELSEPTCP 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4436 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs56622 60 5e-12 >Cs56622 Length = 79 Score = 60.5 bits (145), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Query: 45 YPDLGYLENAS--TETLIAGVAPVKMFYERSEMNYGAENGCKYGSNCSYSSC 94 YPDL E+ + TETL+ GVAPVKM E SEM +GAE GCK G NC + C Sbjct: 26 YPDLRSFESTTVATETLVLGVAPVKMHSEGSEMGFGAEGGCKCGPNCKCNPC 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4423 (75 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7532 (295 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs76516 290 1e-80 >Cs76516 Length = 291 Score = 290 bits (743), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 141/290 (48%), Positives = 188/290 (64%), Gaps = 8/290 (2%) Query: 10 MVFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKN 69 M + SLF LMV+ S+ F + ++ + G L LNLD SG+GF SK+ Sbjct: 4 MSLIFSLFVGLLMVVLVSSAKFDDLYQTSWAFDHVQY--DGDTLKLNLDNYSGAGFASKS 61 Query: 70 EYLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNSTGEPYTLHTNVFSQG 129 +YLFG++ +QIKLV G+SAGTVTA+Y+SS+GP H+E DFEFLGN+TGEPY + TNV+ G Sbjct: 62 KYLFGKVSIQIKLVGGDSAGTVTAFYMSSDGPNHNEFDFEFLGNTTGEPYLVQTNVYVNG 121 Query: 130 KGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRI 189 GNREQ+ LWFDPTK FHTYS++WN ++++FLVD PIRV NLE G+PFPK+Q M + Sbjct: 122 VGNREQRLDLWFDPTKEFHTYSLLWNQRQVVFLVDETPIRVHTNLEHKGIPFPKDQAMGV 181 Query: 190 YSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKXXXXXXXXXXXXXXXXXXXXLT-EQS 248 YSS+WNADDWAT+GG VKTDW+ APF ASY+ F + E+ Sbjct: 182 YSSIWNADDWATQGGRVKTDWSHAPFIASYKGFDIDACECPASVAGADNAKKCSSSAEKR 241 Query: 249 AWKTQ----GLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTECKRSR 294 W + L+ ++L WV+ ++Y+YC+D RFP +PTEC R Sbjct: 242 FWWDEPTLSELNVHQSHQLMWVRANHLIYDYCTDTSRFP-AIPTECVHHR 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796664 (184 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7935 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22916 (286 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13092 (156 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22698 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10433 152 3e-39 >Cs10433 Length = 87 Score = 152 bits (383), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 70/84 (83%), Positives = 77/84 (91%) Query: 17 SGKAVPKLQLEHGLAVDRVYTGSFMTSLDMAGFSISVMKADQTILQRLDAATKAPYWPVG 76 +GKAVP LQLEHGLAV+RVYTGSFMTSLDMAGFSIS+MKAD+ IL+ LDA TKAP+WPVG Sbjct: 1 AGKAVPNLQLEHGLAVERVYTGSFMTSLDMAGFSISIMKADEVILKHLDATTKAPHWPVG 60 Query: 77 VDGNHPPAKIPVPLPPSRSMNSDE 100 VDGN PPAKIPVP+PPS SM SDE Sbjct: 61 VDGNRPPAKIPVPMPPSHSMKSDE 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1254 (121 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28706 (271 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32411 (183 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762029 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21106183 99 5e-23 >Cs21106183 Length = 137 Score = 98.6 bits (244), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 55/125 (44%), Positives = 77/125 (61%), Gaps = 7/125 (5%) Query: 97 KSLPVAVKVLNKEGYQGHREWLTEVNFLGQLRHPNLVKLIGYCCED--DHRLLVYEFMFR 154 K V LN QG +E++ +VN L L+HPNL KL+G+ D D R+L+YE +F Sbjct: 14 KKFEATVTRLNPSS-QGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFH 72 Query: 155 GSLENHLF-RKATVPLSWGTRMMIALGAAKGLAFLHNAERP--VIYRDFKTSNILLDSDY 211 GSL+ ++ R P+ W TR+ IAL AA+GL FLH E P +Y +F T+NI +D D+ Sbjct: 73 GSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHE-EGPFQAMYNEFSTANIQIDKDF 131 Query: 212 ATKLS 216 + KLS Sbjct: 132 SAKLS 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11272 (412 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs27028 428 e-122 >Cs27028 Length = 238 Score = 428 bits (1100), Expect = e-122, Method: Compositional matrix adjust. Identities = 197/238 (82%), Positives = 218/238 (91%) Query: 167 LNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVL 226 +NQ +P++YV+LYTYQI RAL+Y+H +GVCHRDIKPQNLLVNPHTHQ+K+CDFGSAK+L Sbjct: 1 MNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLVNPHTHQLKICDFGSAKML 60 Query: 227 VKGEPNISYICSRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLV 286 V GEPNISYICSRYYRAPELIFGATEYT+AID+WS+GCVLAELLLGQPLFPGESGVDQLV Sbjct: 61 VPGEPNISYICSRYYRAPELIFGATEYTTAIDMWSIGCVLAELLLGQPLFPGESGVDQLV 120 Query: 287 EIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNL 346 EIIK+LGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEA+DLVSRLLQYSP+L Sbjct: 121 EIIKILGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEALDLVSRLLQYSPSL 180 Query: 347 RCTALDALVHSFFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARK 404 RCTAL+A H FFDDLRDPNT LPNGR LP LFNF + EL G E +L+PEHARK Sbjct: 181 RCTALEACAHPFFDDLRDPNTCLPNGRPLPTLFNFTAQELAGASNELRQRLIPEHARK 238 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274410 (186 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17635 (130 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8715 (275 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17769 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs58462 323 1e-90 >Cs58462 Length = 290 Score = 323 bits (829), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 160/299 (53%), Positives = 207/299 (69%), Gaps = 11/299 (3%) Query: 1 MEFDDRFMQAQRTKXXXXXXXXXXXXYPYCSGIATACRINIEDYMVEKLGIDRSIIPELG 60 ME+ + Q K YP SG++ NI++YM++KL I+ + +PEL Sbjct: 1 MEYKNENKQVSNQKYDCLLFDLDDTIYPLTSGLSKEVTKNIQEYMLQKLCIEEAKVPELC 60 Query: 61 NLLYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFT 120 LYK YGTT+AGLRAIGY FD D++HS+VHGRLPY +KPDPVLR+LLL+LP RK+IFT Sbjct: 61 VSLYKFYGTTLAGLRAIGYQFDCDDFHSYVHGRLPYMMLKPDPVLRNLLLSLPIRKVIFT 120 Query: 121 NADKIHAAKALSRLGLEDIFEGIICFETLNPIHKNTVSDDEDDIEFVGLXXXXXXXXXXQ 180 NADK HAA+ LSRLGLED FE II FETLN K TV D+D E + Sbjct: 121 NADKTHAARVLSRLGLEDCFERIISFETLNSTDKGTVLVDQDASE---------SERPTE 171 Query: 181 IFDIIGHFATPNPTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKR 240 +FDI + + PN +LP+TP+VCKP E+A E+ KIANINP++T+FF+DS+RN++ GKR Sbjct: 172 LFDIDDYCSRPNADLELPRTPVVCKPFEEAFEQVFKIANINPRKTIFFDDSIRNLETGKR 231 Query: 241 VGLQTVLVGTSQRVKGADYALESIHNLREAIPELWE--ADRKSKVGYSGKIAVETSVTA 297 +GL TV VGTS R +G DYALESIHN++EA+PELWE + + YSGK+++ETSV A Sbjct: 232 LGLHTVWVGTSHRAEGVDYALESIHNIKEALPELWEVAGENSESISYSGKVSIETSVIA 290 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200692 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20523 (311 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14799 (428 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs69106190 225 7e-61 >Cs69106190 Length = 396 Score = 225 bits (573), Expect = 7e-61, Method: Compositional matrix adjust. Identities = 116/260 (44%), Positives = 174/260 (66%), Gaps = 9/260 (3%) Query: 121 LITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVGLPKRAPI 180 L G +F W+ LNV+FNI NKKV N FPYP+ S + L G + LVSW+ + + Sbjct: 103 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIAEAPKT 162 Query: 181 DKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVLGHHIPLS 240 D E L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+ G +P+ Sbjct: 163 DLEFWKSLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLFGETLPMP 222 Query: 241 LWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIYSKKAMTG--MDSTNVYA 298 +++SL P++ G ++A++TEL+FN +GF AMISN+AF +R+I+SKK M G + N YA Sbjct: 223 VYMSLLPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVGGMNYYA 282 Query: 299 YISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKFVSDLFWIG---MFYHLYNQLA 355 +S+++LL+ P AI +EGPQ+ G++ AIA++G FV +W+ +FYHLYNQ++ Sbjct: 283 CLSMMSLLILTPFAIAVEGPQMWAAGWQKAIAQIG-PNFV---WWVAAQSIFYHLYNQVS 338 Query: 356 TNTLERVAPLTHAVGNVLKR 375 +L++++PLT ++GN +KR Sbjct: 339 YMSLDQISPLTFSIGNTMKR 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26123 (177 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2610 (253 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2810 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49633160 (95 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18031 (274 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14016 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9858 (377 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15521 (360 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26966 (442 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8633 (372 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs8874 533 e-153 >Cs8874 Length = 386 Score = 533 bits (1373), Expect = e-153, Method: Compositional matrix adjust. Identities = 253/322 (78%), Positives = 283/322 (87%) Query: 24 NLIQAICFILIRPLSKNTYRKINRXXXXXXXXXXXXXIDWWAGVKIQVYTDPETFRLMGK 83 NLIQA+CF+ IRPLSKNTYR+INR +DWWAGVKI+++ D ET+RLMGK Sbjct: 24 NLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVDRETYRLMGK 83 Query: 84 EHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS 143 EHALV+ NH+SDIDWLVGWVL+QRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLER+ Sbjct: 84 EHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERN 143 Query: 144 WAKDENTLKLGLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPVPRNVLIPR 203 W KDE+TLK GLQRL+DYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP+PRNVLIPR Sbjct: 144 WVKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIPR 203 Query: 204 TKGFVSAVSHMRSFVPAIYDVTVAIPKASPSPTMLRLFQGRPSVVHVQIKRHLMKELPET 263 TKGFVSAVSHMRSFVPAIYDVTVAIPK+SP+PTM+RLF+G+ SV+HV +KRHLMKELPET Sbjct: 204 TKGFVSAVSHMRSFVPAIYDVTVAIPKSSPAPTMIRLFKGQSSVMHVHLKRHLMKELPET 263 Query: 264 DEAVAQWCKDIFVAKDAFLDKHTAKQTFGDQILQPTGQPRKSLLVVASWSCLLILGALKF 323 D+AVAQWC+D+FVAKDA LDKH A+ TF DQ LQ +P+KSLLVV SW+ L+I G LKF Sbjct: 264 DDAVAQWCRDMFVAKDALLDKHNAEDTFSDQELQEIPRPKKSLLVVISWASLVIFGVLKF 323 Query: 324 LYRSSLLSSWKGIGFSTLGLSI 345 L SSLLSSWKGI FS GL I Sbjct: 324 LQWSSLLSSWKGIAFSAFGLGI 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27061 (297 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7310 (583 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs86377 256 5e-70 >Cs86377 Length = 261 Score = 256 bits (654), Expect = 5e-70, Method: Compositional matrix adjust. Identities = 137/255 (53%), Positives = 167/255 (65%), Gaps = 22/255 (8%) Query: 348 VQLPLDLETGQCKGFGFVQFAHLEHAKAAQSLNGKLEIAGRTIKVSSVTDHVGSQEAGAK 407 VQLPLD ETG CKGFGFVQFA LE A+ A +LNG+LEI GR IKVS+VTD G Q+ GA Sbjct: 4 VQLPLD-ETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGAN 62 Query: 408 SAXXXXXXXXX-LSLNAQSRALLMQKLDRSGIATSIAGSIGVPGLNGAA----------- 455 + LSLNA+SRALLMQKLDRSG AT+IAGS+ P +N A Sbjct: 63 TTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSVVTPAVNSTALPLPTAPLLGA 122 Query: 456 --------PNQRAVTLPIN-GQAAVSAPILPAAVAVNEPVGNPSECLLLKNMFDPATERE 506 P T+P + GQ + + A+V + + +G PSECLLLKNMFDP E Sbjct: 123 ASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETY 182 Query: 507 PDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVYLRFEXXXXXXXXXXXMHLRWFAGRL 566 +FD+DIKEDVE ECSK+G++KHI+V+K+SAGFVYLRFE +H RWFAG++ Sbjct: 183 EEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKM 242 Query: 567 ISALFMQPQVYEAKF 581 I+A FM PQ YEAKF Sbjct: 243 ITATFMVPQTYEAKF 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31898 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26657 (284 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761053 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4147 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs29412 208 2e-56 >Cs29412 Length = 180 Score = 208 bits (529), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 101/130 (77%), Positives = 118/130 (90%), Gaps = 1/130 (0%) Query: 2 ASVKAVALMTGDSNVRGSLHFLQASNGGPTHIQGRISGLSPGLHGFHIHALGDTSNGCNS 61 A+VKAVAL++G ++V+GSLHF+Q NG TH++G+I+GL PGLHGFHIHALGDT+NGCNS Sbjct: 8 ATVKAVALISGATSVKGSLHFVQGPNG-VTHVKGKITGLKPGLHGFHIHALGDTTNGCNS 66 Query: 62 TGPHFNPLKKEHGAPSDKERHAGDLGNIVAGQDGVAEVSLQDWLIPLSGPNSILGRAVVV 121 TGPHFNPLKK+HGAPSD ERH GDLGNIVAG DGVAEVS+ D +IPLSG +SILGRAVVV Sbjct: 67 TGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMIPLSGQHSILGRAVVV 126 Query: 122 HADPNDLGKG 131 HADP+DLGKG Sbjct: 127 HADPDDLGKG 136 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48271147 (126 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4675 (194 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414951 (138 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs41088 148 2e-38 >Cs41088 Length = 299 Score = 148 bits (374), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 79/134 (58%), Positives = 87/134 (64%), Gaps = 8/134 (5%) Query: 1 MSGRFSRTIYVGNLPSDIKEWEVEDLFYKYGRIVDIELKIPPRPPCYSFVEFESSRDAED 60 MS R SRT+YVGNLP DI+E EVEDLFYKYG I I+LKIPPRPP Y+FVEFE +RDAED Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEEARDAED 60 Query: 61 AIRGRDGYNFDGCRLRVELAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRVI 120 AIRGRDGY+FDG RLRVELAH EYRV+ Sbjct: 61 AIRGRDGYDFDGHRLRVELAH--------GGRGRSSSDRHSSHSSGRGRGVSRRSEYRVL 112 Query: 121 VRNLPSSASWQDFE 134 V LPSSASWQD + Sbjct: 113 VTGLPSSASWQDLK 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22024 (301 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29068 (216 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs8154 129 3e-32 >Cs8154 Length = 173 Score = 129 bits (323), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 66/120 (55%), Positives = 78/120 (65%), Gaps = 35/120 (29%) Query: 131 LPKEMVPNPDDIELWL-----------------------------------KVDGELKQK 155 LPK VP+P ++ELWL +VDGE++QK Sbjct: 45 LPKSAVPDPHNLELWLTVHNHYSLLSYFFMAFVKASNLFFTGWINFKCVSLQVDGEIRQK 104 Query: 156 GSTKDMIFKLPFLISHISSIMTLLEGDVILTGTPQGVGPVKIGQKITAGITNLVDVQFNV 215 GSTKDMIF +P+LISHISSIMTL EGDVILTGTPQGVGPVK+GQKITAGIT L+DV F++ Sbjct: 105 GSTKDMIFMIPYLISHISSIMTLFEGDVILTGTPQGVGPVKVGQKITAGITGLLDVHFDI 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269463 (136 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27877 (427 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22374 (352 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8974 (206 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs4259 88 7e-20 >Cs4259 Length = 148 Score = 88.2 bits (217), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 44/77 (57%), Positives = 49/77 (63%) Query: 127 DTRQITDXXXXXXXXXXXXXHLDLFGARITDSGTTYLRSFKDLKSLEICGGGLTDVGIKN 186 D RQITD HLDLFGARITDSG YLR+FK+L+SLEICGGGLTD G+K+ Sbjct: 1 DARQITDTGLAALTSLTGLTHLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKH 60 Query: 187 IKDXXXXXXXXXXQNCN 203 IKD QN N Sbjct: 61 IKDLSSLKLLNLSQNRN 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21132 (160 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6549 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2035 (132 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20244 (208 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23077 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs21820 135 2e-34 >Cs21820 Length = 128 Score = 135 bits (341), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 70/128 (54%), Positives = 89/128 (69%), Gaps = 3/128 (2%) Query: 83 MGRLFVVSLEGK-IYSCKHCRTHLALCDDVVSKSFYCRHGKAYLFSKVVNVYSGECEDRA 141 MGR+F+V L+G+ Y C+ C +HLAL D V+S SF CR G+AYLFS VVN+ G E+R Sbjct: 1 MGRIFLVELKGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERL 60 Query: 142 MMTGLHTVADIFCVGCGSIVGWKYETAHEKGQKYKEGKSVLERIKVSGPEGKTFWASHEA 201 M++G+HTV DIFC CG IVGWKY AH+K QKYKEGK VLER ++ E T S E Sbjct: 61 MLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRI--VEEVTEELSLET 118 Query: 202 QVSSSDAD 209 S++A+ Sbjct: 119 HTHSNEAE 126 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28724 (449 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824593 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2671 (187 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64004 272 2e-75 >Cs64004 Length = 186 Score = 272 bits (695), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 137/176 (77%), Positives = 151/176 (85%), Gaps = 2/176 (1%) Query: 13 EVARLPQIFKTLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIRRA 72 +V+RLP IF+ LGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLI+RA Sbjct: 5 KVSRLPYIFQHLGLEYDEKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLIKRA 64 Query: 73 KDFNIVLDDVAITHLSYGLEFSRXXXXXXXXXXXXXRSKFVVAKTEQERRAAIIRAQGES 132 +DFNIVLDDVAITHLSYG EFSR RSKFVV K +QERRAAIIRA+GES Sbjct: 65 RDFNIVLDDVAITHLSYGAEFSRAVEQKQVAQQEAERSKFVVMKADQERRAAIIRAEGES 124 Query: 133 EAAKLISDATASAGMGLIELRRIEASREVANTLARSPNVSYLPGGK--NMLFGLNP 186 EAA+LIS+AT+ G+GLIELRRIEASRE+A TLARSP+V+YLPGGK NML LNP Sbjct: 125 EAAQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNP 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012380 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21775 (551 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs105406 91 3e-20 >Cs105406 Length = 148 Score = 91.3 bits (225), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 59/142 (41%), Positives = 81/142 (57%) Query: 406 LMDKQGRKSLLLTSFGGXXXXXXXXXXXFTWKALAPYSAPLSVAGTVLYVLSFSXXXXXX 465 LMDK GRK+LL SF + S LSV G +++VL+F+ Sbjct: 3 LMDKLGRKALLQWSFFSMAVSMAIQVAASSSYIPGSASLYLSVGGMLMFVLTFALGAGPV 62 Query: 466 XXXXXXEIFASRIRAKAVSLSLGMHWISNFVIGLYFLSLVTKFGIGTVYFGFAGVCLLAV 525 EIF SRIRAKA+++ + +HW+ NF +GL FL L+ + G +Y F CL+AV Sbjct: 63 PSLLLPEIFPSRIRAKAMAVCMSVHWVINFFVGLLFLRLLEQLGPQLLYSIFGTFCLMAV 122 Query: 526 LYIAGNVVETKGRSLEEIERAL 547 ++ NVVETKG+SL+EIE AL Sbjct: 123 AFVKRNVVETKGKSLQEIEIAL 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990835 (192 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15336 196 2e-52 >Cs15336 Length = 263 Score = 196 bits (497), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 87/154 (56%), Positives = 121/154 (78%) Query: 1 MTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVS 60 MTALVTGGT+GIG+AIVEEL GAIVHTC+R E +LN+ + +W+ KG +V+GS CD+ Sbjct: 14 MTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGSACDLKI 73 Query: 61 KTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLS 120 + +R++L+ V S FDGKLNIL+NN G PK E+T ED+S +M+TN ESAYHL QL+ Sbjct: 74 RAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAYHLSQLA 133 Query: 121 HPLLKASGSANIVLLSSIAGVVSLNIGTIYSATK 154 +PLLKASG+ NI+ +SS+ GV+++ + +IY++TK Sbjct: 134 YPLLKASGNGNIIFISSVTGVIAVPLSSIYASTK 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12116 (134 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3176 (234 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs33129 166 3e-43 >Cs33129 Length = 225 Score = 166 bits (419), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 92/210 (43%), Positives = 128/210 (60%), Gaps = 6/210 (2%) Query: 5 DVKVLGMAPSPFVMRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIHGDKP 64 +VK+L SPF +RA L LK V ++F+ E +KS LLLQSNPV+KKVPVLIH KP Sbjct: 4 EVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGKP 63 Query: 65 VCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGEEAKK 124 + ESL+I+EY+DE W P +LP DPY+RA ARFWA + +K S+ + QG+E ++ Sbjct: 64 ISESLVILEYVDETWKQNP-LLPEDPYERARARFWAKFGEDKVLVSIWNAFIKQGKE-QE 121 Query: 125 AAIEQVTEGLALLEEAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGIKLLDQ 184 AI E L LEE KG FFGG++IG D+A G + V E++ G+KL+++ Sbjct: 122 EAIGLAIETLKFLEEEL----KGKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKLIEK 177 Query: 185 TKTPGLVKWADKFCAHAAVKDVMPETDKLV 214 + P L W + +K+ P +KLV Sbjct: 178 ERVPLLAAWMQEVAEAPVIKESWPPHEKLV 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13156 (265 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25214 (220 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042114 (149 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8056 (418 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50886902 (102 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22926 (251 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20635 (287 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs34637 377 e-106 >Cs34637 Length = 336 Score = 377 bits (967), Expect = e-106, Method: Compositional matrix adjust. Identities = 185/283 (65%), Positives = 221/283 (78%), Gaps = 18/283 (6%) Query: 21 GKPDSVCISQGGRFPPFSSEGKPPKRVSKGSKDLTLCRVFRKKTCCDVAQTHPALVSVRK 80 GK + VC+SQGGRF PFSSEGKPP+R SKG DLTLCRVFRKKTCCD AQTHPAL+S+RK Sbjct: 28 GKLNGVCVSQGGRFAPFSSEGKPPERASKGRSDLTLCRVFRKKTCCDTAQTHPALLSIRK 87 Query: 81 LASSGEAGPECLHLWELLECSICDPRIGVQSGPPVICASFCDRVFEACAEAYYSTDAITQ 140 LAS+GEA ECLHLWELLECSICDP +GVQ GPP+ICASFC+RV++AC+ AY+S DA TQ Sbjct: 88 LASTGEASQECLHLWELLECSICDPNVGVQPGPPLICASFCERVYQACSNAYFSMDAKTQ 147 Query: 141 VLAPCGVNDYVCGRASEWIHNGTEFCYAAGFAVK--DDISVSKEEPFCYGGKASLDLIAD 198 VLAPCGVND+VCGRA++W+ NGTE C+AAGFAVK DD + E+ CYGG ASLD IA Sbjct: 148 VLAPCGVNDFVCGRAAQWVSNGTELCHAAGFAVKLPDDTYIDGEQTSCYGGNASLDKIAG 207 Query: 199 SWKASPSEVPQKAESLRVLEEFQQRWREMPFSERVSWAIGGLVLTAGLLFV--------- 249 SW A SE PQK +++R+LE+FQQ ++M F ERVSWA+GGLVLTAGLLFV Sbjct: 208 SWSAPRSERPQKDKNIRILEDFQQWVQQMQFGERVSWAVGGLVLTAGLLFVTKRMIFFSL 267 Query: 250 ----SKRKRHNQRHNVAALR--IRKFEAKKSQ-KSPNSPGSRK 285 SKR+ H+QR +AA++ RK E K +Q SP S G+R+ Sbjct: 268 FQQSSKRRSHSQRQKLAAIQRTARKLEGKMNQASSPVSQGNRR 310 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5264 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs77271 66 2e-13 >Cs77271 Length = 98 Score = 66.2 bits (160), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/82 (43%), Positives = 49/82 (59%), Gaps = 6/82 (7%) Query: 66 FLGFGPEDSHFVVELTYNYGVSSYDIGTGFGHFAIATPDVKKLVEDV----RAKGGNVTR 121 LG+ ED V+EL Y+YGV+ Y G + AI+T DV K E V + GG +TR Sbjct: 1 MLGYAEEDQTTVLELAYSYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITR 60 Query: 122 EPGPVKG-GTSVIAFVKDPDGY 142 +PGP+ G T + +FV DPDG+ Sbjct: 61 QPGPIPGLNTKITSFV-DPDGW 81 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8751 (325 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66150 178 6e-47 >Cs66150 Length = 305 Score = 178 bits (452), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 103/252 (40%), Positives = 146/252 (57%), Gaps = 11/252 (4%) Query: 22 PTSAQLKTNYYANICPNVESIVRDAVTKKFQQTFVTVPGTLRLFFHDCFVEGCDASVIVA 81 P+ AQL ++Y++ CPNV + + D + K F +RL FHDCFV+GCDAS+++ Sbjct: 29 PSQAQLSPSFYSSTCPNVLNTIEDVLKKAFSSDIRIGASLIRLHFHDCFVDGCDASILLD 88 Query: 82 STANNKAEK-DNPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLS 140 ST +EK P+N S GF+ + KAAV+ C VSCADIL +A + LS Sbjct: 89 STNTIDSEKFAAPNNNS--ARGFEVIDNMKAAVERA--CPRVVSCADILTIAAERSVALS 144 Query: 141 GGPSYSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNSLFASHGLS-QADMVALSGAHTL 199 GGPS++V LGR D ++ N LP L++L S F + GL+ + D+VALSGAHT Sbjct: 145 GGPSWAVPLGRRDSRTANRALANQNLPGPFDTLDELKSSFRNVGLNDKLDLVALSGAHTF 204 Query: 200 GFSHCNQFSNRIY----SNPVDPTLNKTYATQLQQMCPKNVDPDIAIDMDPTTPRKFDNV 255 G + C F R+Y + DPTL+ T+ QL+++CP+ + + + D TTP FDN Sbjct: 205 GRAQCQFFRGRLYDFNNTGKPDPTLDATFLQQLRKLCPQGGNGGVLANFDVTTPDVFDNK 264 Query: 256 YFQNLVEGKGLF 267 YF NL G+ F Sbjct: 265 YFSNL-RGRKAF 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32010 (202 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs25776 98 5e-23 >Cs25776 Length = 104 Score = 98.2 bits (243), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 43/93 (46%), Positives = 62/93 (66%) Query: 86 MAPEVIEHKPYDHKADVFSFGIVLWELLTGQIPYSSLTPLQAAVGVVQKSLRPTIPKTTH 145 MAPE + +P + K+DV+SFG++LWEL+T Q P++ L+P Q V ++ R IP+ T Sbjct: 1 MAPEFLRGEPSNEKSDVYSFGVILWELVTMQQPWNGLSPAQVVGAVAFQNRRLAIPQNTS 60 Query: 146 PRFAELLERCWQQDPTQRPPFSDIIEILQNLAK 178 P A L+E CW DP QRP F++I+E L+ L K Sbjct: 61 PVLASLMESCWADDPAQRPSFANIVESLKKLLK 93 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31581 (128 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs73025 157 5e-41 >Cs73025 Length = 382 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGM 77 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 137 IQKESTLHLVLRLRGGM 153 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 153 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 212 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 213 IQKESTLHLVLRLRGGM 229 Score = 157 bits (396), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 229 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 288 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 289 IQKESTLHLVLRLRGGM 305 Score = 156 bits (395), Expect = 7e-41, Method: Compositional matrix adjust. Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 305 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 364 Query: 61 IQKESTLHLVLRLRGG 76 IQKESTLHLVLRLRGG Sbjct: 365 IQKESTLHLVLRLRGG 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28288 (344 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21541 (520 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26818 (281 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36106190 462 e-132 >Cs36106190 Length = 283 Score = 462 bits (1189), Expect = e-132, Method: Compositional matrix adjust. Identities = 229/282 (81%), Positives = 246/282 (87%), Gaps = 4/282 (1%) Query: 1 MAKDV--EGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT 58 M+K+V EG H KDY DPPP PL D EL WSFYRALIAEF+ATLLFLY++V T Sbjct: 1 MSKEVNEEGQTHRHHHGKDYVDPPPAPLIDMAELKLWSFYRALIAEFVATLLFLYVSVAT 60 Query: 59 VIGYKSQSEADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL 118 VIG+K QS D CGGVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL Sbjct: 61 VIGHKKQS--DACGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSL 118 Query: 119 IRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTFVLV 178 IRAV Y++AQCLGAICGVGLVKAF K Y GGGAN +++GYNKG+ LGAEIIGTFVLV Sbjct: 119 IRAVAYMVAQCLGAICGVGLVKAFMKHEYNSLGGGANTVASGYNKGSALGAEIIGTFVLV 178 Query: 179 YTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIYNKD 238 YTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIYN D Sbjct: 179 YTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNND 238 Query: 239 KAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSN 280 KAWDD WIFW+GPF+GA AA YHQYILRA AIKALGSFRSN Sbjct: 239 KAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFRSN 280 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27340 (72 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24736 (340 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19569 (80 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6904 (421 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs51829 151 9e-39 >Cs51829 Length = 262 Score = 151 bits (382), Expect = 9e-39, Method: Compositional matrix adjust. Identities = 84/165 (50%), Positives = 108/165 (65%), Gaps = 9/165 (5%) Query: 1 MTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPFGSNV 60 MTNAPFMLNVDCDMYANNP+IVL AMCL LG K+E E AF+Q PQ FYD E N+ Sbjct: 11 MTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFYDRPE------NL 64 Query: 61 VEAVKKIWPGLAGIQGPIYAGTGCFHRRKVIYGLSL--TDNEGNLTSERLNKECFGNSPE 118 + I G+ GIQGP Y GTG FHRR V+YGL L +++GN+ + L K+ FGNS E Sbjct: 65 CILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKK-FGNSKE 123 Query: 119 LIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKV 163 I+SA Q L + ++S +++ A++VA YE + WG +V Sbjct: 124 FIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEV 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28888 (401 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10714 (163 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27549 (173 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs95125 271 4e-75 >Cs95125 Length = 176 Score = 271 bits (692), Expect = 4e-75, Method: Compositional matrix adjust. Identities = 126/170 (74%), Positives = 147/170 (86%) Query: 3 RTRPNILVXXXXXXXXXXXSSALAEATQLRHINVGDLVKAKNLHDGWDDELDCYVINEDL 62 R+RPNILV S+ALAE+TQLRHIN+G+LV+ KNLHDGWDDEL+C+VINEDL Sbjct: 7 RSRPNILVTGTPGTGKTTTSTALAESTQLRHINIGELVREKNLHDGWDDELECHVINEDL 66 Query: 63 VCDELEDTMEEGGNIVDYHGCDFFPERWFDLVVVLQTDNTVLYDRLTRRGYSNSKLSNNI 122 VCDELED ME+GGNIVDYHGCDFFPERWFD VVVLQT+N+VLYDRLT+RGY+ +KL+NNI Sbjct: 67 VCDELEDIMEQGGNIVDYHGCDFFPERWFDRVVVLQTENSVLYDRLTKRGYTGAKLTNNI 126 Query: 123 ECEIFQTLLEEAKESYPQDIVIPLKSDSIQDISTNLTTLTDWVTRWQPSS 172 ECEIFQ LLEEAKESYP+DIV+ LKSD+I+DI+ N+ LTDWV WQP S Sbjct: 127 ECEIFQVLLEEAKESYPEDIVLALKSDTIEDITRNIAILTDWVRNWQPRS 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24188 (264 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71814181 (125 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19020 (188 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32374 (96 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig651 (233 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs46215 142 3e-36 >Cs46215 Length = 158 Score = 142 bits (358), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 74/158 (46%), Positives = 106/158 (67%), Gaps = 4/158 (2%) Query: 80 VGHIPTGNPKTSGTLGGYSGPGSICATSCL--VNADNSTS--YQNSTATFSDSRELPGFL 135 +G I G+ KT+ + GY PGS+ ++ V ADN++S QNS F +R++PG + Sbjct: 1 MGQISDGDIKTTAVITGYLAPGSLSPSASSCSVTADNTSSQQVQNSNIAFRAARQVPGLV 60 Query: 136 HNTANSQGFYVDKSGEMLDQGPLRNLGFVGKETCIPSRFAVDDFESQMSNLNPGRIHVES 195 N + QG Y KSGE+ D G LRN GF+GK CIPSR AVD+FES M+NLN G I++++ Sbjct: 61 SNVGDIQGSYGAKSGEVFDLGSLRNHGFMGKGNCIPSRLAVDEFESPMNNLNYGNIYLDN 120 Query: 196 SGTLVKQEPSEDYVDNAKLGIPILHQYSSSDFMSPFAD 233 + VK+EP+ ++V+NAK+GIP+ QY+ +D MS F D Sbjct: 121 NANKVKEEPNLEFVENAKVGIPMYQQYAPNDLMSVFTD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4544 (232 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68010 119 2e-29 >Cs68010 Length = 146 Score = 119 bits (299), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 61/144 (42%), Positives = 93/144 (64%), Gaps = 8/144 (5%) Query: 86 MNAYLGGFAAALSKY--PVWVMSTVPANSNQDTLGVIYERGFIGTYQDWCEAFSTYPRTY 143 MNA+ GF +AL + VWVM+ VP + L +I +RGF+G DWCEAF TYPRTY Sbjct: 1 MNAHSCGFNSALLEKGKSVWVMNVVP-TIGTNYLPMILDRGFVGVLHDWCEAFPTYPRTY 59 Query: 144 DLIHAGGVFSI---YQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAITDGMRWK 200 DL+HA G+ S+ ++ RC I E+DRILRPEG V+ RDT ++ +A+T ++W Sbjct: 60 DLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEGWVIIRDTARLIESARALTTRLKWD 119 Query: 201 SQIMDHESGPFNPEKILLAVKTYW 224 +++++ ES + E++L+ K ++ Sbjct: 120 ARVIEIESN--SDERLLICQKPFF 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 90997873 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5235 (166 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380738 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26701 (179 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4713 (252 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3814 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10310 (65 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10321 (269 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414632 (167 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24364 (347 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18203 (221 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22639 (298 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs104106187 521 e-150 >Cs104106187 Length = 354 Score = 521 bits (1341), Expect = e-150, Method: Compositional matrix adjust. Identities = 234/282 (82%), Positives = 261/282 (92%) Query: 2 NPRFSNYTVSQFMHLLGVKPTPQKDLQSFPIKTYPKSLKLPNNFDARTAWPQCNTIGRIL 61 NP+FSNYTV QF HLLGVKPTP+ L P+KT+ KSLKLP +FDAR+AWPQC+TI RIL Sbjct: 59 NPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRIL 118 Query: 62 DQGHCGSCWAFAAVEALSDRFCVHYGMNISLSVNDLLACCGFMCGAGCNGGYPIYAWRYF 121 DQGHCGSCWAF AVEALSDRFC+H+GMN+SLSVNDLLACCGF+CG GC+GGYPI AWRYF Sbjct: 119 DQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYF 178 Query: 122 IHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVKKCVDGNQIWKNSKRYSISAYRINSD 181 +HHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCV+KCV NQ+W+NSK YSISAYRINSD Sbjct: 179 VHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSD 238 Query: 182 PHSIMAEVYRNGPVEVAFTVYEDFAHYKSGVYKHVKGDVLGGHAVKLIGWGTTNDGEDYW 241 P IMAE+Y+NGPVEV+FTVYEDFAHYKSGVYKH+ GDV+GGHAVKLIGWGT++DGEDYW Sbjct: 239 PEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYW 298 Query: 242 LLANQWNRSWGDDGYFKIRRGTNECGIEEDVVAGLPSSKNFI 283 +LANQWNRSWG DGYFKI+RG+NECGIEEDVVAGLPSSKN + Sbjct: 299 ILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLV 340 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7976 (241 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs89949 347 6e-98 >Cs89949 Length = 240 Score = 347 bits (890), Expect = 6e-98, Method: Compositional matrix adjust. Identities = 177/241 (73%), Positives = 187/241 (77%), Gaps = 1/241 (0%) Query: 1 MASLGILVIGFLSLVSSVNGYYGGWSNAHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNT 60 MA IL +GFLSLVSSV GY GGW NAHATFY YGNLYSQGYGTNT Sbjct: 1 MALWVILCVGFLSLVSSVQGY-GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNT 59 Query: 61 AALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNFCPPGGWCDPPQQHFDLSQP 120 AALSTALFNNGL+CGAC+QI C NDPQWCL GSIIVTATNFCPPGGWCDPP HFDLSQP Sbjct: 60 AALSTALFNNGLSCGACFQIMCANDPQWCLRGSIIVTATNFCPPGGWCDPPNHHFDLSQP 119 Query: 121 VFLRIAQYKAGXXXXXXXXXXXXXXXXXXXXXNGHSYFNLVLVTNVGGAGDVQSVAIKGS 180 VF IAQY+AG NGHSYFNLVL+TNVGGAGDV +V+IKGS Sbjct: 120 VFQHIAQYRAGIVPVIYRRVRCKRNGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGS 179 Query: 181 RTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQTYTGRQFL 240 RTRWQ MSRNWGQNWQSNSYLNGQSLSF+VTTS+G +VSYNVAPPNWSFGQTYTGRQF Sbjct: 180 RTRWQPMSRNWGQNWQSNSYLNGQSLSFVVTTSNGHSVVSYNVAPPNWSFGQTYTGRQFR 239 Query: 241 Y 241 Y Sbjct: 240 Y 240 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6388 (317 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13086 (87 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16962 (60 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1073 (86 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21210 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21059 (153 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7755 (332 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71813923 (97 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783584 (106 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31507 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs68106183 110 6e-27 >Cs68106183 Length = 160 Score = 110 bits (276), Expect = 6e-27, Method: Compositional matrix adjust. Identities = 88/166 (53%), Positives = 106/166 (63%), Gaps = 15/166 (9%) Query: 1 MEGRKKXXXXXXXXXXXXXXXKESSASSGIFGAIFAPSSKDLVFGRESLRSEVTGKKL-- 58 MEGRK+ KESS+SSGIFG+IF+P SK V GRESL SE KK Sbjct: 1 MEGRKQTGSSSSLTNELFGS-KESSSSSGIFGSIFSPPSK--VLGRESLHSESMEKKHDS 57 Query: 59 TDDPLHFKPRDQ------PDGASKEIEGESKSITNMDIISSIYRDQRVQQPCHFSSSIYY 112 + + + KP P AS+ E ES+ D+ SS+Y+DQRVQ PCH SSSIYY Sbjct: 58 SKEAWNTKPTTPVLLLSFPGDASRSYETESQGTAYKDM-SSMYQDQRVQ-PCHLSSSIYY 115 Query: 113 GGQDIYA-HPQSTQNPEYNTPYKKDGTEDDSGSASRGNWWQGSLYY 157 GGQD+Y+ P ++Q P N+ +KKDG EDDSGSASRGNWWQGSLYY Sbjct: 116 GGQDVYSPRPPNSQGPGVNSVFKKDG-EDDSGSASRGNWWQGSLYY 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5841 (211 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9611 (337 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71924193 (157 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10934 (353 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21070 (165 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6614 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs64592 295 2e-82 >Cs64592 Length = 221 Score = 295 bits (756), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 141/173 (81%), Positives = 159/173 (91%) Query: 75 IKTQLLEAIKGINRGIFGVPSAKKSQIEALVNQLESRNPTPDPLLNLQKVGGCWKLVYST 134 IKT+LL+ ++GINRGIFGVPSAKKS+IEALV LES+NPTP P NL KVGG WKLVYST Sbjct: 28 IKTELLQVVQGINRGIFGVPSAKKSEIEALVELLESQNPTPHPTANLDKVGGTWKLVYST 87 Query: 135 ITILGSKRTKLGLRDFISLGDFFQNINIAKGKAVNVIKFDVRGLNLFNGRLTIEASFKKA 194 ITILGSKRTKLGLRDFI+LGDFFQ+I++AKGKAVNVIKF+VRGLNL NG+LTIEASFK A Sbjct: 88 ITILGSKRTKLGLRDFITLGDFFQSIDVAKGKAVNVIKFNVRGLNLLNGQLTIEASFKIA 147 Query: 195 SNSRVDINYDNSMITPSQLMSVFRKNYDILLGIFNPEGWLEITYVDDTLRIGR 247 S SRVDI YDNS ITP QLM++FRKNYD+LLGIFNP+GWLEI+YVDDT+RIGR Sbjct: 148 SKSRVDIAYDNSTITPEQLMNMFRKNYDLLLGIFNPDGWLEISYVDDTMRIGR 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9008 (248 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20723 (369 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs18794 358 e-101 >Cs18794 Length = 217 Score = 358 bits (919), Expect = e-101, Method: Compositional matrix adjust. Identities = 178/220 (80%), Positives = 190/220 (86%), Gaps = 8/220 (3%) Query: 155 MDMGGGNWDKETVTRALRAAYNNPERAVDYLYSSIPETTEVAVPVGNFPASQATDVA--- 211 MDMGGG WDKETVTRAL+AAYNNPERAVDYLYS IPET EVAVPV +FPASQA + Sbjct: 1 MDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPETAEVAVPVAHFPASQAAETGAAG 60 Query: 212 --PVSGAPNSAPLNMFPQETXXXXXXXXXXXXNFLKNNRQFQALRSMVQSNPQILQPMLQ 269 PVSG PNS+PLNMFPQET +FL+NN+QFQALRSMVQSNPQILQPMLQ Sbjct: 61 AAPVSGVPNSSPLNMFPQETLSGAPASGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQ 120 Query: 270 ELGKQNPQLLRLIQEHHTEFLQLINEPVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAI 329 ELGKQNPQLLRLIQEH EFLQLINEPV+GSEGD+FDQ P+QD+PHAINVTPAEQEAI Sbjct: 121 ELGKQNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQ---PEQDMPHAINVTPAEQEAI 177 Query: 330 ERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 369 +RLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED Sbjct: 178 QRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 217 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10275 (245 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs16453 98 9e-23 >Cs16453 Length = 223 Score = 97.8 bits (242), Expect = 9e-23, Method: Compositional matrix adjust. Identities = 66/196 (33%), Positives = 97/196 (49%), Gaps = 17/196 (8%) Query: 56 IPVDELKDLTDNFGTKSLIGEGSYGRVYHGVLKSGPAAAIKKLDS------SKQPEREFL 109 I +E+ T++F + IG+G +G VY + SG A+KK S S Q E EFL Sbjct: 31 IVYEEIISATNDFNAEHCIGKGGHGSVYRAKVPSGEIFAVKKFHSPLPGEMSFQQE-EFL 89 Query: 110 SQVSMVSRLKHENAVELVGYCIDGPLRLLAYEYAPKGSLHDILHGRKGVKGAQPGPVLSW 169 +++ ++ ++H N V+ +C + YEY GSL IL K L W Sbjct: 90 NEIQALTEIRHRNIVKFYCFCSHPKHSFIIYEYLESGSLDKILCNDASAKE------LGW 143 Query: 170 VQRVKIAVGAARGLEYLHEKAQPHIIHRDIKSCNILLFDDDVAKIADFDLSN-QAPDMAA 228 QR+ + G A L YLH P I+HRDI S N+LL A ++DF ++ PD + Sbjct: 144 TQRLNVIKGVADALFYLHNNCFPPIVHRDISSKNVLLDLGYEAHVSDFGIAKFLNPDSS- 202 Query: 229 RLHSTRVLGTFGYHAP 244 + + + GT GY AP Sbjct: 203 --NWSELAGTHGYVAP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3200 (104 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2542 (204 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs66175 67 1e-13 >Cs66175 Length = 260 Score = 67.4 bits (163), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 3/77 (3%) Query: 37 GSTASTAVLVGNHLYVANVGDSRTVISKAGKAIALSEDHKPNRSDERKRIENAGGVVMWA 96 GSTA A++ L VAN GDSR V+S+ G+A+ LS+DHKP+ E+ RI AGG + Sbjct: 176 GSTACVAIIRDKQLVVANAGDSRCVLSRKGQALNLSKDHKPDLEVEKDRILKAGGFIQ-- 233 Query: 97 GTWRVGGVLAMSRAFGN 113 RV G L ++RA G+ Sbjct: 234 -VGRVNGSLNLARAIGD 249 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27931 (137 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038482 (150 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs88716 60 2e-11 >Cs88716 Length = 201 Score = 59.7 bits (143), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/87 (40%), Positives = 45/87 (51%), Gaps = 9/87 (10%) Query: 67 KRMTWSIR--------SNSSGLDPSPRNG-STGTTRLIRAIQAIQTKLGVKIRQLRRGFP 117 KR W I S S G + +G G TRL R + A +L K+ R+ P Sbjct: 56 KRHGWKIAFALDTGGISGSGGQESLNGDGPDLGGTRLGRIVSAGGRQLLEKLNIARKNLP 115 Query: 118 MKLLFFLVGFYCATAYATVIGQTGDWD 144 MK+ L+GFY A A AT++GQTGDWD Sbjct: 116 MKIFLLLLGFYTANALATILGQTGDWD 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10305 (196 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs48454 134 6e-34 >Cs48454 Length = 244 Score = 134 bits (337), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 76/168 (45%), Positives = 102/168 (60%), Gaps = 48/168 (28%) Query: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYE---- 56 MGRGRV+LKRIENKINRQVTF+KRR+GLLKKA+E+SVLCDAEVALI+FS++GKL+E Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTD 60 Query: 57 ------------FCSSFRNL--------------------------------LGEDLSHL 72 +C + R L +GEDL+ L Sbjct: 61 SCMERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADL 120 Query: 73 NTKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKAL 120 + KEL+ +E Q+++ LK IRSRK Q +L +S+LQ ++++L E N L Sbjct: 121 SLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQNNLL 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13373 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs117106181 267 5e-74 >Cs117106181 Length = 221 Score = 267 bits (683), Expect = 5e-74, Method: Compositional matrix adjust. Identities = 122/180 (67%), Positives = 150/180 (83%) Query: 1 MILAEYTEFTGNFPAIAVPCLQKLPSSNNKFTYNCDHHTFNFLVEDGYAYCVVAKDSVGK 60 ++LAEYTEF+GNF +IA CLQKLP+SNNKFTYNCD HTFN+LV++GY YCVVA +S G+ Sbjct: 16 VVLAEYTEFSGNFNSIAYQCLQKLPASNNKFTYNCDAHTFNYLVDNGYTYCVVADESSGR 75 Query: 61 QISIAFLERVRADFKKRYGGGKADTAIAKSLNKEFGPIMKEHMKYIIDHAEEIEKLLKVK 120 QI +AFLERV+ +F +YGGGKA TA A LNKEFGP +KE M+Y +DH EEI KL KVK Sbjct: 76 QIPMAFLERVKDEFVSKYGGGKAATAPANGLNKEFGPKLKELMQYCVDHPEEISKLAKVK 135 Query: 121 AQVSEVKSIMLENIDKAIDRGENLTVLVDKTEDLRSQAQDYKNKGTQMTRKMWYQNMKIK 180 AQVSEVK +M+ENI+K +DRGE + +LVDKTE+L QAQD+++ GT+M RKMW QNMKIK Sbjct: 136 AQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLHQQAQDFRSTGTKMRRKMWLQNMKIK 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26517 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226758534 (147 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24208 (81 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8595 (98 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23179 (307 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs6613 63 3e-12 >Cs6613 Length = 344 Score = 63.2 bits (152), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 65/282 (23%), Positives = 111/282 (39%), Gaps = 72/282 (25%) Query: 21 TRIFVARIPQSVTEANFRSHFEKYGE-ITDLYMPKD-QSSKAHRGIGFITFENAGKVLDK 78 R+F+ +P++ TE FR E G + + + KD Q+ +RG F+ + N Sbjct: 49 NRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNA----- 103 Query: 79 QAFFVAD-SVEDLMADTHELGGSNIVVDRATPKEDDFRPVGRMAQQGGYGAYNAYISAAT 137 AD S + ++ +L G+ + A PK Sbjct: 104 ----CADYSRQKMLNANFKLDGNTPTISWADPK--------------------------- 132 Query: 138 RYAAVGAPTLYDHPVPGPAFPRGESARGLGKKIFVGRLPQEATSDDLRQYFGRFGRIVDV 197 + P +A K ++V +P +++ +++ F R G + V Sbjct: 133 ------------------STPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKV 174 Query: 198 YVPRDPKRTGHRGFGFVTFGEDGVAERVSR--RSHEICGQQVAIDTATPPEDAGTSGNF- 254 +P P ++G R FGF+ + E A + + +EI GQ + + A P D T G F Sbjct: 175 VMP--PGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFP 232 Query: 255 ----MMNNVEPFAGYGGPMRSYGRMYGSLDFDDWGYGIGSGI 292 ++ P AGYGG G YGS+ G+G+ +G Sbjct: 233 YSPGLVPTHLPHAGYGG---FAGTPYGSV---GTGFGVAAGF 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2796 (227 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7160 (279 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs54979 125 7e-31 >Cs54979 Length = 258 Score = 125 bits (313), Expect = 7e-31, Method: Compositional matrix adjust. Identities = 62/135 (45%), Positives = 87/135 (64%), Gaps = 1/135 (0%) Query: 3 GCKNVTMSNVHLIAPGDSPNTDGLHISTSSQIKVLNSVMATGDDCVSIGQGSHDITVKNV 62 GC+ V + + + +P SPNTDG+HI + + + NS+++ GDDC+SIG G D+ + +V Sbjct: 24 GCEGVMIDKLSISSPKLSPNTDGIHIENTKSVGIYNSMISNGDDCISIGTGCSDVDIADV 83 Query: 63 TCGPGHGISIGSLGKYADELSVSQIYVSNCTFRNTTNGARIKTWAGESAGEATGIIYEDI 122 TCGP HGISIGSLG + + VS I V N R + NG RIKTW G G + + +E+I Sbjct: 84 TCGPSHGISIGSLGAHYSQACVSNITVRNAIIRESDNGLRIKTWQG-GTGCVSDLSFENI 142 Query: 123 IMDQVQNPIIIDQNY 137 M+ V+N I IDQ Y Sbjct: 143 QMENVRNCINIDQYY 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8160 (389 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50353317 (85 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48273282 (88 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14404 (116 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48405783 (112 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10695 (225 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs10194 355 e-100 >Cs10194 Length = 251 Score = 355 bits (912), Expect = e-100, Method: Compositional matrix adjust. Identities = 184/251 (73%), Positives = 201/251 (80%), Gaps = 27/251 (10%) Query: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 MPIRNIAVG P E HPDALRAALAEFISTLIFVFAGEGSGMAF KLT + A TPSGLVA Sbjct: 1 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA 60 Query: 61 AALAHAF--------------------------IGGNISLLRGLLYWIAQLLGATVACGL 94 A++AHAF +GGNISLLRG+LYWIAQLLG+TVAC L Sbjct: 61 ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL 120 Query: 95 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 154 LK VTNGQTT+AF+LS GVG WNA VFEIVMTFGLVYTVYATA+DPKKGS+GTIAPIAIG Sbjct: 121 LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIG 180 Query: 155 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLISAGIPGVIHHFAFIG 214 FIVGANILAGGAFDGASMNPAVSFGPALVSWSW+NHWVYW GPLI G+ G+++ F FI Sbjct: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI- 239 Query: 215 NSRHDQPPPTD 225 N H+Q P T+ Sbjct: 240 NQSHEQLPTTE 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22927 (304 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48401035 (119 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764053 (127 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46598328 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5417 (142 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8059 (222 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs15890 118 4e-29 >Cs15890 Length = 150 Score = 118 bits (296), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 57/85 (67%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Query: 139 VWP-KLYITLSSKEKEEDFLAMKGCKLPQRPKKRAKLIQRSLLLVSPGAWLTDMCQERYE 197 VWP K I L++KEKEEDF+A+KG KLPQRPKKRAK IQR++ LVSPGAWL D+ ERYE Sbjct: 66 VWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKFIQRTVNLVSPGAWLCDLTLERYE 125 Query: 198 VREXXXXXXXXRGLKAMGSLETDSE 222 VRE RGLKAMGS+++DSE Sbjct: 126 VREKKISKKRPRGLKAMGSMDSDSE 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25701 (180 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs162106182 86 2e-19 >Cs162106182 Length = 107 Score = 86.3 bits (212), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Query: 93 KTWCSYSSEVKSLFKRLGVEPIVIELDELGPQGPQLQKVLERLTGQHTVPNVFIGGKHIG 152 KT C + VK LF++LGV IELD+ G +Q L TGQ TVPNVFIGGKHIG Sbjct: 20 KTLCPFCVSVKELFQQLGVTFKAIELDK-ESDGSDIQSALAEWTGQKTVPNVFIGGKHIG 78 Query: 153 GCTDTVKLYRKGELETLLSEASA 175 GC T L+R+G+L LL+EA A Sbjct: 79 GCDSTTALHREGKLVPLLTEAGA 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029556 (47 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10658 (189 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Cs36395 163 1e-42 >Cs36395 Length = 380 Score = 163 bits (412), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 77/125 (61%), Positives = 95/125 (76%), Gaps = 2/125 (1%) Query: 1 MEFGRFVWLQILLVFFCLCFSSIEGYKFYVGGKDGWVVNPSQSYSLWAEKNRFNINDTLH 60 MEF + + L + L F SS KF VGGK GWV NP ++Y+ W+ +NRF +NDTL Sbjct: 1 MEFQKSLCLSLAL--FAFFISSSHALKFNVGGKHGWVTNPGENYNKWSGRNRFLVNDTLF 58 Query: 61 FKYKKGSDSVLVVNKDDYFSCNTQNPIQKLDGGDSDFTVDRSGPFYFISGQNGNCQKGQK 120 FKYKKGSDSVL+VNKDDY SCNT+ P+ KLD GDS+F +DRSGPFYFISG + +CQKGQK Sbjct: 59 FKYKKGSDSVLLVNKDDYDSCNTKKPLLKLDSGDSEFKLDRSGPFYFISGNHDHCQKGQK 118 Query: 121 LLVIV 125 L+V+V Sbjct: 119 LIVVV 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50890345 (105 letters) Database: orange.as.orf 1113 sequences; 227,106 total letters Searching..................................................done ***** No hits found ****** Database: orange.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 227,106 Number of sequences in database: 1113 Lambda K H 0.313 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1113 Number of Hits to DB: 146,821,228 Number of extensions: 5922742 Number of successful extensions: 17580 Number of sequences better than 1.0e-10: 819 Number of HSP's gapped: 16598 Number of HSP's successfully gapped: 923 Length of database: 227,106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 133 (55.8 bits)