BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787194 (144 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv52403 190 1e-50 >Vv52403 Length = 221 Score = 190 bits (482), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 93/142 (65%), Positives = 111/142 (78%) Query: 3 KGVAVLGSSEGVKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTGPH 62 K VAVL + V+G + QE DGPTTV+ I+GL PG HGFH+H FGDTTNGC+STG H Sbjct: 71 KAVAVLKGTSSVEGVVTLSQEDDGPTTVSVRITGLTPGNHGFHLHEFGDTTNGCMSTGAH 130 Query: 63 FNPNGKEHGAPEDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHGDP 122 FNPNG HGAPED+ RHAGDLGN+ +G A T++D QIPL+GP++VIGRA+VVH Sbjct: 131 FNPNGMTHGAPEDDVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNAVIGRALVVHELE 190 Query: 123 DDLGKGGHELSKSTGNAGGRVA 144 DDLGKGGHELS +TGNAGGR+A Sbjct: 191 DDLGKGGHELSLTTGNAGGRLA 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5230 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14690 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19941 (329 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27821 117 3e-28 >Vv27821 Length = 418 Score = 117 bits (293), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 65/152 (42%), Positives = 95/152 (62%), Gaps = 12/152 (7%) Query: 87 PGPEPLSSAPPTKARMRWTQELHEAFVEAVDHLGGSERATPKGILNLMKVEGLTIYHVKS 146 PG L + K R++WT +LHE F+EAV+ LGG+++ATPK ++ LM + GLT+YH+KS Sbjct: 34 PGDSGLVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKS 93 Query: 147 HLQKYRTAR--YKPESSEGPYEKVSTLVDETNPLDMKG---------SMGITEALRLQVE 195 HLQKYR ++ + +S V + E N M S+ ++E L++ +E Sbjct: 94 HLQKYRLSKNLHGQANSATSKTVVGERMPEANGALMSSPNIGNQTNKSLHLSETLQM-IE 152 Query: 196 LQKRLHEQLENQRKLQLQIEEQGKCLEKMFEQ 227 Q+RLHEQLE QR LQL+IE QGK L+ + E+ Sbjct: 153 AQRRLHEQLEVQRHLQLRIEAQGKYLQAVLEK 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27558 (267 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226776838 (55 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32014 (282 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038911 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27666 138 4e-35 >Vv27666 Length = 612 Score = 138 bits (347), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 79/128 (61%), Positives = 92/128 (71%), Gaps = 9/128 (7%) Query: 3 RGRADGSQKKRLVTSVLVLVIICGLLYFY--SKKNGSSALEYGSK-IRKFGSTYLGVDED 59 RGRADGSQ++RL+ S+ V+ I LY Y S ALEYGS+ +RK G T D D Sbjct: 2 RGRADGSQRRRLLPSLCVVAIFLVFLYVYHGSIFGSQKALEYGSRSLRKLGLTG-DDDAD 60 Query: 60 VG----DSPPKLG-EDEEDGVILKSIPVCDDRHSELIPCLDRNLIYETRLKLDLSVMEHY 114 +G +S K G ED ED V+ KSIPVCDDRHSELIPCLDRNLIY+ RLKLDLS+MEHY Sbjct: 61 LGSKLDESSSKFGQEDGEDDVMPKSIPVCDDRHSELIPCLDRNLIYQMRLKLDLSLMEHY 120 Query: 115 ERHCPVPE 122 ERHCP+PE Sbjct: 121 ERHCPLPE 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91030313 (125 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10241 (311 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43587 211 1e-56 >Vv43587 Length = 324 Score = 211 bits (538), Expect = 1e-56, Method: Compositional matrix adjust. Identities = 104/214 (48%), Positives = 145/214 (67%), Gaps = 5/214 (2%) Query: 82 RVAETDDRSELF---EDMKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCP 138 ++ +D S F E MK F+ FK KY +N + LAKGQ+PKFMV +C+DSRVCP Sbjct: 103 QLKSSDGSSSPFDPVERMKTGFIYFKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCP 162 Query: 139 STILGFQPGEAFIVRNIANLVPSLES-GPSETNAALEFSVNSLKVENILVVGHSCCGGIR 197 S +L FQPG+AF+VRN+AN+VP+ + S +A+E++V LKVE+I+V+GHS CGGI+ Sbjct: 163 SHVLDFQPGDAFVVRNVANMVPAYDKIRYSGVGSAVEYAVLHLKVEHIVVIGHSSCGGIK 222 Query: 198 ALMSMD-DEIEKSSFIQNWVVVGKDARSWTKAAASTLSFDQQCKHCEKESINRSLLNLLT 256 LMS D + FI++WV +G A+S A L F +QC +CEKE++N SL NLL+ Sbjct: 223 GLMSFPFDGTSSTDFIEDWVKIGLPAKSKVVAECGDLPFPEQCAYCEKEAVNVSLGNLLS 282 Query: 257 YPWIEEKVKQGVLAVHGGYYDFVECTFEKWTLDY 290 YP++ E + + L + GGYYDFV+ TFE W LD+ Sbjct: 283 YPFVREGLVKKTLTLKGGYYDFVKGTFELWGLDF 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14919 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43587 93 1e-21 >Vv43587 Length = 324 Score = 92.8 bits (229), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 40/68 (58%), Positives = 53/68 (77%) Query: 1 MKQRFLDFKNHKYMENLEHYQNLAKGQAPKFMVISCADSRVCPSTILGFQPGEAFIVRNI 60 MK F+ FK KY +N + LAKGQ+PKFMV +C+DSRVCPS +L FQPG+AF+VRN+ Sbjct: 120 MKTGFIYFKKEKYDKNPALHAELAKGQSPKFMVFACSDSRVCPSHVLDFQPGDAFVVRNV 179 Query: 61 ANLVPSLE 68 AN+VP+ + Sbjct: 180 ANMVPAYD 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18766 (252 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13308 (108 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3144 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823645 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23118 (290 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3309 414 e-118 >Vv3309 Length = 273 Score = 414 bits (1064), Expect = e-118, Method: Compositional matrix adjust. Identities = 212/274 (77%), Positives = 219/274 (79%), Gaps = 2/274 (0%) Query: 18 VLGNSLGNFXXXXXXXXXXXXXXXFKTVALFSXXXXXXXXXXXXXXX-XDEELAKWYGPD 76 +LGN L NF FKTVALFS DEELAKWYGPD Sbjct: 1 MLGNPL-NFSGASRTAPSASSPATFKTVALFSKKKAAPAKAKPAAVSPADEELAKWYGPD 59 Query: 77 RRIFLPSGLLDRSEIPEYLTGEVPGDYGYDPFGLGKKPEDFSKYQAYELIHARWAMLGAA 136 RRIFLP GLLDRSEIP YLTGEVPGDYGYDPFGL KKPEDF+KYQAYELIHARWAMLGAA Sbjct: 60 RRIFLPEGLLDRSEIPAYLTGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAA 119 Query: 137 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFXXXXXXXXXXXXX 196 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIF Sbjct: 120 GFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFAVVAEVVLVGGAE 179 Query: 197 YYRITNGLELEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSMLGFFLQAYVT 256 YYRI NGL+LEDKLHPGGPFDPLGLA DPDQAALLKVKEIKNGRLAMF+MLGFF+QAYVT Sbjct: 180 YYRIINGLDLEDKLHPGGPFDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYVT 239 Query: 257 GEGPVENLSKHLSDPFGNNLLTVIGGSIERAPTL 290 GEGPVENL+ HLSDPFGNNLLTVI G+ ERAPTL Sbjct: 240 GEGPVENLAAHLSDPFGNNLLTVIAGTAERAPTL 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748222 (89 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9124 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60148 310 1e-86 >Vv60148 Length = 613 Score = 310 bits (794), Expect = 1e-86, Method: Compositional matrix adjust. Identities = 143/176 (81%), Positives = 159/176 (90%) Query: 1 MHAGTNPFEVITQAVKAVEKHMKTFVHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVVQG 60 MH+GTNPFEVI QAVKAVEKHM+TF+HREKKKLPSFLDWFGWCTWDAFYTDVTAEG+ +G Sbjct: 1 MHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGIEEG 60 Query: 61 LKSLSEGGTPPRFLIVDDGWQQIENKDKDSGVVVQEGAQFASRLTGIKENEKFQKNDHNN 120 L+SLS+GG PP+FLI+DDGWQQI N++KD+ VVQEGAQFA+RLTGIKENEKFQKN NN Sbjct: 61 LQSLSKGGAPPKFLIIDDGWQQIGNENKDNNCVVQEGAQFANRLTGIKENEKFQKNGRNN 120 Query: 121 EQVSGLKHVVDEAKQHHNVKFVYVWHALAGYWGGVKPAATGMEHYDTALIIPSVVP 176 EQV GLKHVV++AKQ HNVKFVYVWHALAGYWGGVKPAA GMEHY+ AL P P Sbjct: 121 EQVPGLKHVVEDAKQRHNVKFVYVWHALAGYWGGVKPAAAGMEHYECALAYPVQSP 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7379 (589 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60148 1032 0.0 >Vv60148 Length = 613 Score = 1032 bits (2669), Expect = 0.0, Method: Compositional matrix adjust. Identities = 488/597 (81%), Positives = 534/597 (89%), Gaps = 9/597 (1%) Query: 1 MHAGTNPFEVITQAVKAVEKHMKTFVHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVVQG 60 MH+GTNPFEVI QAVKAVEKHM+TF+HREKKKLPSFLDWFGWCTWDAFYTDVTAEG+ +G Sbjct: 1 MHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGIEEG 60 Query: 61 LKSLSEGGTPPRFLIVDDGWQQIENKDKDSGVVVQEGAQFASRLTGIKENEKFQKNDHNN 120 L+SLS+GG PP+FLI+DDGWQQI N++KD+ VVQEGAQFA+RLTGIKENEKFQKN NN Sbjct: 61 LQSLSKGGAPPKFLIIDDGWQQIGNENKDNNCVVQEGAQFANRLTGIKENEKFQKNGRNN 120 Query: 121 EQVSGLKHVVDEAKQHHNVKFVYVWHALAGYWGGVKPAATGMEHYDTALAYPVSSPGVEG 180 EQV GLKHVV++AKQ HNVKFVYVWHALAGYWGGVKPAA GMEHY+ ALAYPV SPGV G Sbjct: 121 EQVPGLKHVVEDAKQRHNVKFVYVWHALAGYWGGVKPAAAGMEHYECALAYPVQSPGVMG 180 Query: 181 NQPDIVMDSLTVHGLGLVHPKKVFNFYNELHSYLASCGVDGVKVDVQNIIETLGSGHGGR 240 NQPDIVMDSL+VHGLGLV P+ VFNFYNELH+YLASCGVDGVKVDVQNIIETLG+GHGGR Sbjct: 181 NQPDIVMDSLSVHGLGLVPPRTVFNFYNELHAYLASCGVDGVKVDVQNIIETLGAGHGGR 240 Query: 241 VSLTRSYHQALEASVARNFADNGCISCMCHNTDGLYSAKQTAVVRASDDFYPRDPASHTI 300 V+LTRSY QALEAS+ARNF DNGCISCMCHNTDGLYS KQTAVVRASDDFYPRDPASHTI Sbjct: 241 VALTRSYQQALEASIARNFTDNGCISCMCHNTDGLYSTKQTAVVRASDDFYPRDPASHTI 300 Query: 301 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARALGGCAIYVSDKPGHHNFDLLRK 360 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARA+GGCAIYVSDKPGHHNF+LLRK Sbjct: 301 HISSVAYNTLFLGEFMQPDWDMFHSLHPAAEYHGAARAVGGCAIYVSDKPGHHNFELLRK 360 Query: 361 LVLPDGSVLRAKLPGRPTRDCLFADPARDRTSLLKIWNVNNLSGVVGVFNCQGAGWCKIE 420 LVLPDGSVLRA+LPGRPTRDCLFADPARD TSLLKIWNVN SGVVGVFNCQGAGWCKIE Sbjct: 361 LVLPDGSVLRAQLPGRPTRDCLFADPARDGTSLLKIWNVNKCSGVVGVFNCQGAGWCKIE 420 Query: 421 KKTRIHDYSPGTLSGSVRAADVDAIAQVAGADWNGETAVYAHKSGEVLRLPKGASVPVTL 480 KKTR+HD SP TL+GSV AADVD IA VAG +W G+ VYA+KSGEV+RLP+GAS+PVTL Sbjct: 421 KKTRVHDTSPDTLTGSVCAADVDQIAHVAGTNWKGDVVVYAYKSGEVVRLPEGASLPVTL 480 Query: 481 KVLDYEVFHFCPLKEITSDVSFAPIGLLDMFNSSAAVEEVEIHLASDKKPELSNGEV--- 537 KVL++EVFHFCPLKEI +++SFAPIGLLDM NS AVE+ E+H+A + KPEL +GE+ Sbjct: 481 KVLEFEVFHFCPLKEIATNISFAPIGLLDMLNSGGAVEQFEVHMACE-KPELFDGEIPFE 539 Query: 538 -----SENRSPTATIGLKTRGCGRFGAYCSRRPLKCTDDNAETNLEYDSGCGLTTIT 589 SENRSPTATI L RGCGRFGAY S+RPLKC +AE YD GL T T Sbjct: 540 LSTSLSENRSPTATIALTARGCGRFGAYSSQRPLKCQVGDAEVEFSYDPNNGLLTFT 596 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17732 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7542 (285 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10294 527 e-152 >Vv10294 Length = 291 Score = 527 bits (1358), Expect = e-152, Method: Compositional matrix adjust. Identities = 242/284 (85%), Positives = 268/284 (94%) Query: 1 METKPSEMSSSKMFGGYNKRYKHFSPTLGCSMTFHIYFXXXXXXXHRFPVLYWLSGLTCT 60 ME KP+E+S SKMFGGYNKR+KHFSPTLGCSMTFH+YF H+FPVLYWLSGL+CT Sbjct: 1 MEAKPTEISGSKMFGGYNKRFKHFSPTLGCSMTFHVYFPPLPSPSHKFPVLYWLSGLSCT 60 Query: 61 DENFITKSGAQRVASSEGVALIALDTSPRGLSIEGEADSWDFGVGAGFYLNATEEKWKNW 120 DENFI KSGAQRVASSEG+AL+A DTSPRGL++EGEADSWDFGVGAGFYLNAT+EKWKNW Sbjct: 61 DENFIIKSGAQRVASSEGIALVAPDTSPRGLNVEGEADSWDFGVGAGFYLNATQEKWKNW 120 Query: 121 RMYDYVVKELPQLLNDNFSQLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN 180 +MYDYVVKELP++L++NF+QLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN Sbjct: 121 QMYDYVVKELPKVLSENFAQLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVN 180 Query: 181 PINCPWGQKAFSNYLGGNKTDWEEYDATSLIKKFNDVSGTILIDQGEDDKFLHDQLMPHK 240 P+NCPWGQKAF+NYLGGNK DWEEYDAT LI KFNDVS TILIDQGEDDKFLHDQL+PHK Sbjct: 181 PMNCPWGQKAFTNYLGGNKADWEEYDATCLISKFNDVSATILIDQGEDDKFLHDQLLPHK 240 Query: 241 FEEACQSAKVPLLLRLQPGYDHSYFFISTFIDDHIRHHAQALNL 284 FEEAC++AKVPLLLRLQPGYDHSY+FI+TFID HI+HHAQALN+ Sbjct: 241 FEEACKNAKVPLLLRLQPGYDHSYYFIATFIDHHIQHHAQALNM 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9154 (270 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12568 (272 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23746 399 e-113 >Vv23746 Length = 259 Score = 399 bits (1026), Expect = e-113, Method: Compositional matrix adjust. Identities = 208/273 (76%), Positives = 221/273 (80%), Gaps = 15/273 (5%) Query: 1 MATNENLPPNVIKQLAKELKSLDESPPEGIKVGVNDDDFSIIYADIEGPAGTPYENGVFR 60 MATNENLPPNVIKQLAKELK+LDE+PPEGIKV VNDDDFS I+AD+EGPAGTPYENGVFR Sbjct: 1 MATNENLPPNVIKQLAKELKNLDETPPEGIKVVVNDDDFSTIFADVEGPAGTPYENGVFR 60 Query: 61 MKLLLSWDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 MKLLLS DFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI Sbjct: 61 MKLLLSHDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 Query: 121 EPFPESALNEQAGKMLLENYEEYARHARLYTGIHA-KPKPKFKTGAISESTTALNVEQTN 179 EPFPESALNEQAGKMLLENYEEYARHAR+YTGIHA KPKPKFKTGAISESTTALNV+QTN Sbjct: 121 EPFPESALNEQAGKMLLENYEEYARHARIYTGIHALKPKPKFKTGAISESTTALNVDQTN 180 Query: 180 TSTLNADQKNTAPGAALPVISASPSPLAPITVTTRGNGQDQPAVVAPMEXXXXXXXXXXX 239 +S LN +QKNTA + PS LA T T G G+ AP Sbjct: 181 SSVLNVEQKNTA-------LQLPPSSLA--TCMTAGGGKGGGNGQAP-----TTETGVSG 226 Query: 240 XXXXXXXRKDGGLTKAQADKKKIDARKKSLKRL 272 +K+ GL K QADKKK+DARKKSLKRL Sbjct: 227 SAAATPHKKESGLAKVQADKKKMDARKKSLKRL 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21036 (153 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10347 96 2e-22 >Vv10347 Length = 316 Score = 96.3 bits (238), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 39/55 (70%), Positives = 50/55 (90%), Gaps = 1/55 (1%) Query: 15 PEQEQ-LKCPRCESSNTKFCYYNNYNLSQPRHFCKNCKRYWTKGGALRNIPVGGG 68 P+++Q + CPRC S+NTKFCYYNNY+L+QPR+FCK C+RYWT+GG LRN+PVGGG Sbjct: 43 PQKDQAVNCPRCSSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGG 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25724 (190 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21854 (425 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13448 (63 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414170 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12282 (268 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53234 301 8e-84 >Vv53234 Length = 261 Score = 301 bits (771), Expect = 8e-84, Method: Compositional matrix adjust. Identities = 156/260 (60%), Positives = 171/260 (65%), Gaps = 12/260 (4%) Query: 18 AALYNPRTVEEVFRDFKGRRTGMIKALTSDVEKFFQMCDPEKENLSLYGYPSEQWXXXXX 77 A YNPRTVEEVFRDFKGRR GMIKALT+DV++F+Q CDPEKENL LYG+P+E W Sbjct: 4 GANYNPRTVEEVFRDFKGRRAGMIKALTTDVDEFYQQCDPEKENLCLYGFPNELWEVNLP 63 Query: 78 XXXXXXXXXXXXXGINFARDGMAEKDWLSLVAVHSDAWLVSVAFYFGARFGFDKADRKRL 137 GINFARDGM EKDWLSLVAVHSDAWL++VAFYFGARFGFDKADRKRL Sbjct: 64 AEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADRKRL 123 Query: 138 FNMINELPTIFEVVTGTAKKQVXXXXXX----------XXXXXXXXXXXXARGSELHGRH 187 FNMIN+LPTIFEVVTGTAKKQV RGSE G++ Sbjct: 124 FNMINDLPTIFEVVTGTAKKQVKEKSSVSNHSSNKSKSNSKVVPQQQQPQQRGSESQGKY 183 Query: 188 SEVVQPKXXXXXXXXXXXXXXXXTCGACGGGGPSSLDEPWIFCDFCETWFHMKCVKMTPA 247 S+ Q CGACG S DE WI CD CE WFH KCVK+TPA Sbjct: 184 SKTPQKDEDEGLEEEEEDEHGETLCGACGENYAS--DEFWICCDICEKWFHGKCVKITPA 241 Query: 248 RAKQIKQYKCPSCSNKRARP 267 RA+ IKQYKCPSCSNKR+RP Sbjct: 242 RAEHIKQYKCPSCSNKRSRP 261 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29681 (323 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30587 91 3e-20 >Vv30587 Length = 355 Score = 90.9 bits (224), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 58/246 (23%), Positives = 122/246 (49%), Gaps = 5/246 (2%) Query: 12 VRARMSVASAVIFGSVFWRMGRSQTSIQDRMGLLQVAVINTAMAALTKTVGVFPKERAIV 71 R + + ++ GS+F+++ + ++R+GL ++ ++ T+ + +F +ER I+ Sbjct: 99 CRTLQMLIAGLVLGSIFYQLKDNLIGAEERVGLFAF-ILTFLLSCTTEALPIFLQERDIL 157 Query: 72 NREHAKGSYTLGPYLLSKLLAEIPVGSAFPLMFGAILYPMARLHPTLSRFGKFCGIVTVE 131 +E + GSY + Y ++ L +P ++F LY + L+P F F ++ + Sbjct: 158 MKETSSGSYRVSSYAIANGLVYLPFLLILAILFSLPLYLLVGLNPNFMAFMHFLLLIWLI 217 Query: 132 SFAASAMGLTVGAMVPTTEAAMAVGPSLMTVFLVFGGYYVNAENTPIIFRWIPSVSLIRW 191 + A+++ + A+VP +V +M F +F GY+++ P + ++ +SL ++ Sbjct: 218 LYTANSVVVCFSALVPNFIVGNSVISGVMGSFFLFSGYFISKNGMPDCWIFMHYISLFKY 277 Query: 192 AFQGLCINEF--RGLQFDHQHSYDIQNGEQALERISFG-GSHIRETLVAQSRILLFWYST 248 F+G INEF G D+ + GE L +G S R ++ ILL+ + Sbjct: 278 PFEGFLINEFSGSGKCLDYMFGTCVVKGEDVLREEGYGEESRWRNVVIMVCFILLYRF-I 336 Query: 249 TYLLLQ 254 +Y++L+ Sbjct: 337 SYVILR 342 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4715 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv45791 112 4e-27 >Vv45791 Length = 161 Score = 112 bits (279), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 62/157 (39%), Positives = 96/157 (61%), Gaps = 8/157 (5%) Query: 7 NEERKKVMVAIDESEFSLYAFNWALENLRETIQSS---QLVVFTAQPIDFASTYAASYGA 63 EE+ ++V +D+SE S YA W L++ + +LV+ A+P + A GA Sbjct: 3 TEEKSVMVVGVDDSEHSFYALQWTLDHFFAPFPGTAPFKLVIVHAKPSPTTAIGLAGPGA 62 Query: 64 APAQLVTSLLENHKKVALALLERAKEICAKHGIVPETVTEV--GDPKVVICEAVEKHNIQ 121 A ++ + + KK+A ++ +A EICA + + + EV GD + V+CEAVEKH+ Sbjct: 63 A--DVLPYVEADLKKIAGRVVGKAHEICASKSVT-DVILEVVEGDARNVMCEAVEKHHAS 119 Query: 122 LLVLGSHGRGGIQRAFLGSVSNYCVHNAKCPVLVVRK 158 +LV+GSHG G I+RA LGSVS+YC H+A C V++V+K Sbjct: 120 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25624 (273 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10279 (76 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042338 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27821 140 7e-36 >Vv27821 Length = 418 Score = 140 bits (354), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 73/125 (58%), Positives = 97/125 (77%), Gaps = 4/125 (3%) Query: 13 LVLSTDAKPRLKWTPELHQRFVEAVSQLGGADKATPKSLMRMMGIHGLTLYHLKSHLQKY 72 LVLSTDAKPRLKWTP+LH+RF+EAV+QLGGADKATPK++M++MGI GLTLYHLKSHLQKY Sbjct: 39 LVLSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKY 98 Query: 73 RLGKSQQSE-NSADIKQEDYKEIQSSDGHFGADISDEDHSQINESLQIAQSLQLQMEVQR 131 RL K+ + NSA K + + ++G + S +Q N+SL ++++LQ+ +E QR Sbjct: 99 RLSKNLHGQANSATSKTVVGERMPEANGALMS--SPNIGNQTNKSLHLSETLQM-IEAQR 155 Query: 132 KLHEQ 136 +LHEQ Sbjct: 156 RLHEQ 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8369 (469 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58110 91 4e-20 >Vv58110 Length = 313 Score = 90.9 bits (224), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 36/99 (36%), Positives = 60/99 (60%) Query: 16 WSQEEDDILRNQISTHGTENWAIIASKFKDKTTRQCRRRWYTYLNSDFKKGGWSPEEDML 75 WS EED+ L+ + HG NW++I+ ++ + CR RW L+ + ++PEED Sbjct: 15 WSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDAT 74 Query: 76 LCEAQKIFGNRWTEIAKVVSGRTDNAVKNRFSTLCKKRA 114 + A FGN+W IA+++ GRTDNA+KN +++ K++ Sbjct: 75 IIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKC 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424661 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31777 (243 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9947 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31437 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10162 (552 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2868 603 e-174 >Vv2868 Length = 513 Score = 603 bits (1556), Expect = e-174, Method: Compositional matrix adjust. Identities = 303/509 (59%), Positives = 375/509 (73%), Gaps = 34/509 (6%) Query: 34 RWIVDESGQRVKLACVNWVSHLDAVVAEGLSKQPVDAIAKRIASLGFNCVRLTWPLLLAT 93 RWIVDE G RVKLACVNW SH +A VAEGLS PVD I+KRIASLGFNCVRLT PL LA Sbjct: 37 RWIVDEDGARVKLACVNWPSHQEAPVAEGLSNHPVDLISKRIASLGFNCVRLTLPLFLAI 96 Query: 94 NETLAAVTVRQSFQSLGLLESISGIQSNNPALVDLPLLKAYQAVVSSLGSNNVMVILDNH 153 +++LA++TVRQSFQ LGLLES++G Q+NNP+++DLPL AYQAVVS+L NN+MVILD+H Sbjct: 97 DQSLASLTVRQSFQRLGLLESLAGFQANNPSMLDLPLTSAYQAVVSNLADNNMMVILDSH 156 Query: 154 LSTPGWCCXXXXXXXXXXXKYFNPDLWITGLTRMATLFKGVSNVVGMSLRNELRGPKQNV 213 S P + ++FNPDLW+ GLTR+AT+F GV NVVGMSLRNELR P QNV Sbjct: 157 FSEPSF-----HDNGVFGDQHFNPDLWVKGLTRIATMFSGVPNVVGMSLRNELRCPNQNV 211 Query: 214 DDWYKYMQRGAEAVHSANADVLVILSGLSFDTDLSFLAKRPVSLTFAGKTVFEVHWYGFS 273 DWY+YMQ+GAEAVHSAN DVLVI+SGLS TDLSFL + + LTF GK V E+HW+G Sbjct: 212 KDWYRYMQKGAEAVHSANPDVLVIISGLSDGTDLSFLLNQQLELTFTGKLVLEMHWHGSR 271 Query: 274 DGQAWKNGNPNQVCGQVYNNVKRKSGFLLDNGLPL-FVSEFGVDHRGTNVNDNRYLNCFM 332 G+A + NPN+VCG+V +++ R+ G LL G PL FVSE GVD DNR+LNCF Sbjct: 272 VGRAGETSNPNKVCGRVVDSIMRRGGVLLQQGWPLIFVSELGVD-------DNRHLNCFF 324 Query: 333 AAAAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQSPLQG 392 AAE D D+ALWTL EE G++NW NSS QR+S LQSPLQG Sbjct: 325 GLAAELDFDWALWTL-------------EETNGLMNW------NSSFFQRISALQSPLQG 365 Query: 393 PGLAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWAYSSRKVLTLKGTYFCIQA 452 P +++ R HKIIFHP+TGLC+L+ PLKLGPC++S AW Y+ +K+LT+KGTYFC+QA Sbjct: 366 PDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFCLQA 425 Query: 453 DKLNKPAAVGILCTTRNSQWDIISDSKLHLQSKTMDGTEVCLDVDSSNTVVTNSCNCLSR 512 L KPA + I+CT S W+IISDSK++L +K DGT VCLDVDSS+T+VT++C CL R Sbjct: 426 VGLGKPAKLSIICTKPGSNWEIISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKCLGR 485 Query: 513 DSSCDPGNQWFKLVDSTINSSPKSPMLEL 541 CDPG+QWFK+VDST + + P+L++ Sbjct: 486 GDMCDPGSQWFKVVDST--NITRRPILQI 512 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3389 (278 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 140 3e-35 >Vv12866259 Length = 264 Score = 140 bits (353), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 86/214 (40%), Positives = 117/214 (54%), Gaps = 34/214 (15%) Query: 71 PDRPLWFP--GSTPPPWLDGSLPGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAG 128 PDR L+ PP +L G PGD+G+D GLS+DP++ N++ E++HCRWAMLGA G Sbjct: 51 PDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG 110 Query: 129 IFIPEFLTKIGI-LNTPSWYTAGEQ-------EYFTDTT--------TLFVVELVLIGWA 172 PE L++ G+ W+ AG Q +Y + + ++ +++L+G Sbjct: 111 CVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAV 170 Query: 173 EGRRWADILKPGSVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIK 232 EG R A P TDP+ YPGG FDPLG PE EL+ KEIK Sbjct: 171 EGYRIAG--GPLGEVTDPL------------YPGGS-FDPLGLAD-DPEAFAELKVKEIK 214 Query: 233 NGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP 266 NGRLAM ++ G + Q I TG GP++NL HLADP Sbjct: 215 NGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91002989 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26624 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20929 64 2e-12 >Vv20929 Length = 268 Score = 63.9 bits (154), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 43/109 (39%), Positives = 58/109 (53%), Gaps = 17/109 (15%) Query: 113 ETTPMTIFYNGTVSVFN-VPLDKADSILKLALEGNS-RKAAEAALPVDPKLALHPS---- 166 +T MTIFY G V VFN P DKA +++LA G+S + P+D + PS Sbjct: 134 QTAQMTIFYGGQVIVFNDFPADKAKEVMRLAGMGSSPVPSTTVKNPIDAG-GMAPSTPNV 192 Query: 167 ----------EQQQQLVDPLSEYLPITRSKSLQRFLEKRKERLNAGSPY 205 E+ Q+ P++ LPI R SL RFLEKRK+R+ A +PY Sbjct: 193 VPNFANSLIQERIQRPAQPVACELPIARKASLHRFLEKRKDRITARAPY 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19021 (135 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16810 (182 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9402 (328 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46936 202 9e-54 >Vv46936 Length = 157 Score = 202 bits (513), Expect = 9e-54, Method: Compositional matrix adjust. Identities = 102/160 (63%), Positives = 131/160 (81%), Gaps = 3/160 (1%) Query: 1 MASNLPMSPQLEQIHGEIHDNFRALANGFQKLDKIKDSNRQSKQLEELTGKMRECKRLIK 60 M+S +S +L +I G+I D FRAL+NGFQKL+KIKD++RQS+QLEELTGKMRECKRLIK Sbjct: 1 MSSLAGISEELAEIDGQISDIFRALSNGFQKLEKIKDTSRQSRQLEELTGKMRECKRLIK 60 Query: 61 EFDREVKDEESRNPPDVNKQLNDEKQSMIKELNSYVQLRKTYMNSLGNKKVELFDMGAGV 120 EFDREVKD E RN P+ NK LN++KQSM+KELNSYV L+K Y +L NK+++LFD A Sbjct: 61 EFDREVKDLEIRNDPETNKMLNEKKQSMVKELNSYVALKKQYATNLENKRIDLFDAPA-- 118 Query: 121 SEPTADENVQMASAMSNQELINSGMKTMDETDQVIERSKK 160 + +ENV +AS+M+NQ+L+++G + MDETDQVIERSKK Sbjct: 119 -DDVGEENVLLASSMTNQQLMDNGNRMMDETDQVIERSKK 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15149 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15680 128 2e-32 >Vv15680 Length = 122 Score = 128 bits (322), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 56/112 (50%), Positives = 81/112 (72%) Query: 7 FKQEFSFDERLEESKSIIAKYPDRVPVIIERYSRTDLPEMEKKKFLVPRDMSVGQFIHIL 66 FKQE F++R E+ I KYPDR+PVI+E+ R+D+P ++KKK+LVP D++VGQF++++ Sbjct: 6 FKQEHDFEKRRAEAARIREKYPDRIPVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVI 65 Query: 67 SSRLHLTPGKALFVFVKNTLPQTAGRLDSIYETYKEDDGFLYMCYSSEKTFG 118 R+ L+ KA+F+FV N LP T + IY+ K+ DGFLY+ YS E TFG Sbjct: 66 RKRIKLSAEKAIFIFVDNVLPPTGAIMSGIYDEKKDADGFLYVTYSGENTFG 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26201 (339 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21994 (571 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv59489 161 3e-41 >Vv59489 Length = 375 Score = 161 bits (407), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 100/287 (34%), Positives = 156/287 (54%), Gaps = 12/287 (4%) Query: 126 IGQGTYSNVYKARDALSGKIVALKKVR--FDNLEPESVKFMAREILILRRLDHPNVVKLE 183 IG+G Y V ++ + ++VA+KK+ FDN K REI +LR LDH NV+ + Sbjct: 49 IGRGAYGIVCSVLNSETNEMVAIKKIANAFDN--HMDAKRTLREIKLLRHLDHENVIGIR 106 Query: 184 GLV---TSRMSCSLYLVFEYMEHDLAGLAASPAIKFTEPQVKCYMNQLLSGLEHCHNRYV 240 +V R +Y+ E M+ DL + S +E + ++ Q+L GL++ H+ V Sbjct: 107 DVVPPPLRREFSDVYIATELMDTDLHQIIRSNQ-GLSEEHCQYFLYQILRGLKYIHSANV 165 Query: 241 LHRDIKGSNLLIDNGGVLKIADFGLASFFDPNYKQPMTSRVVTLWYRPPELLLGATDYGV 300 +HRD+K SNLL++ LKI DFGLA N + MT VVT WYR PELLL ++DY Sbjct: 166 IHRDLKPSNLLLNANCDLKICDFGLARPTAEN--EFMTEYVVTRWYRAPELLLNSSDYTA 223 Query: 301 GVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIFKLCGSP--SDDYWKKSKLPHATIFKP 358 +D+WS GCI EL+ +P+ G+ V Q+ + +L G+P SD + ++ I + Sbjct: 224 AIDVWSVGCIFMELMNRRPLFAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQL 283 Query: 359 QQSYKRCIAETFKDFPPSSLPLIETLLAIDPAERRTATAALRNEFFT 405 Q ++ + F P ++ LI+ +L DP +R T AL + + + Sbjct: 284 PQHPRQPLVNVFPHIHPLAIDLIDRMLTFDPTKRITVEEALAHPYLS 330 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13025 (290 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5117 414 e-118 >Vv5117 Length = 304 Score = 414 bits (1065), Expect = e-118, Method: Compositional matrix adjust. Identities = 200/295 (67%), Positives = 239/295 (81%), Gaps = 5/295 (1%) Query: 1 MSLGPDGELQYPSQRRLGKN-KIPGVGEFQCYDENMLSVLKQHAEAAGNPLWGLGGPHDV 59 M LGPDGEL+YPS R+ K K+PGVGEFQCYD+NMLS+LKQHAEA GNP WGLGGPHD Sbjct: 10 MGLGPDGELRYPSHHRVSKRGKVPGVGEFQCYDKNMLSLLKQHAEATGNPYWGLGGPHDA 69 Query: 60 PSYDQSPNANNFFKDDGGSWESPYGDFFLSWYSNQLISHGDRLLDLVSSTFSDTEVEICG 119 P YD PN+NNFF++ GGSWE+PYGDFFLSWYSNQLISHG LL L S+ F ++ V I G Sbjct: 70 PQYDGMPNSNNFFREHGGSWETPYGDFFLSWYSNQLISHGSSLLSLASTVFCNSPVAISG 129 Query: 120 KVPLMHSWYKTRSHPSELTSGFYNTSSRDGYQAVAQMFARNSCKIILPGMDLSDEHQPQD 179 KVP++HSWYKTRSHPSELT+GFYNT +DGY+ +A++FA+NSCK+ILPGMDLSD+HQPQ+ Sbjct: 130 KVPVVHSWYKTRSHPSELTAGFYNTVDKDGYERIAEIFAKNSCKMILPGMDLSDDHQPQE 189 Query: 180 SLSSPELLLSQIKTACRKHGVEISGQNSSVSGAREGFQQIKKNLLGENA-INLFTYQRMG 238 SLSSPELLL+QIK+ACRK GV+ISGQNSSVSGA GF+Q+KKNLLGE+ ++LFTYQRMG Sbjct: 190 SLSSPELLLAQIKSACRKRGVQISGQNSSVSGAPGGFEQVKKNLLGEDGVVDLFTYQRMG 249 Query: 239 AXXXXXXXXXXXXXXVRSLNQPQLQSDDLPIEEEAV-ESVPTNSES--VVRMQTA 290 A VRSL+QP++ DD+P EEE V ES+P S S ++MQ A Sbjct: 250 AYFFSPEHFPSFTELVRSLSQPEMLWDDMPNEEEEVGESLPVGSSSDKNLQMQVA 304 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9578 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25993 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14204 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20845 (357 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28074 (237 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48415811 (61 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6654 125 2e-31 >Vv6654 Length = 311 Score = 125 bits (313), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 57/60 (95%), Positives = 59/60 (98%) Query: 1 MQKLAKELGVVIPVSFFEEANNAHYNSIAIIDADGADLGLYRKSHIPDGPGYQEKFYFNP 60 MQKLAKELGVVIPVSFFEEANNAHYNSIAI+DADG DLG+YRKSHIPDGPGYQEKFYFNP Sbjct: 91 MQKLAKELGVVIPVSFFEEANNAHYNSIAIVDADGTDLGIYRKSHIPDGPGYQEKFYFNP 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27514 (159 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20836 (131 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv40892 137 8e-35 >Vv40892 Length = 152 Score = 137 bits (345), Expect = 8e-35, Method: Compositional matrix adjust. Identities = 69/131 (52%), Positives = 79/131 (60%) Query: 1 MRDFXXXXXXXXXXXXRISQCVFAAGSIXXXXXXXXXXXXXXXCYLIASMGLQLIWSLVL 60 M+DF RISQC+FAAGSI CYLIASMGLQ+IWS L Sbjct: 1 MKDFPGTPGTWTGLILRISQCMFAAGSIASMATTSSFFSVTAFCYLIASMGLQVIWSFGL 60 Query: 61 ALLDAYSLVKKKVLHNPVLVSLFVVGDWXXXXXXXXXXXXXXXXXXXYFSDLNDCNYGRE 120 A LDAY+LVKKKVLHNPVLVSLFVVGDW Y+SD DC++G+E Sbjct: 61 AFLDAYALVKKKVLHNPVLVSLFVVGDWVTAILSLAAASASAGITVLYYSDFGDCDFGKE 120 Query: 121 CQKYQMAVGLA 131 CQKYQ++V LA Sbjct: 121 CQKYQISVALA 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5849 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49630969 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21241 (531 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49875 92 2e-20 >Vv49875 Length = 448 Score = 92.4 bits (228), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 44/90 (48%), Positives = 64/90 (71%), Gaps = 2/90 (2%) Query: 418 RTYTKVYKRG-AVGRSIDMTRYSNYDELKQDLARRFGIEGQLEDRGRVGWKLVYVDHEND 476 R+ TKV+K+G A+GRS+D+T+++NYDEL +L + F G+L + W +VY D E D Sbjct: 322 RSCTKVHKQGIALGRSVDLTKFNNYDELIAELDQLFEFGGELM-APKKNWLIVYTDDEGD 380 Query: 477 VLLVGDDPWEEFVNCVRCIKILSPQEVQQM 506 ++LVGDDPW+EF VR I I + +EVQ+M Sbjct: 381 MMLVGDDPWQEFCGMVRKIYIYTREEVQRM 410 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990436 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29054 (359 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19544 530 e-152 >Vv19544 Length = 354 Score = 530 bits (1364), Expect = e-152, Method: Compositional matrix adjust. Identities = 258/316 (81%), Positives = 277/316 (87%), Gaps = 11/316 (3%) Query: 55 IPEAGFPPNPFDFSAMTGLLNDPSIKELAEQIAKDPSFNQMADQLQKTFQGVSVDEGVPQ 114 +P AG P NPFDFSAMTGLLNDPSIKELAEQIAKDP+FNQMA+QLQKTF G +V+E +PQ Sbjct: 39 VPGAGLPTNPFDFSAMTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQ 98 Query: 115 FDSQQYYSTMQQVMQNPQFMTMAERLGSALMQDPSMNTMLESFANPSNKDQLEERMSRIK 174 FD+QQYYSTMQQVMQNPQFMTMAERLG+ALMQDPSM++MLE+ ANP++KDQLEERM+RIK Sbjct: 99 FDTQQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIK 158 Query: 175 EDPSLKPILEEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVGXXXXXXXXXX---XXXXX 231 EDPSLKPIL+EIETGGPAAMMRYWNDKDVLQKLGEAMGLAV Sbjct: 159 EDPSLKPILDEIETGGPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEEL 218 Query: 232 GNEDESIVHH--------TASVGDVEGLKAALASGADKDEEDSEGRTALHFACGYGEVKC 283 NEDESI HH TASVGDVEGLK ALASGADKDEEDSEGRTALHFACGYGEVKC Sbjct: 219 ANEDESIAHHHSESIVHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKC 278 Query: 284 AQALLEAGARVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL 343 AQ L+EAGA VDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL Sbjct: 279 AQILVEAGATVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL 338 Query: 344 NNQNDVLKLLEKDAFL 359 N+Q++VLKLLEKDAFL Sbjct: 339 NSQHEVLKLLEKDAFL 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4678 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14885 (269 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18640 (328 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990659 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925542 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22158 (438 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3256 (523 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819132 (185 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21057 (446 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23856 385 e-109 >Vv23856 Length = 418 Score = 385 bits (990), Expect = e-109, Method: Compositional matrix adjust. Identities = 183/360 (50%), Positives = 270/360 (75%), Gaps = 4/360 (1%) Query: 67 RLLKLERIKDYLLMEEEFVTN-QERLKPQEEKAEEDRSKVDDLRGSPMSVGNLEELIDEN 125 RL L+R +++ ++EE+V + Q+ LK + +A+E+ V ++ P+ +G E++D+N Sbjct: 43 RLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEE---VKRIQSVPLVIGQFMEMVDQN 99 Query: 126 HAIVSSSVGPEYYVGILSFVDKDQLEPGCAILMHNKVLSVVGLLQDEVDPMVSVMKVEKA 185 + IV S+ G YYV ILS ++++ L+P ++ +H ++V +L E D +S++ + Sbjct: 100 NGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEK 159 Query: 186 PLESYADIGGLDAQIQEIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAV 245 P +Y DIGG D Q QEI+EAVELPLTH ELY+ IGI PP+GV+LYG PGTGKT+LAKAV Sbjct: 160 PDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAV 219 Query: 246 ANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDAHS 305 AN T+A F+RVVGSE +QKYLG+GP++VR++FR+A + +P+I+FIDE+DA+ T R+DA + Sbjct: 220 ANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQT 279 Query: 306 GGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIK 365 G +RE+QR ++ELLNQ+DGFD +VKVI+ATNR ++LDPALLRPGR+DRKIEFPLPD + Sbjct: 280 GADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRR 339 Query: 366 TRRRIFQIHTSRMTLADDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHTDF 425 +R +FQ+ T++M L+D+V+LE++V D+ S A+I AIC EAG+ A+R+ R + DF Sbjct: 340 QKRLVFQVCTAKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDF 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25765 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2984 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30550 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6654 65 1e-12 >Vv6654 Length = 311 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 48/160 (30%), Positives = 75/160 (46%), Gaps = 6/160 (3%) Query: 113 IIDAAGASGVNVLCLQEAWTMPFAFCTREKR-WCEFAEPVDGESTRF-IQDLARKYNMVI 170 ++ A G N++ +QE + + FC ++ + + A+P G T +Q LA++ +VI Sbjct: 44 LVRDAHRKGANIILIQELFE-GYYFCQAQREDFFQRAKPYKGHPTILRMQKLAKELGVVI 102 Query: 171 ISPILERDVNHGDTIWNTAVXXXXXXXXXXKHRKNHIPRVGDFNESTYYMEGNTGHPVFE 230 E N +N+ +RK+HIP + E Y+ G+TG VFE Sbjct: 103 PVSFFEEANN---AHYNSIAIVDADGTDLGIYRKSHIPDGPGYQEKFYFNPGDTGFKVFE 159 Query: 231 TAYGKIAVNICYGRHHPLNWLAFGLNGAEIGFNPSATVGE 270 T + KI V IC+ + P A L GAEI P+A E Sbjct: 160 TKFAKIGVAICWDQWFPEAARAMVLQGAEILLYPTAIGSE 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30199 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29839 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6911 86 1e-19 >Vv6911 Length = 157 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 45/99 (45%), Positives = 57/99 (57%), Gaps = 7/99 (7%) Query: 2 RTGMFSYTTYEDQTNEPHFLDACHLCRKPLGNNSDIFMYRGNTPFCSKDCRQEQIKFDEN 61 R+ F +ED ++PHFL+AC LC KPLG+N DI+MYRG+TPFCS++CRQEQI+ DE Sbjct: 61 RSARFYDARFED--HQPHFLEACFLCNKPLGDNRDIYMYRGDTPFCSEECRQEQIEMDEA 118 Query: 62 XXXXXXXXXXXXXXDPNKNSTA-----NKTVRTGFVAVA 95 K S+ N RTG VA A Sbjct: 119 TEKNRSISSIKAFRKEQKTSSTPSKSQNYPFRTGTVAAA 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9815 (530 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55149 746 0.0 >Vv55149 Length = 523 Score = 746 bits (1927), Expect = 0.0, Method: Compositional matrix adjust. Identities = 354/480 (73%), Positives = 407/480 (84%), Gaps = 2/480 (0%) Query: 52 TQNGNFQPESA-SGTDXXXXXXXXXXXXLAYTLAKDGRRVHVIERDLSEPDRIVGELLQP 110 T NG + ++A D LA TL KDGRRV VIERDL+EPDRIVGELLQP Sbjct: 45 TANGECRSKTACEEADVIIVGAGVAGAALANTLGKDGRRVRVIERDLTEPDRIVGELLQP 104 Query: 111 GGYLKLIELGLEDCANESIDAQKVFGYALYKDGNDTKLSYPLENYPSDIAGRSFHNGRFI 170 GGYLKLIELGL+DC E IDAQ+VFGYAL+KDG +TKLSYPLE + SD+AGRSFHNGRFI Sbjct: 105 GGYLKLIELGLQDCVEE-IDAQRVFGYALFKDGKNTKLSYPLEKFDSDVAGRSFHNGRFI 163 Query: 171 QKMRERATALKNVTLEQGTVTTLIEEKGTVKGVMYKNKAGDEMRSYAPLTIVCDGCFSNL 230 Q+MRE+A L NV LEQGTVT+L+EEKGT++GV YK K G+ M +YAPLTIVCDGCFSNL Sbjct: 164 QRMREKAATLPNVQLEQGTVTSLLEEKGTIRGVNYKTKDGETMTAYAPLTIVCDGCFSNL 223 Query: 231 RRNLCTPKVDNPSCFVGLILENCDLPYANHGHVILGDPSPILFYPISGTEVRCLVDVPGT 290 RR+LCTPKVD PSCFVGL+LE+C+LP+ANHGHV+L DPSPILFY IS TE+RCLVDVPG Sbjct: 224 RRSLCTPKVDVPSCFVGLLLEDCELPFANHGHVVLADPSPILFYRISSTEIRCLVDVPGQ 283 Query: 291 KVPSVANGEMAKYLKNVVAPQVPPQLLRSFLAAVEKGNIRTMQNKSMPATPQPTPGAILL 350 KVPS++NGEMAKYLK VVAPQ+PP+L F+AA+ KGNIRTM N+SMPA P PTPGA+L+ Sbjct: 284 KVPSISNGEMAKYLKTVVAPQIPPELYDGFIAAINKGNIRTMPNRSMPAAPHPTPGALLM 343 Query: 351 GDAFNMRHPLTGGGMTVALSDIVXXXXXXXXXXXXNDAPALCEYLESFYTLRKPVSSTIN 410 GDAFNMRHPLTGGGMTVALSDIV NDA LC+YLESFYTLRKPV+STIN Sbjct: 344 GDAFNMRHPLTGGGMTVALSDIVVLRDLLGPLHDLNDAATLCKYLESFYTLRKPVASTIN 403 Query: 411 TLAGALYKVFCASPDPARQEMREACFDYLSLGGICARGPISLLSGLNPRPIHLFLHFFAV 470 TLAGALY+VFCASPD AR+EMR+ACFDYLSLGG+C+ GP+SLLSGLNPRP+ L HFFAV Sbjct: 404 TLAGALYRVFCASPDQARKEMRDACFDYLSLGGVCSSGPVSLLSGLNPRPLSLVCHFFAV 463 Query: 471 AVYGVGRLMIPFPTPKRVWLGTRLILGASGIIFPIIKGEGVRQMFFPATIPAYYRAPPLQ 530 A++GVGRL++PFP+PKRVW+G R+I GASGIIFPIIK EGVRQMFFPAT+PAYYRAPP++ Sbjct: 464 AIFGVGRLLLPFPSPKRVWIGARIISGASGIIFPIIKAEGVRQMFFPATVPAYYRAPPVK 523 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6578 (273 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48281431 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11167 324 5e-91 >Vv11167 Length = 492 Score = 324 bits (831), Expect = 5e-91, Method: Compositional matrix adjust. Identities = 150/178 (84%), Positives = 167/178 (93%) Query: 1 MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPIGPVLLEDYHLVEKLANFDRERIP 60 MDPYKYRPSSA+NSPFWTTN+GAPV NNNSSLTVGP GP+LLEDYHLVEKLANFDRERIP Sbjct: 1 MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP 60 Query: 61 KRVVHARGASAKGFFDVTHDISHLSCADFLRAPGVQTPVIVRYSTVIHERGSPETIRDPR 120 +RVVHARGASAKGFF+ THDIS+L+CADFLRAPGVQTPVI+R+STVIHERGSPET+RDPR Sbjct: 61 ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR 120 Query: 121 GFAAKFYTGEGNWDLVGNNLPAFFVRDAVKFPDVIHAFKPNPKSHIQEYWRVLDFLSH 178 GFA KFYT EGN+DLVGNN P FF+RD +KFPD++HA KPNPKSHIQE WR++DF SH Sbjct: 121 GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSH 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18747 (259 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2535 (111 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265691 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31509 (399 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv766258 672 0.0 >Vv766258 Length = 399 Score = 672 bits (1733), Expect = 0.0, Method: Compositional matrix adjust. Identities = 322/399 (80%), Positives = 352/399 (88%) Query: 1 MQAASKRVGRQYLTQXXXXXXXXXXXXXXDHYYGADRPKYGSTLATKGVGHLVRKGTGGR 60 MQA S+R+G Q Q DHYYGAD P+ GSTLA KGVGHLVRKGTGGR Sbjct: 1 MQALSRRLGHQSFNQSPAISSLKSIYPLSDHYYGADHPRLGSTLAPKGVGHLVRKGTGGR 60 Query: 61 SSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY 120 SSVSGIVA VFG+TGFLGRY+VQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY Sbjct: 61 SSVSGIVAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMKY 120 Query: 121 NPRDEDSIKAVMSKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQV 180 NPRDE+SIKAVM+KANVV+NLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQV Sbjct: 121 NPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMISKEHGGIMRFIQV 180 Query: 181 SCLGASSSSPSRFLRTKAAAEEAVLSELPEATILRPAVMVGTEDRILNRWAFFAKKYGFL 240 SCLGAS SSPSR L KAAAEEAVL ELPEATI+RPAVM+GTEDRILNRWA FAKKYGFL Sbjct: 181 SCLGASPSSPSRMLMAKAAAEEAVLRELPEATIMRPAVMIGTEDRILNRWAQFAKKYGFL 240 Query: 241 PLIGDGSTKFQPVYVVDVAGAIVAALKDDGTSMGKVYELGGPEIFTMHQLAELMFDTIRE 300 PL GDGSTKFQPVYV+DVA AI+AALKDDGTSMGKVYELGGPEIFTMH+LA +M+DTIRE Sbjct: 241 PLYGDGSTKFQPVYVIDVAAAIMAALKDDGTSMGKVYELGGPEIFTMHELAAVMYDTIRE 300 Query: 301 WPRYVKVPLPIAKAMGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALSFNDL 360 WPRYVKVP PIAKAM PREILLNKVPFPLP P +FN D I A +DT+VSENAL+F+DL Sbjct: 301 WPRYVKVPFPIAKAMTLPREILLNKVPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDL 360 Query: 361 GLVPHKLKGYPIEFLIQFRKGGPNYGSTVSERVSPDAWP 399 G+VPHKLKGYPIEFL+ +RKGGP +GST+SERV P+A+P Sbjct: 361 GIVPHKLKGYPIEFLLSYRKGGPQFGSTISERVDPEAFP 399 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418557 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21116 (230 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv1166261 163 3e-42 >Vv1166261 Length = 148 Score = 163 bits (412), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 77/137 (56%), Positives = 94/137 (68%) Query: 82 VDETYIMVKPDGVQRGLVGEIISRFEXXXXXXXXXXXXQCPQDLAEEHYKDLKGKSFFPK 141 +++T+IM+KPDGVQR LVGEII RFE + AE+HY+DL K FF Sbjct: 1 MEQTFIMIKPDGVQRNLVGEIIGRFEKKGFSLKGLKLLSVERGFAEKHYEDLSSKPFFNG 60 Query: 142 LIEYIVSGPVVCMAWEGVGVVAAVRKLIGATNPLQAEPGTIRGDLAVQTGRNVVHGSDSP 201 L+EYI+SGPVV M WEG VV RK+IGATNP + PGTIRGD AV GRNV+HGSDS Sbjct: 61 LVEYIISGPVVAMIWEGKNVVTTGRKIIGATNPSDSAPGTIRGDFAVDIGRNVIHGSDSV 120 Query: 202 ENGKREIALWFKEGELC 218 + ++EIALWF EG + Sbjct: 121 GSARKEIALWFPEGPVA 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486818 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8716 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17040 80 4e-17 >Vv17040 Length = 210 Score = 79.7 bits (195), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 57/213 (26%), Positives = 97/213 (45%), Gaps = 33/213 (15%) Query: 35 KRLILIGPPGSGKGTQSPIIKDDYCLCHLATGDMLRAAVSAKTPLGVKAKEAMDKGELVS 94 K + ++G PGSGKGTQ I + HL+ GD+LRA + + + G + + +G++V Sbjct: 23 KVVFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAEIKSGSENGNMIQSMIKEGKIVP 82 Query: 95 DDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQAEKLDEMLKKQGAKIDKVLNFAVDDAIL 154 ++ + ++ A+ + S K F++DGFPR + + K + + VL F + + Sbjct: 83 SEVTIKLLQRAILEDSNDK-FLIDGFPRNEENRAAFEAVTKIEP---EFVLFFDCSEEEM 138 Query: 155 EERITGRWIHPSSGRSYHTKFAPPKAPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTE 214 E RI R + G R+DD ++ R + F + + Sbjct: 139 ERRILNR----NQG-------------------------REDDNVETIRKRFKVFLESSL 169 Query: 215 PVIGYYSQKGIVANLQAEKPPQEVTSKVHKVLS 247 PVI YY KG V + A + +EV V V + Sbjct: 170 PVIEYYESKGKVRKIDAAQSIEEVFEAVKAVFT 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32739 (279 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv38144 316 3e-88 >Vv38144 Length = 274 Score = 316 bits (810), Expect = 3e-88, Method: Compositional matrix adjust. Identities = 164/230 (71%), Positives = 180/230 (78%), Gaps = 3/230 (1%) Query: 19 FNRHHSTRTPQVATPKQFPPVQCQKSSFQGLSLGEAKRGVLYSLVADLNNRSGLGNNVRR 78 F R HS + PK P Q QK++FQGLSL +AKRG S++A ++RS + VRR Sbjct: 17 FTRTHSIKPSSTPPPKPLTPSQSQKTTFQGLSLQDAKRGFSNSVLA-ADSRSSFAS-VRR 74 Query: 79 GLRVTARTAGAAKSIEAEVDKPLGLTLGQKPGGPVTITAVDXXXXXXXXXXXXXDQVIYT 138 GL +TARTAGAAK+IE EVDKPLGLTLGQK GG V ITAV+ DQV+YT Sbjct: 75 GLEITARTAGAAKNIEVEVDKPLGLTLGQKSGGGVVITAVEGGGNAAKAGLKAGDQVLYT 134 Query: 139 SSFFGDELWPADKLGFTKTAINAKPDSVYFVVSRGGAPVDVKRLPKRPAPPRFGRKLTEA 198 SSFFGDELWPADKLGFTKTAI AKPDSVYFVVSR GA VDVKRLPKRPAPPRFGRKLTEA Sbjct: 135 SSFFGDELWPADKLGFTKTAIQAKPDSVYFVVSR-GAEVDVKRLPKRPAPPRFGRKLTEA 193 Query: 199 QKARATHICLDCGFIYTLQKPFDEQPDSYTCPQCLAPKKRFAQYDVNTGK 248 QKARATHICLDCGFIYTL KPF+EQ D+Y CPQC APKKRFA+YDV TGK Sbjct: 194 QKARATHICLDCGFIYTLTKPFEEQSDAYVCPQCSAPKKRFARYDVVTGK 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797885 (84 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11372 (541 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32041 164 3e-42 >Vv32041 Length = 333 Score = 164 bits (416), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 2/160 (1%) Query: 4 LSMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVIQTT 63 LS SLP GFRF PTD EL+ YL K+ G + +I EID+ K +PW LP ++ Sbjct: 9 LSQLSLPPGFRFYPTDEELLVQYLCRKVAGQGFSLEIIGEIDLYKFDPWVLPSKAIF--G 66 Query: 64 DPEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDKILIGMKKTLVFHIGRAPK 123 + EW+FF P+DRKYPNG R NR GYWKATG D+ I ++ +G+KK LVF+IG+APK Sbjct: 67 EKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFYIGKAPK 126 Query: 124 GKRTNWVMHEYRATQKELDGTNPGQSSFVLCRLFKKQDET 163 G +TNW+MHEYR + + +VLCR++KK + Sbjct: 127 GTKTNWIMHEYRLLENSRKNGSSKLDDWVLCRIYKKNSNS 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48694241 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17866264 129 2e-32 >Vv17866264 Length = 310 Score = 129 bits (323), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 64/103 (62%), Positives = 72/103 (69%) Query: 3 SYCLCISQNRERSYLAARPAFYNYIFVMFVLCALASFGCGLAGIGASFGIWLYNLTDICY 62 + L + ++ R L ARPAFY YI +M L ALA F CGL G GA FG WLY LT I Y Sbjct: 208 GFILFMYHSKWRERLPARPAFYKYITIMCCLNALALFACGLTGNGAGFGFWLYGLTMIFY 267 Query: 63 HTLYLPSLYMIFVADFFQEESFLLENAYYSEMKDAGFFDADWD 105 H YLP LY+ F+ADFFQEE LEN YYSEMKDAGFFDADW+ Sbjct: 268 HAFYLPLLYITFLADFFQEEDLHLENVYYSEMKDAGFFDADWE 310 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48402402 (102 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275638 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21155 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5847 (127 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25185 (151 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71923032 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3769 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5666259 241 6e-66 >Vv5666259 Length = 300 Score = 241 bits (615), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 117/161 (72%), Positives = 129/161 (80%), Gaps = 7/161 (4%) Query: 1 MSRTCSQCGNNGHNSRTCSDVSGGGCGGPIAENGIMLFGVRVTEGNAFRKSVSMNNLSQY 60 MSR+CSQCGNNGHNSRTC++ G G A N IMLFGVR+TEG AFRKS SM NLSQY Sbjct: 1 MSRSCSQCGNNGHNSRTCTESGGAGA----AANDIMLFGVRITEG-AFRKSASMTNLSQY 55 Query: 61 ERPQQADTNAEAGYASDEVVHASGHRRERRRGVAWTEEEHKLFLVGLQMVGRGDWRGISR 120 E+PQ D+NA+AGYASD+VVHAS RER+RGV WTEEEH+LFL+GLQ VG+GDWRGISR Sbjct: 56 EQPQ--DSNADAGYASDDVVHASARSRERKRGVPWTEEEHRLFLLGLQKVGKGDWRGISR 113 Query: 121 NFVKTRTPTQVASHAQKYFLXXXXXXXXXXXSSLFDITTDT 161 NFVKTRTPTQVASHAQKYFL SSLFDIT DT Sbjct: 114 NFVKTRTPTQVASHAQKYFLRRNNHNRRRRRSSLFDITADT 154 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7018 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3293 116 3e-28 >Vv3293 Length = 184 Score = 116 bits (290), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 71/196 (36%), Positives = 91/196 (46%), Gaps = 18/196 (9%) Query: 1 MGNCQAIDAAALVIQHPSGKLERMYWPISASEVMRLNPGHYVSLIIPLPVSEQDHEQVAE 60 MGNCQAIDAA LVIQ+P GK +++YWP+SASE+M++NPGHYV+L+I Sbjct: 1 MGNCQAIDAATLVIQYPCGKADKLYWPVSASELMKMNPGHYVALLI------TTTLCPTT 54 Query: 61 NHEEEHGKAVRFTRVKLLRPNETLALGHAYRLVTXXXXXXXXXXXXXXXXXXXXXXXRTG 120 +VR TRVKLLRP +TL LG YRL+T Sbjct: 55 ATTTTGPSSVRITRVKLLRPTDTLVLGQVYRLITAEEVMKALWAKKYAKMKKTQAASADM 114 Query: 121 QGKEN----SGCEEAAAEVKSDEKENNKHASKRERHRSRTSSXXXXXXXXXXXXXXXXXX 176 G+ N G E V+ E E N ++ ER R Sbjct: 115 AGRVNEKLGGGLE---FTVRRSEMEKNHQMARHERGHERGRGRTAAASAGANSATA---- 167 Query: 177 LRSKSWRPSLQSISEG 192 R ++W+PSL SI EG Sbjct: 168 -RPRTWQPSLHSILEG 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3034 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35116 381 e-108 >Vv35116 Length = 336 Score = 381 bits (979), Expect = e-108, Method: Compositional matrix adjust. Identities = 177/218 (81%), Positives = 196/218 (89%), Gaps = 2/218 (0%) Query: 4 PEVPADVLQATSNSTT--TGYSKRAFVTFLAGDADYVKGVVGLAKGLRKVKSEYSLVVAI 61 P VPADV A +T GYSK A+VTFLAG+ DYVKGVVGLAKGLRKVKS Y LVVA+ Sbjct: 3 PGVPADVFTAGGKVSTLNAGYSKGAYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAM 62 Query: 62 LPDVPEEHREILRSQGCIVQEIEPIYPPENQIKFAMAYYVINYSKLRIWNFEEYSKMIYL 121 LPDVPEEHREIL+SQGCI++EIEPIYPPENQI+FAMAYYVINYSKLRIWNFEEYSKM+YL Sbjct: 63 LPDVPEEHREILKSQGCIIREIEPIYPPENQIQFAMAYYVINYSKLRIWNFEEYSKMVYL 122 Query: 122 DADIQVYENIDHLFATPNGYFYAVMDCFCEKTWSHSPQHKIGYCQQCPDKVSWPADMGSP 181 DADIQVY+NIDHL P+GYFYAVMDCFCEKTWSH+PQ+ +GYCQQCPDKV+WPA+MGSP Sbjct: 123 DADIQVYDNIDHLMDAPDGYFYAVMDCFCEKTWSHTPQYSVGYCQQCPDKVTWPAEMGSP 182 Query: 182 PPLYFNAGMFVFEPSRLTYNSLLQTLQVVPPTPFAEQE 219 PPLYFNAGMFVFEPSRLTY SLL TL++ PPT FAEQ+ Sbjct: 183 PPLYFNAGMFVFEPSRLTYESLLHTLRITPPTAFAEQD 220 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24077 (232 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20266261 188 8e-50 >Vv20266261 Length = 185 Score = 188 bits (477), Expect = 8e-50, Method: Compositional matrix adjust. Identities = 120/226 (53%), Positives = 131/226 (57%), Gaps = 43/226 (19%) Query: 8 LTKVTTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVPRSISFSELSSKLTELCGPSVT 67 +T TIKFLCSYGGKILPRYPDGKLRY GGETRVLAV RSISF+EL KL ELCG SV Sbjct: 2 VTSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDRSISFAELLVKLGELCGKSVC 61 Query: 68 AVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAAS-SANMKIRAFLSLIPTARTPKXX 126 LRCQLPTEDLDALVS+ SDEDL NLIEEYDR AS A++KIRAFLS P K Sbjct: 62 ---LRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRAFLS--PPKSIKK-- 114 Query: 127 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPRFPMPSSTPVDRCLRQMPPQPSPST 186 RF MP++ VD C Q+ PQ Sbjct: 115 ----------------ISPPPSSASSSQLSVASASRFTMPAA--VDLCHHQISPQ----- 151 Query: 187 VPFQRPPSKVPHCANIYHARQGHGSNKPASTTGSRPYLVHNGNHWQ 232 VPFQ+ KVPH YH HG+ S YL+HNGNHWQ Sbjct: 152 VPFQKSSRKVPHYG--YHV---HGNP-------SHVYLIHNGNHWQ 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16052 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17893 (156 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv941 266 2e-73 >Vv941 Length = 185 Score = 266 bits (679), Expect = 2e-73, Method: Compositional matrix adjust. Identities = 130/156 (83%), Positives = 136/156 (87%), Gaps = 1/156 (0%) Query: 1 QNTRETAFAIRKLPLVKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPV 60 +NTRETA AIRKLPL KAKRYLEDVL HKQAIPF RFCRGVGRTAQAKNRHSNGQGRWPV Sbjct: 27 KNTRETAHAIRKLPLAKAKRYLEDVLVHKQAIPFTRFCRGVGRTAQAKNRHSNGQGRWPV 86 Query: 61 KSAKFILDLLKNAESNAEVKGLDVDSLIVSHIQVNQAQKQRRRTYRAHGRINPYMSSPCH 120 KSAKFILDLLKNAESNA++KGLDVDSL +SHIQVNQAQKQRRRTYRAHGRINPYMSSPCH Sbjct: 87 KSAKFILDLLKNAESNADLKGLDVDSLYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCH 146 Query: 121 IELILSXXXXXXXXXXXSQLTTSKSKKSALRSGASS 156 IELILS +QL T KSKKS LR GAS+ Sbjct: 147 IELILSEKEEPVKKEPETQLATGKSKKS-LRGGAST 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28515 (300 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22665 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv511 253 1e-69 >Vv511 Length = 309 Score = 253 bits (647), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 118/148 (79%), Positives = 131/148 (88%) Query: 10 YGKPPWIFRGSALYQLHLVKAATVRACIPKEFRLVEAFGYTLGGFFLANYDDSPVGIFDE 69 YGKPPWIF+G ALYQLHLVKA T RA IPKEFRLVEAFGYTLGGFFLA+Y+DSP G+FDE Sbjct: 17 YGKPPWIFKGRALYQLHLVKAETARAFIPKEFRLVEAFGYTLGGFFLASYEDSPAGVFDE 76 Query: 70 LVVIAGLVWSPPTSCAWAAKVLVNSDEACDHGRKEVGLPSQVARFSKRITAVSRQPKSKN 129 LVVIAG+VW+PPTSCAWAA+VLVNSDEAC HGRK VGLPSQVARFSKRITA+ RQ +SK Sbjct: 77 LVVIAGIVWNPPTSCAWAARVLVNSDEACVHGRKAVGLPSQVARFSKRITAIPRQQRSKT 136 Query: 130 IGFLSVIGSSAAFCDPKDCMEVQVTEIK 157 GFL++IG F PKDCM+VQVTEI+ Sbjct: 137 NGFLNMIGIGNTFNSPKDCMDVQVTEIE 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10941 (218 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21867 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7890 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15082 372 e-105 >Vv15082 Length = 369 Score = 372 bits (956), Expect = e-105, Method: Compositional matrix adjust. Identities = 178/211 (84%), Positives = 191/211 (90%), Gaps = 3/211 (1%) Query: 1 MAVKKASESFSKSLIDEVQRWGCMKQTGVSLRYMMEFGSRPTQRNFIISAQFLHKELPIR 60 MAVKK ES+SKS EVQRWGCMKQTGVSLRYMMEFGSRPT++N +ISAQFLHKELPIR Sbjct: 1 MAVKKLCESYSKSFRGEVQRWGCMKQTGVSLRYMMEFGSRPTEKNLLISAQFLHKELPIR 60 Query: 61 IARRAIELESLPYGLSEKPAVLKVRDWYLDSFRDLRTFPDIKDAKDEKDFTQMIKAIKVR 120 IARRAIELESLPYGLSEKPAVL+VRDWYLDSFRDLR FP+IKD DE +FTQMIK IKVR Sbjct: 61 IARRAIELESLPYGLSEKPAVLEVRDWYLDSFRDLRAFPEIKDKNDELEFTQMIKMIKVR 120 Query: 121 HNNVVPMMALGVQQLKKE---KVLYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP 177 HNNVVP MALGVQQLKK K++YEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP Sbjct: 121 HNNVVPTMALGVQQLKKGINVKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP 180 Query: 178 PPHCVGYIDTKMSPMEVARNATEDARXMCLR 208 P CVGYI TKMSP+EVAR+A+EDAR +CLR Sbjct: 181 APDCVGYIHTKMSPVEVARSASEDARSICLR 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6285 (393 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16735 751 0.0 >Vv16735 Length = 391 Score = 751 bits (1940), Expect = 0.0, Method: Compositional matrix adjust. Identities = 361/390 (92%), Positives = 372/390 (95%) Query: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLTQDPDSKVACETCTKTNMVMVFGEITTK 60 METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK Sbjct: 1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTK 60 Query: 61 ANVDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFSKRPEEIGA 120 A++DYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGH +KRPEEIGA Sbjct: 61 ADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA 120 Query: 121 GDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNGTCAWLRPDGKTQVTIEYFNDK 180 GDQGHMFGYATDETPELMPL+HVLATKLGA+LTEVRKNGTC+WLRPDGKTQVT+EY N+ Sbjct: 121 GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYHNEN 180 Query: 181 GAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI Sbjct: 181 GAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI 240 Query: 241 GGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 GGPHGDAGLTGRKIIIDTY KDPTKVDRSGAYIVRQAAKSIVANGLAR Sbjct: 241 GGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLAR 300 Query: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNG 360 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGNG Sbjct: 301 RCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNG 360 Query: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWDK 390 RFLKTAAYGHFGRDDPDFTWEVVKPLKW+K Sbjct: 361 RFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 149780162 (363 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4758 218 2e-58 >Vv4758 Length = 383 Score = 218 bits (554), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 138/382 (36%), Positives = 202/382 (52%), Gaps = 39/382 (10%) Query: 8 VPEAYPMNGGDGAYSYTKNSNCQRAAANVSKSLLDDAIAEKLDVEDFSCNPSNAFRIADL 67 V + M GGDG SY NS Q+ K +L+++I E L + FS +IADL Sbjct: 3 VQQVLCMKGGDGEASYANNSLLQKKVILEVKPILEESITE-LYCKTFS----ECLKIADL 57 Query: 68 GCSVGPNTFFSVQNILEAVKHKYQSQC--ISSQMPEFQVFFSDHVANDFNTLFASLPP-- 123 GCS GPNTF + I++ + + C S + P FQ+F +D NDFN +F SL Sbjct: 58 GCSSGPNTFLPLWEIIDCIG----ATCSRFSREPPAFQIFLNDLPQNDFNAIFKSLARFY 113 Query: 124 ----------ERQYFAAGVPGSFHGQLFPKSSLHFVHSSYAAHWLSKVPEQVVDKNSPAW 173 RQ F GVPGSFH +LFP S+HF HSSY+ HWLS+VPE +V ++ Sbjct: 114 ERIEKEKEGMSRQCFIVGVPGSFHRRLFPDRSIHFFHSSYSLHWLSQVPEGLVSESGTPL 173 Query: 174 NKGKIYYT-TSPDEVVDAYAAQFGKDMTAFLEARAKELVVGG-MMVIIMQAIPNGTPPSR 231 NKG I+ T T+P V AY QF +D TAFL R++E++ GG M++ +M + NG S Sbjct: 174 NKGNIHLTVTTPPSVHKAYLNQFERDFTAFLRLRSQEIIPGGHMLLTLMGSDGNGQNSST 233 Query: 232 IPNGIMFDFLGSTLMEIAKEGLISEGEVDSFNIPTYNTTPKEMMEVIERNGCFSIARIES 291 + + + TL ++ EG I E E+DSFNIP + +P+++ VI+R F++ R+E+ Sbjct: 234 DGLYKICELISMTLKDMVTEGSIQESELDSFNIPLFMPSPEQVRSVIQRESSFTLLRLET 293 Query: 292 TS-PWS------KAGHMINGPG----LTMQLRAGMEGVFKTHFGTEITDQMFDRVYEKSG 340 W + + G + M +RA E + +HFG + D +F R + K Sbjct: 294 FKLDWDDNIDDGNKDQVFDKYGRAKYVVMYIRAVGEPILASHFGGAVMDSLFHRFFMK-- 351 Query: 341 ELIHKIESSCKEGTQLFLALKR 362 ++ IE T L ++L R Sbjct: 352 -VVENIEMGKGIYTNLVISLSR 372 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5998 (107 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20464 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9001 (159 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12295 115 5e-28 >Vv12295 Length = 66 Score = 115 bits (287), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 53/65 (81%), Positives = 58/65 (89%) Query: 95 DTGVVEPSLFPMLANWQREYTMEDILTQLKKEMMSPQNRKLAQPPEGNEEGRVDQKGLVV 154 +TGVVEPSLFPMLA WQRE+TMEDILTQLKKEMMSPQNRKLAQPPEGNEE R+DQK + Sbjct: 2 ETGVVEPSLFPMLATWQREHTMEDILTQLKKEMMSPQNRKLAQPPEGNEEARIDQKSIDR 61 Query: 155 KCCII 159 CI+ Sbjct: 62 SXCIL 66 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23297 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147015 (99 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12065 (328 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27821 77 6e-16 >Vv27821 Length = 418 Score = 76.6 bits (187), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 52/69 (75%), Gaps = 2/69 (2%) Query: 1 MSTSKKPRVVWSVELHQQFVTAVNQLG-LDKAVPKRILEMMNVPGLTRENVASHLQKFRL 59 +ST KPR+ W+ +LH++F+ AVNQLG DKA PK ++++M +PGLT ++ SHLQK+RL Sbjct: 41 LSTDAKPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100 Query: 60 YLKRLNGVA 68 K L+G A Sbjct: 101 S-KNLHGQA 108 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20463 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279518 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26272 82 6e-18 >Vv26272 Length = 357 Score = 82.0 bits (201), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 14/122 (11%) Query: 74 MEGNKDEALRCVRIAEEAIASGNKGRALKFIKIAQRLNQNLQVDALLVKCEAINSGSSAS 133 M+GNKDEAL+C++I ++A+ +G++ RALKF+ A+RL+ NL VD LL AI + S Sbjct: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPVDDLL---SAIERETGQS 57 Query: 134 SVDEKGASEIRKGAGVEKLDR-----------GLNGEVSYTEEHIQLVRKIKRYKDYYAI 182 GA++ A R + V+YTEE I +VR++K+ KDYY + Sbjct: 58 ETPAGGANDEASKASDHPSVRHRVPSSGSSASSSSSSVAYTEEQISIVRQVKKKKDYYEV 117 Query: 183 LG 184 LG Sbjct: 118 LG 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20450 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41067 306 1e-85 >Vv41067 Length = 148 Score = 306 bits (784), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 147/148 (99%), Positives = 147/148 (99%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRNKYETTARSWTQKYAMG 148 PEIAHMYKTDR KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263392 (55 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6519 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2426 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18072 (201 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24889 (300 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9932 150 3e-38 >Vv9932 Length = 171 Score = 150 bits (378), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 73/124 (58%), Positives = 86/124 (69%) Query: 177 MQWGHVGIHDWWRNEQFWVIGGASSHFFALIQGLLKVLGGVNTNFTVTSKAADDGEFSDL 236 M+W V I DWWRNEQFWVIGG S+H FA+ QGLLKVL G++T+FTVTSKA DD +FS+L Sbjct: 1 MRWSGVRIDDWWRNEQFWVIGGVSAHLFAVFQGLLKVLAGIDTDFTVTSKAGDDEDFSEL 60 Query: 237 YLFKWTXXXXXXXXXXXXXXXXXXXXXSDAINNGYQTWGPPFGTLFPATWVILHLYPSPK 296 Y FKWT S+AINNGY++WGP FG LF A WVI+HLYP K Sbjct: 61 YAFKWTTLLIPPTTLLIINLIGVVAGVSNAINNGYESWGPLFGKLFFAFWVIVHLYPFLK 120 Query: 297 GLVG 300 GL+G Sbjct: 121 GLLG 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24501 (333 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16036 (366 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750975 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41361 147 2e-37 >Vv41361 Length = 161 Score = 147 bits (370), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 79/171 (46%), Positives = 105/171 (61%), Gaps = 12/171 (7%) Query: 2 DLQALPEGCIATVISLTTPRDAGTLSSVSWSFRSAADSDAVWGRFLPPDIHTILXXXXXX 61 + +AL CI+ ++S T+PRDA VS + R A DSD+VW +FLP D IL Sbjct: 3 EFRALASDCISHILSCTSPRDACRSELVSTTVRHAGDSDSVWEKFLPSDYQEILSR---- 58 Query: 62 XXVQPPHVGPSSASKTKKELYLALCDNPVLIEQGKLSFSLDKWSGKKCYMIAARALSIVW 121 + P V S KKELY LC +P+LI++G+ SFS+ K +GKK YM++AR LSI W Sbjct: 59 --LVSPLVFAS-----KKELYSKLC-SPLLIDEGRKSFSISKTTGKKGYMLSARNLSITW 110 Query: 122 ADTPQYWKWISIPDSRFEEVAELVDVCWLEIHGRIETRMLSPSTLYKAYLV 172 + YW W + SRF E EL +CWLEI G+I T +LSP T Y+AYL+ Sbjct: 111 SSNTLYWSWKPLLQSRFAETVELRTICWLEIQGKISTSVLSPKTTYRAYLI 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783651 (73 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23338 (512 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91045015 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743793 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9842 (145 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15008 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11566260 320 1e-89 >Vv11566260 Length = 221 Score = 320 bits (820), Expect = 1e-89, Method: Compositional matrix adjust. Identities = 164/221 (74%), Positives = 185/221 (83%), Gaps = 2/221 (0%) Query: 1 MASASPMASQLKSNFTSPITTRP-ALLSPKGLSASPLKLFPSKRL-SSFSIKAVQSDKQN 58 MA+ASPMASQLKS+FTSP T+R + SPKGLSASPL+ F S+R SSFSIKA+QS+K Sbjct: 1 MATASPMASQLKSSFTSPTTSRALPVASPKGLSASPLRPFSSRRAPSSFSIKAIQSEKPT 60 Query: 59 FQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGFLLVGP 118 +QVIQPINGDPFIGSLETP+TSSPLIAWYLSNLPAYRTAVSP+LRGIEVGLAHGFLLVGP Sbjct: 61 YQVIQPINGDPFIGSLETPITSSPLIAWYLSNLPAYRTAVSPVLRGIEVGLAHGFLLVGP 120 Query: 119 FVKTGPLRNTPYXXXXXXXXXXXXVVILTLCLTIYGISSFKEGEPSSAPALTLTGRKKEP 178 FVKTGPLR+TP VVIL++CLT+YGI+SFKEGEPS AP+LTLTGR KEP Sbjct: 121 FVKTGPLRDTPIAGPAGSLAAGGLVVILSICLTMYGIASFKEGEPSIAPSLTLTGRTKEP 180 Query: 179 DQLQTAEGWSKXXXXXXXXXISGVTWAYFLLYVVNLPYFFK 219 DQLQ+A+GW+K ISGVTWAYFLLYV+NLPYF K Sbjct: 181 DQLQSADGWAKFTGGFFFGGISGVTWAYFLLYVLNLPYFVK 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15454 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48262700 (60 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8371 (374 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23931 194 2e-51 >Vv23931 Length = 251 Score = 194 bits (494), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 88/143 (61%), Positives = 112/143 (78%), Gaps = 3/143 (2%) Query: 35 KTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRWMNYLR 94 ++PCC K +G WT EED+ L YI+ GEG WR+LPK AGLLRCGKSCRLRW+NYLR Sbjct: 3 RSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLR 62 Query: 95 PSVKRGQIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLSKKLISQGID 154 P +KRG +E++LI++LH LLGN+WSLIAGR+PGRTDNEIKNYWNTH+ +KL+++GID Sbjct: 63 PDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRGID 122 Query: 155 PRTHKPLN---PDHHSAAADADV 174 P TH+P+N PD + + A V Sbjct: 123 PSTHRPINEPSPDVTTISFAAAV 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6945 (375 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7236 (346 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56231 484 e-138 >Vv56231 Length = 362 Score = 484 bits (1245), Expect = e-138, Method: Compositional matrix adjust. Identities = 232/334 (69%), Positives = 265/334 (79%), Gaps = 9/334 (2%) Query: 12 MENGVVENGVCSSESATGSRYVWSSKESEYSSADHLVVMVHGIMGTAADWKFGAEQFVKT 71 M++G VENG+CSSES G VWSSKES +SADHLVVMVHGI+G+ DWKF AEQFV+ Sbjct: 3 MKDGPVENGICSSESIHGGTDVWSSKESATASADHLVVMVHGILGSVTDWKFAAEQFVRI 62 Query: 72 LPDKVIVHCSERNGSRLTLDGVDVMGERLAEEVIELTRKKPNLRKISFIGHSVGGLVARY 131 LPDKVIVH SERN S LTLDGVDVMGERLAEEVIE+ ++KP +RKISF+ HSVGGLVARY Sbjct: 63 LPDKVIVHRSERNASMLTLDGVDVMGERLAEEVIEVIKQKPEVRKISFVSHSVGGLVARY 122 Query: 132 AIGRLYRPGPPKSDNTEPKSENTEHSSPDGCEEDARSTLAGLEPLNFITVATPHLGSRGN 191 AIGRLYRP P+SEN + S + CEE++R T+ GLE +NFITVATPHLGSRGN Sbjct: 123 AIGRLYRP---------PRSENEDDPSANTCEENSRGTIYGLEAMNFITVATPHLGSRGN 173 Query: 192 KQVPFLFGVPAFERLASAVIHLIFRRTGRHLFLNDDDDGKPPLLKRMIEDCDGCYFMSAL 251 KQVPFLFGVP FE+ A++VIHLIFRRTGRHLFL DDD+G PPLL+RMIEDC +FMSAL Sbjct: 174 KQVPFLFGVPVFEKAATSVIHLIFRRTGRHLFLTDDDEGNPPLLRRMIEDCGELHFMSAL 233 Query: 252 RSFKRRVVYSNVGYDHIVGWKTSCIRRNSELPKWENTVDEKYPHIVYEEHCKAYDAEQCE 311 SF RRV+YSNVGYDHIVGW+TS IRRNSELPKWE+ V+EKYPHIV+EEHCKA DAEQCE Sbjct: 234 HSFTRRVIYSNVGYDHIVGWRTSSIRRNSELPKWEDVVNEKYPHIVFEEHCKACDAEQCE 293 Query: 312 PAXXXXXXXXXXXXXXXXXXXXXXWEKIDVSFHS 345 P+ WEK+DVSFH+ Sbjct: 294 PSSMEDDGLDKLEEELLMGLSCVSWEKVDVSFHA 327 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418713 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9355 (475 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3266259 640 0.0 >Vv3266259 Length = 431 Score = 640 bits (1651), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/385 (79%), Positives = 336/385 (87%) Query: 91 PAMAESLTVAFPASRTTEVNSVQTTLVETWGLIRETFVDPTFNHQDWDQKLQQTMTEMFP 150 PA+AESLTVAFP SR EVN+VQ TLVETWGLIRETF+DPTFNHQDWD KLQQTM EMFP Sbjct: 9 PALAESLTVAFPVSRAREVNTVQRTLVETWGLIRETFIDPTFNHQDWDLKLQQTMVEMFP 68 Query: 151 LRSADAAYMKISGMLSTLGDPFTRIISPKEYQSFRIGSNGNLQGVGLFINREPRTGHLVV 210 LR+ADAAY KISGMLSTLGDPFTRIISPKEYQ+FRIGS+GNLQGVG+FIN EPRTGHL+V Sbjct: 69 LRTADAAYNKISGMLSTLGDPFTRIISPKEYQNFRIGSDGNLQGVGIFINAEPRTGHLIV 128 Query: 211 LSCVEGGPAARAGIHQGDELVEINGEKMDGIETEVAVQKLXXXXXXXXXXXXXXXNDIRG 270 LSC+EG PAARAGIH+GDEL+EINGE++DG + E A QKL Sbjct: 129 LSCIEGSPAARAGIHEGDELIEINGERLDGTDDETAAQKLRGRVGTTVTVKLHSGTGWGS 188 Query: 271 DSGIKEVKLPREYIKLSPISTATIPHKTPDGRLTKTGYVKLSAFSQTAAADMENAINEMK 330 DSG +EVKL R++IKLSPIS+A IPHKTPDG ++K GYVKLSAFSQTAAA+MEN I+EM+ Sbjct: 189 DSGFREVKLSRDFIKLSPISSAIIPHKTPDGHVSKLGYVKLSAFSQTAAAEMENCIHEME 248 Query: 331 RQGVHSYILDLRNNPGGLVKAGLDVAQIWLDGDETLVNTIDREGNLLPINMVNGHAITHD 390 Q V SYILDLRNNPGGLVK GLDVAQIWLDGDETLVNTIDR+GN+LPINMV+GHAIT D Sbjct: 249 AQDVCSYILDLRNNPGGLVKVGLDVAQIWLDGDETLVNTIDRDGNMLPINMVDGHAITRD 308 Query: 391 PLVVLVNEGSASASEILAGALHDNRRATLVGHRTFGKGKIQSVTELHDGSALFVTVAKYL 450 PLVVLVNEGSASASEILAGALHDN RA LVGH+TFGKGKIQSVTELHDGSALFVTVAKYL Sbjct: 309 PLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYL 368 Query: 451 SPALHDIDQVGIAPDVQCTTDKLHS 475 SPALHDIDQVGI PDVQC+T+ L S Sbjct: 369 SPALHDIDQVGITPDVQCSTEMLSS 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18180 (111 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601413 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31687 150 7e-39 >Vv31687 Length = 205 Score = 150 bits (379), Expect = 7e-39, Method: Compositional matrix adjust. Identities = 72/118 (61%), Positives = 81/118 (68%) Query: 1 ENDRTNDFIILDDQVEASEERPKKTKLFYIHAVENWDAEFXXXXXXXXXXXXXXXGATLT 60 EN +TNDFIIL+D VEA EE PKKTKLF+ HA +NWDAEF TL Sbjct: 39 ENRQTNDFIILNDHVEAPEELPKKTKLFFAHAADNWDAEFYAKVNDDVYVNIDALVTTLE 98 Query: 61 TYIDKPRVYIGCMKSGEVFSEPTHKWYEPDWWKFGDAKSYFRHASGELYAIFRALAHF 118 ++ R YIGCMKSGEVFS+ HKWYE DWWKFGD KSYFR+ASGE+Y I R LA F Sbjct: 99 AHLQVSRTYIGCMKSGEVFSDVGHKWYESDWWKFGDGKSYFRYASGEMYVISRGLAKF 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27745 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283987 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6570 (235 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 88 2e-19 >Vv47659 Length = 393 Score = 87.8 bits (216), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 75/250 (30%), Positives = 117/250 (46%), Gaps = 42/250 (16%) Query: 1 MVAVDFTASNG----NSRLPDSLHYIDPTGRPNAYQRAIIEVLEVLQFYDSDKRFPAWGF 56 ++ +DFT SN +S SLH I T PN Y++AI + L +D D P +GF Sbjct: 65 ILGIDFTKSNEWTGRHSFHRKSLHAISNT--PNPYEQAISIIGRTLSPFDEDNLIPCFGF 122 Query: 57 GARPIDGPVSHCFNLNGSSHHCEVEGIQGIMTAYASALQNVSLAGPTLFGPVITNAALNA 116 G D + + H G + ++ Y + + L+GPT F P+I +AA++ Sbjct: 123 G----DASTHDKYVFSFYPDHRYCRGFEEVLARYKEIVPYLKLSGPTSFAPII-DAAIDI 177 Query: 117 SQSVANGGRKYFVLLIITDGVVT------------DHQETKDALVKASDLPLSILIVGVG 164 + +NG +Y VL+II DG V+ Q T +++V AS PLSI++VGVG Sbjct: 178 VEG-SNG--QYHVLVIIADGQVSGSLDGSSGRFSPQEQATVNSIVAASRYPLSIILVGVG 234 Query: 165 GADFKEMEILDADKGERLESSTGHVASRDIVQFVPFRDVQS-------GEISVVQALLAE 217 + M++ D + +R S D QFV F + S E + + L E Sbjct: 235 DGPWDAMKLFDDNIPQR---------SFDNFQFVNFSKIMSENMEASKKETAFALSALME 285 Query: 218 LPAQFLTYMR 227 +P Q+ +R Sbjct: 286 IPFQYRATLR 295 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7083 (374 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7180 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57603 357 e-101 >Vv57603 Length = 189 Score = 357 bits (917), Expect = e-101, Method: Compositional matrix adjust. Identities = 174/199 (87%), Positives = 185/199 (92%), Gaps = 10/199 (5%) Query: 1 MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP 60 MSFIGTQQKCKAC KTVYPVE+LSADG+ YHKSCFKC+HC GTLKLSNYSSMEGVLYCKP Sbjct: 1 MSFIGTQQKCKACLKTVYPVEQLSADGVVYHKSCFKCSHCNGTLKLSNYSSMEGVLYCKP 60 Query: 61 HFEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEK 120 HFEQLFKE+GNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQ+KCATCGKTAYPLEK Sbjct: 61 HFEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK 120 Query: 121 VTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHFSQLFKEKGSYNHLIKSASIK 180 VTVESQAYHKSCFKCSHGGCPI+PSNYAALEGILYCKHHF+QLFKEKGSYNHLIKSAS+K Sbjct: 121 VTVESQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHLIKSASMK 180 Query: 181 RTXXXXXXXXXTVASIPEA 199 R + AS+P+A Sbjct: 181 R----------SAASVPDA 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31401 (310 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23254 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3467 395 e-112 >Vv3467 Length = 229 Score = 395 bits (1014), Expect = e-112, Method: Compositional matrix adjust. Identities = 193/228 (84%), Positives = 209/228 (91%) Query: 62 IATFLFLYITILTVMGVVKSKSKCTTVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVT 121 +ATFLFLYITILTVMGV KS + C +VGIQGIAWAFGG IFALVY TAGISGGHINPAVT Sbjct: 1 MATFLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT 60 Query: 122 FGLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFELLGGGANSVNHGYTKGQG 181 FGL LARKLSLTRA+FYI+MQ LGAI GA VVKGFE S ++E+LGGGAN VN GYTKG G Sbjct: 61 FGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDG 120 Query: 182 LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPA 241 LGAEI+GTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIP+TGTGINPA Sbjct: 121 LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA 180 Query: 242 RSLGAAIIYNKRHAWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKSK 289 RSLGAAII+N+ HAWDD WIFWVGPFIGAALAA+Y +VIRAIPFKS+ Sbjct: 181 RSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRAIPFKSR 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6839 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3467 392 e-111 >Vv3467 Length = 229 Score = 392 bits (1007), Expect = e-111, Method: Compositional matrix adjust. Identities = 192/228 (84%), Positives = 209/228 (91%) Query: 62 IATFLFLYITILTVMGVVKSKSKCTTVGIQGIAWAFGGTIFALVYSTAGISGGHINPAVT 121 +ATFLFLYITILTVMGV KS + C +VGIQGIAWAFGG IFALVY TAGISGGHINPAVT Sbjct: 1 MATFLFLYITILTVMGVKKSPTMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVT 60 Query: 122 FGLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQG 181 FGL LARKLSLTRA+FYI+MQ LGAI GA VVKGFE S ++E+LGGGAN V GYTKG G Sbjct: 61 FGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDG 120 Query: 182 LGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPA 241 LGAEI+GTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIP+TGTGINPA Sbjct: 121 LGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPA 180 Query: 242 RSLGAAIIYNKKHAWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKSK 289 RSLGAAII+N++HAWDD WIFWVGPFIGAALAA+Y +VIRAIPFKS+ Sbjct: 181 RSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRAIPFKSR 228 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51237933 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28629 (283 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv161 122 1e-29 >Vv161 Length = 95 Score = 122 bits (305), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 52/94 (55%), Positives = 72/94 (76%) Query: 106 MVEIHSAQELVDSLKNAGDRLVVVDFYSPGCGGCRALHPKICQLAESNPNAIFLKVNYEE 165 M++IHS QE + +L AGD+LV+V+FY C CRAL PK+C+ A+ PN IFLKVN++E Sbjct: 1 MIDIHSMQEFLSALSQAGDKLVIVEFYGTWCASCRALFPKLCKTAQDYPNIIFLKVNFDE 60 Query: 166 HKTMCHALNIHVLPFFRFYRGADGRVCSFSCTNA 199 +K+MC +LN+ +LP F FYRG+DG + SFSC+ A Sbjct: 61 NKSMCKSLNVKMLPCFHFYRGSDGLLESFSCSLA 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22077 (213 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27048 373 e-105 >Vv27048 Length = 386 Score = 373 bits (957), Expect = e-105, Method: Compositional matrix adjust. Identities = 180/211 (85%), Positives = 193/211 (91%) Query: 1 MAMVDERLYPIAVLIDELKNEDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDD 60 MAMVDE LYPIAVLIDELKN DIQLRLNSIRRLSTIARALGEERTR ELIPFLSENNDDD Sbjct: 1 MAMVDEPLYPIAVLIDELKNADIQLRLNSIRRLSTIARALGEERTRNELIPFLSENNDDD 60 Query: 61 DEVLLAMAEELGVFIPYVGGVEHANILLPPLETLCTVEETCVRDKAVDSLCKIGGQMREK 120 DEVLLAM EELGVFIPYVGG+EHA +LLPPLETLCTVEET VRDKAV+SLC+IG QM+E Sbjct: 61 DEVLLAMTEELGVFIPYVGGLEHACVLLPPLETLCTVEETRVRDKAVESLCRIGSQMKEN 120 Query: 121 DLVEYFIPLVKRLAAGEWFTARVSSCGLFHIAYTSAPETLKTELRTTYSQLCQDDMPMVR 180 DL+ +FIPLVKRLA+GEWFTARVS+CGLFHIAY SAPE LK ELR YSQLCQDDMPMVR Sbjct: 121 DLINWFIPLVKRLASGEWFTARVSACGLFHIAYPSAPEMLKMELRAIYSQLCQDDMPMVR 180 Query: 181 RSAASNLGKFAGTVEAVHLKADIMSIFEDLT 211 RSAAS+L KF+ TVE VHLK DIM+IFE+LT Sbjct: 181 RSAASSLWKFSATVEPVHLKNDIMTIFENLT 211 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14587 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31573 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56446 103 2e-24 >Vv56446 Length = 240 Score = 103 bits (257), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 62/170 (36%), Positives = 88/170 (51%), Gaps = 9/170 (5%) Query: 1 MALDAARGMNYLHNCTPVIVHRDLKSPNLLVD----RNWVVKVCDFGLSRMKNSTFLSSR 56 +A+D A GM YLH IVH DLKS NLLV+ + KV D GLS++K +S Sbjct: 66 IAMDVAFGMEYLHGKN--IVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQPLISG- 122 Query: 57 STAGTAEWMAPEVLRNEPS--DEKCDVYSYGVILWELSTMQQPWGGMNPMQVVGAVGFQH 114 GT WMAPE+L S EK DV+S+G+++WEL T ++P+ ++ ++G + Sbjct: 123 GVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVSNT 182 Query: 115 RRXXXXXXXXXXXXXXXRKCWQTDPKLRPSFAEIMAILKPLQKPISRSGQ 164 R +CW ++P RPSF EI L+ + I GQ Sbjct: 183 LRPSVPEFCDPEWRALMERCWSSEPSERPSFTEIANQLRSMAAKIPPKGQ 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20380 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9938 (492 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20414 74 5e-15 >Vv20414 Length = 345 Score = 74.3 bits (181), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 2/115 (1%) Query: 285 QKVLDVGCGIGGGDFYMASNFDVEVIGIDLSVNMISFA--LEQSIGLKCAVEFEVADCTK 342 ++V+DVGCGIGG Y+A + GI LS A L S GL V F+VAD Sbjct: 125 KRVVDVGCGIGGSSRYLAKKYGASCQGITLSPLQAQRAQTLAASQGLADKVSFQVADALD 184 Query: 343 KTYPDNTFDVIYSRDTILHIQDKPALFRSFYEWLKPGGKVLISDYCRCVGTPSEN 397 + +PD FD+++S ++ H+ DK PGG +++ +C +PSE Sbjct: 185 QPFPDGQFDLVWSMESGEHMPDKKKFVSELARVAAPGGTIILVTWCHRDLSPSEE 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6257 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121299 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18366261 136 9e-35 >Vv18366261 Length = 172 Score = 136 bits (342), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 65/85 (76%), Positives = 72/85 (84%) Query: 3 ISTQASSTPPLNIKREEKVKETPTRCGTCRKRVGLTGFSCRCGDLFCAVHRYSDKHNCPH 62 IST+AS+ N E KVKE P RC CRKRVGLTGF+C+CG+LFCAVHRYSDKH+CP Sbjct: 88 ISTEASNDSSSNQIIESKVKEGPNRCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPF 147 Query: 63 DYRTAAQDAIAKANPVVKAEKLDKI 87 DYRTAA+DAIAKANPVVKAEKLDKI Sbjct: 148 DYRTAARDAIAKANPVVKAEKLDKI 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25959 (137 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55768772 (77 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9179 103 4e-25 >Vv9179 Length = 371 Score = 103 bits (258), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 50/71 (70%), Positives = 56/71 (78%) Query: 7 QDVQWLQTITSLPILVKGVLTAEDXXXXXXXXXXXXXXSNHGARQLDYVPSTIMALEKVV 66 +DV+WLQTIT+LPILVKGVLTAED SNHGARQLDYVP+TIMALE+VV Sbjct: 214 KDVKWLQTITNLPILVKGVLTAEDTRLAIQAGAAGIIVSNHGARQLDYVPATIMALEEVV 273 Query: 67 KAAQGRIPCFL 77 KAAQGR+P FL Sbjct: 274 KAAQGRVPVFL 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12111 (588 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21566256 105 3e-24 >Vv21566256 Length = 806 Score = 105 bits (261), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 71/198 (35%), Positives = 100/198 (50%), Gaps = 11/198 (5%) Query: 9 KPMILALARPDPKKNITTLVKAFGECRPLRELANLTLIMGNRDGIDEMXXXXXXXXXXXX 68 KP+I ++AR D KN+T LV+ +G+ LREL NL ++ G+R + Sbjct: 570 KPIIFSMARLDRVKNLTGLVEWYGKNTRLRELVNLVVVGGDRRK-ESKDLEEQSEMKKMH 628 Query: 69 XXIDKYDLYGQVAY-PKHHKQSDVPDIYRLAAKTKGVFINPAFIEPFGLTLIEAAAHGLP 127 I+ Y L GQ + + ++YR A TKGVF+ PAF E FGLT++EA GLP Sbjct: 629 ELIETYKLNGQFRWISSQMDRVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLP 688 Query: 128 IVATKNGGPVDIHQVLDNGLLIDPHDQQSIADALL----KLVADKQLWARCRQNGLKNI- 182 AT NGGP +I +G IDP+ A+ L K AD W + + GLK I Sbjct: 689 TFATCNGGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIE 748 Query: 183 HLFSWPEHCKTYLSRIAS 200 ++W K Y R+ + Sbjct: 749 EKYTW----KIYSERLLT 762 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226782354 (207 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32000 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv7645 71 1e-14 >Vv7645 Length = 492 Score = 70.9 bits (172), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 31/85 (36%), Positives = 54/85 (63%) Query: 59 ILYFTATWCGPCRFISPLYTSLAGKYKKVVFLKVDIDEARDVAANWNISGVPAFFFVRNG 118 IL+F A+WC + + +++ L+ + VF +V+ +E ++ +++S VP F F ++G Sbjct: 25 ILHFWASWCEASKHMDQVFSHLSTDFPHAVFFRVEAEEQPVISEAYSVSAVPYFVFFKDG 84 Query: 119 KEVDKMVGADKAALERKIAQHAGSI 143 K VD M GAD ++L K+A+ AGSI Sbjct: 85 KTVDTMEGADPSSLANKVAKVAGSI 109 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9071 (201 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29838 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11853 (226 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6753 67 2e-13 >Vv6753 Length = 183 Score = 67.0 bits (162), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 4/75 (5%) Query: 15 KVLSQTASSSACERNWSTFALIHTKQRNKLAHSSLEKLVYCYYNMKLQIRDKEAEIDHVD 74 +VLS T S+S CERNWSTF IHTK+RN+L H L LVY YN +L +E + Sbjct: 1 RVLSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRL----RERSLQRKQ 56 Query: 75 RGDPLDVFDIVVEDD 89 DP+ V +I +D+ Sbjct: 57 NVDPILVEEIDSDDE 71 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7031 (210 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv39428 123 2e-30 >Vv39428 Length = 380 Score = 123 bits (309), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 24/215 (11%) Query: 1 MIQNHLSLILG----NRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRVDQRFQLEKTMK 56 MI+ HL+ +LG + + ++ + +I + ++GQ+YAAS++YGYFLK R LE ++ Sbjct: 185 MIKEHLTTVLGWKPKSNVTENWATTQIRRFQLGQIYAASILYGYFLKSASLRHHLEMSLV 244 Query: 57 ILPGAMGAEDSDIHKSVG-EDVRPGSGGEALQAGASSHPEVPSLAGGVSPGGFGNALKHS 115 + + + S G +D+ G G SS P SL S + Sbjct: 245 HTHHDLSSSNVSGFWSYGLKDLFLGPNG-------SSQP--TSLGEASSRQ---EEKEEK 292 Query: 116 RLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKDDLIKI 175 +LR YVM FD +TL R A ++S+EA++++EKH+ ALFG G +++ DD+I Sbjct: 293 KLRCYVMGFDPDTLQRCAKLKSKEAVNLVEKHSCALFGDEKT-----GLLET--DDVIST 345 Query: 176 SFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN 210 SF ++RL+LE+V FGSFLWD E YV S Y+ N Sbjct: 346 SFSSMKRLVLEAVAFGSFLWDTEEYVGSVYNLKEN 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226786909 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5682 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv28330 238 1e-64 >Vv28330 Length = 238 Score = 238 bits (606), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 133/217 (61%), Positives = 150/217 (69%), Gaps = 33/217 (15%) Query: 31 KRGFSETESDISTDASTCVDLKLNL-SNNSKETNSTGGKDGSAXXXXXXXXXXXXLDFRA 89 KRGFSET VDLKLNL S +S + K+ SA Sbjct: 43 KRGFSET-----------VDLKLNLLSKDSVADQAEKMKEKSA--------------LPP 77 Query: 90 SDXXXXXXXXXQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGA 149 S+ QVVGWPPVRSFRKN+ T VQK++ + ++++A VKVSMDGA Sbjct: 78 SNDPAKPPAKAQVVGWPPVRSFRKNILT-VQKNS------SEEEKASSSAAFVKVSMDGA 130 Query: 150 PYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTY 209 PYLRKVDLKMYKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNE KL+D+LNGSDY+PTY Sbjct: 131 PYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTY 190 Query: 210 QDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLG 246 +DKDGDWMLVGDVPWEMFVESCKRLRIMK EA+GL Sbjct: 191 EDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLA 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5936 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv28330 160 1e-41 >Vv28330 Length = 238 Score = 160 bits (405), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 86/151 (56%), Positives = 99/151 (65%), Gaps = 34/151 (22%) Query: 53 SSDPIDVPPTKTQVVGWPPIRSYRKNSLQLRE------------AYVKVSVDGAPYLRKI 100 S+DP PP K QVVGWPP+RS+RKN L +++ A+VKVS+DGAPYLRK+ Sbjct: 78 SNDPAK-PPAKAQVVGWPPVRSFRKNILTVQKNSSEEEKASSSAAFVKVSMDGAPYLRKV 136 Query: 101 DLKVYNSYPELIKALEKMFNLANI---------------------NGSDFAPTYEDKDGD 139 DLK+Y SY EL AL KMF+ I NGSD+ PTYEDKDGD Sbjct: 137 DLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGD 196 Query: 140 WMLVGDVPWNMFVSSCKRLRIMKGSEARGLS 170 WMLVGDVPW MFV SCKRLRIMKGSEA GL+ Sbjct: 197 WMLVGDVPWEMFVESCKRLRIMKGSEAIGLA 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18903 (312 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9966 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5588 (223 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19053 276 3e-76 >Vv19053 Length = 230 Score = 276 bits (705), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 138/230 (60%), Positives = 164/230 (71%), Gaps = 7/230 (3%) Query: 1 MVRTNLKGETMGLMEKRTALEAEINAIIERLTQPGGPGISGNLLDSEGFPREDIDIPAVX 60 MV NLK E M LM++RT LEA++NAII+RL QPGGPGISG+L+DSEGFPR DIDIP V Sbjct: 1 MVGANLKAEAMALMDRRTELEAQMNAIIQRLCQPGGPGISGSLVDSEGFPRSDIDIPTVR 60 Query: 61 XXXXXXXXXXNDHKEVTEKLNRNIEVLHSARLTPKQSSLKDSD---GQXXXXXXXXXXXX 117 ND+K++TEK+N NI++LHSARL P+ S KD D G Sbjct: 61 AERQRLAELRNDYKDITEKINENIQLLHSARLAPRSSLHKDLDNDEGSNNQGSSTATAVP 120 Query: 118 XXXXHT----GSTNTMDVDVIVSVPFALVDEIADESPAAEDGLQLGDQIVKFGSVENGDN 173 H + MDVD VS+PFA+VDEIA+ SPAAEDGLQLGD+IVKFG+VE GDN Sbjct: 121 SAASHNVLPRDTLTAMDVDATVSLPFAVVDEIAEASPAAEDGLQLGDRIVKFGNVEAGDN 180 Query: 174 LLQKLASEAQANQGRGIPVILVRQGAQVNLTMTPRTWQGRGLLGCHLRIL 223 LL +LASEAQ N G IPVI++RQGA +NLTMTPRTWQGRGLLGCH ++L Sbjct: 181 LLPRLASEAQTNHGHAIPVIVMRQGALINLTMTPRTWQGRGLLGCHFQML 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27904 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10475 105 7e-25 >Vv10475 Length = 184 Score = 105 bits (261), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 72/196 (36%), Positives = 95/196 (48%), Gaps = 29/196 (14%) Query: 2 KKMKGVVSDA-----VEDQRTRFKHQSLMQDYEEXXXXXXXXXXXXXXXXXXXSTLVAEV 56 KKMK +V ++ ED ++RFKHQSL+QD+ E TL+AEV Sbjct: 3 KKMKRMVMESSPHAVYEDAKSRFKHQSLLQDFHELQKETEAMKKKLQSVNLNKLTLLAEV 62 Query: 57 RFLRRRYNYLMGNQSTHTRPKQDVVKTHNLDTQRVTYLXXXXXXXXXXXXRCPLPALDLN 116 RFLRRRY YL+ N + T P+ ++ + N TQ L Sbjct: 63 RFLRRRYKYLLKNMAPKTPPEPELKQPQNSATQ-----------------------LKNI 99 Query: 117 KKEKVKHGMEDI-VRKPPPKFDLNLNARALGGKEATLRTPTPNFDLNKKERVQSGKDTAK 175 +EK G + +R P P F N+ R GK A L P P ++LN+K R SGK+ A Sbjct: 100 TREKNHSGKQAAAMRNPAPVFGGNMKERIHKGKVAALPNPDPGYELNQKTRGYSGKEAAL 159 Query: 176 RKSTPVFDLNQISVIK 191 R PVFDLN+ISV K Sbjct: 160 RNPVPVFDLNKISVSK 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814098 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6322 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7295 (679 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11258 388 e-109 >Vv11258 Length = 222 Score = 388 bits (997), Expect = e-109, Method: Compositional matrix adjust. Identities = 187/226 (82%), Positives = 202/226 (89%), Gaps = 4/226 (1%) Query: 454 MIKELLISFRRATGQKPQRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF 513 MI++LL+SFR+ATGQKP RIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF Sbjct: 1 MIRDLLVSFRKATGQKPLRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEPNYQPPVTF 60 Query: 514 VVVQKRHHTRLFANNHSDRNAVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP 573 +VVQKRHHTRLFANNH DRN+ DRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP Sbjct: 61 IVVQKRHHTRLFANNHRDRNSTDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP 120 Query: 574 AHYHVLWDENKFTADELQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYLEPETS 633 AHYHVLWDEN FTAD +QSLTNNLCY YARCTRSVS+VPPAYYAHLAAFRARFY+EP+ Sbjct: 121 AHYHVLWDENNFTADGIQSLTNNLCYWYARCTRSVSVVPPAYYAHLAAFRARFYMEPDMQ 180 Query: 634 DSGSMTSGAPGRGGMGPRSTRAPGPNAAVRPLPALKENVKRVMFYC 679 ++GS G G ++TRA G VRPLPALKENVKR+MFYC Sbjct: 181 ENGSNGGGGGGHAA---KATRASG-ETGVRPLPALKENVKRIMFYC 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12743 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8236 189 2e-50 >Vv8236 Length = 128 Score = 189 bits (480), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 88/107 (82%), Positives = 98/107 (91%) Query: 18 QPSESSNKRKRGVFQKELQHMMYGFGDDPNPLPESVALMEDIVVEYVTDLVHKAQEIGSK 77 QPS+SS KRKRGVFQK+LQHMMYGFGDD NPLPE+VAL+EDIVVEYVTDLVHKAQE SK Sbjct: 18 QPSDSSFKRKRGVFQKDLQHMMYGFGDDANPLPETVALLEDIVVEYVTDLVHKAQETASK 77 Query: 78 RGRLSVDDFLYLIRKDFPKLNRCRELLSMNEELKQARRAFETDEEKL 124 RG+L +DFL+L+RKD PKLNRC ELLSMNEELKQAR+AF+ DEEKL Sbjct: 78 RGKLLTEDFLFLMRKDLPKLNRCTELLSMNEELKQARKAFDVDEEKL 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274494 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263551 (73 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2557 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24866 (313 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14336 (85 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51095885 (84 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19309 (131 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20162 (129 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28141 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10364 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3157 409 e-116 >Vv3157 Length = 221 Score = 409 bits (1050), Expect = e-116, Method: Compositional matrix adjust. Identities = 193/194 (99%), Positives = 193/194 (99%) Query: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG Sbjct: 1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG 60 Query: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI Sbjct: 61 KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI 120 Query: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV Sbjct: 121 VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFV 180 Query: 181 ESPALAPPEVQFDM 194 ESPALAPPEVQ DM Sbjct: 181 ESPALAPPEVQIDM 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26030 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43002 254 2e-69 >Vv43002 Length = 213 Score = 254 bits (648), Expect = 2e-69, Method: Compositional matrix adjust. Identities = 119/190 (62%), Positives = 162/190 (85%) Query: 57 LADETRFTVNELEALYELFKKLSSSIIDDGSIHKEELQLALFQTPQGENLFLDRVFDLFD 116 LA +T F+V+E+EAL+ELFK +SSS+IDDG I+KEE QLALF+ + ENLF +R+FDLFD Sbjct: 21 LASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLALFKNRKKENLFANRIFDLFD 80 Query: 117 EKKNGVIEFDEFVHALNIFHPYAPIDDKIDFAFRLYDLRQTGFIEREEVKQMVIAILMES 176 K+ GVI+F +FV +LN+FHP AP +DKIDF+F+LYDL TGFIER+EVKQM+IA+L ES Sbjct: 81 VKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSFKLYDLDSTGFIERQEVKQMLIALLCES 140 Query: 177 DVKLPDDILEEIIEKTFADADADKDGKINKEEWKVFVLRHPSLLKNMTLPYLKDITTVFP 236 ++KL D+ +E I++KTF +AD ++DG+I+K EW+ FV R+PSLLK MTLPYL+DITT FP Sbjct: 141 EMKLADETIEIILDKTFLEADVNQDGRIDKSEWQNFVSRNPSLLKIMTLPYLRDITTTFP 200 Query: 237 SYIFHTEVED 246 S++F++EV++ Sbjct: 201 SFVFNSEVDE 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24831 (317 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487983 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29853 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv941 330 1e-92 >Vv941 Length = 185 Score = 330 bits (845), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 159/183 (86%), Positives = 170/183 (92%), Gaps = 2/183 (1%) Query: 1 MVKYSREPNNPTKSCKAQGEGLRVHFKNTRETAHAIRKMHLAKAKRYLEDVLAHKQAIPF 60 MVKYSREP+NPTKSCKA+G LRVHFKNTRETAHAIRK+ LAKAKRYLEDVL HKQAIPF Sbjct: 1 MVKYSREPDNPTKSCKARGSDLRVHFKNTRETAHAIRKLPLAKAKRYLEDVLVHKQAIPF 60 Query: 61 RRFCRGVGRTAQAKNRQSNGQGRWPVKSANFILDLLKNAESNAEVKGLDVDSLYVSHIQV 120 RFCRGVGRTAQAKNR SNGQGRWPVKSA FILDLLKNAESNA++KGLDVDSLY+SHIQV Sbjct: 61 TRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNADLKGLDVDSLYISHIQV 120 Query: 121 NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEAVKKEPDTQLAPRKSRKGQALQSG 180 NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEE VKKEP+TQLA KS+K +L+ G Sbjct: 121 NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLATGKSKK--SLRGG 178 Query: 181 ASS 183 AS+ Sbjct: 179 AST 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5564 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10437 (156 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3021 (167 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8738 (259 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612315 (5 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25680 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922057 (197 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71819131 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12866 (268 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32818 265 7e-73 >Vv32818 Length = 296 Score = 265 bits (677), Expect = 7e-73, Method: Compositional matrix adjust. Identities = 134/188 (71%), Positives = 147/188 (78%), Gaps = 2/188 (1%) Query: 1 MSSRSSRTIYVGNLPGDIRMREVEDLFLKYGPIVDIDLKIPPRPPGYAFVEYEDPRDADD 60 MSSR+SRT+YVGNLPGDIR REVEDLF KYGPI IDLKIPPRPPGYAFVE+E+ RDA+D Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEESRDAED 60 Query: 61 AIYGRDGYDFDGFRLRVELAX--XXXXXXXXXXXXXXXXXXXXXXXXXXDYRVLVTGLPP 118 AI GRDGYDFDG RLRVELA +YRVLVTGLP Sbjct: 61 AIRGRDGYDFDGHRLRVELAHGGRGHSSSIDRHSHSSGRGGRGGASRRSEYRVLVTGLPS 120 Query: 119 AASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTNYEDMKYAIRKLDDSEFRNAFARS 178 +ASWQDLKDHMRRAGDVCFSQVF D GG GIVDYTNY+DMK+AIRKLDDSEFRNAF+R+ Sbjct: 121 SASWQDLKDHMRRAGDVCFSQVFHDGGGTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRA 180 Query: 179 YIRVREYD 186 Y+RV+EYD Sbjct: 181 YVRVKEYD 188 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591577 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27666 133 9e-34 >Vv27666 Length = 612 Score = 133 bits (335), Expect = 9e-34, Method: Compositional matrix adjust. Identities = 62/118 (52%), Positives = 79/118 (66%) Query: 1 MKVCISRYTSKMHKEKGSGLAPWPHRLTAAPPRLEEIGVSPEEFQEDTSIWHFRVIEYWK 60 M+ CI+ Y+ HK +GS LAPWP R TA PPRL + G S + F++DT +W RV YW Sbjct: 392 MEACITPYSDHDHKSRGSELAPWPARATAPPPRLADFGYSKDIFEKDTEVWMQRVESYWN 451 Query: 61 QMKSVIQKNSIRNVMDMNSYLGGFAAALNEKDVWVMNVAPVHVSARLKIIFDRGLIGT 118 + I +++RN+MDM + LG FAAAL KDVWVMNV P LK+I+DRGLIGT Sbjct: 452 LLSPKITSDTLRNLMDMKANLGSFAAALKGKDVWVMNVVPEDGPNTLKLIYDRGLIGT 509 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25121 (162 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6749 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7864 (226 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8054 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9940 365 e-103 >Vv9940 Length = 456 Score = 365 bits (936), Expect = e-103, Method: Compositional matrix adjust. Identities = 186/261 (71%), Positives = 211/261 (80%), Gaps = 16/261 (6%) Query: 1 MKSCAEKGDSKITEQTSTKNNDGESSG------------DTSKDNSKASEVQKPDYIHVR 48 +K CAE G+SKITE + KN+ ++ +TS D SK SEVQKPDYIHVR Sbjct: 198 IKGCAEDGESKITEANNNKNSTATTTTTATTTTTNNNNRETSADTSKVSEVQKPDYIHVR 257 Query: 49 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE 108 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE Sbjct: 258 ARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVE 317 Query: 109 FLSMKLAAVNPRLDFNIDDLFAKEMFPTCAANFPTMGMSSEMTNSVYLQLNPMQQLVSSS 168 FLSMKLAAVNPRLDFNID+ AKE+FP CAANFPT+GMSSEMTN YL +P+QQ V++ Sbjct: 318 FLSMKLAAVNPRLDFNIDNFLAKEVFPACAANFPTIGMSSEMTNPSYLHYDPIQQ-VATC 376 Query: 169 GLDMGLNSTDLALRRTISAPSSIPEPFLDTSCFTQAQPTAIWDADLQNIFNVEFQQGR-S 227 G++MG+N ++ALRRTISAP SIP+ FLD SCFTQ QP++ WDADLQN++ EF QGR Sbjct: 377 GVEMGINPAEIALRRTISAPVSIPDTFLD-SCFTQIQPSSTWDADLQNLYGPEFHQGRLM 435 Query: 228 SFQSQ-PFTGSIEDSNLKMEM 247 SF SQ FTG I+ SNLKMEM Sbjct: 436 SFPSQAAFTGPIDASNLKMEM 456 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6913 (233 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9656 (171 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3449 160 1e-41 >Vv3449 Length = 162 Score = 160 bits (406), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 77/85 (90%), Positives = 84/85 (98%) Query: 1 MASAEIEFRCFVGGLAWATDNEALERAFSQYGEIIESKIINDRETGRSRGFGFVTFGSEQ 60 MASAEIE+RCFVGGLAWATD+++LERAFSQ+GEI+ESKIINDRETGRSRGFGFVTF SEQ Sbjct: 1 MASAEIEYRCFVGGLAWATDDQSLERAFSQFGEILESKIINDRETGRSRGFGFVTFSSEQ 60 Query: 61 AMRDAIEGMNGQNLDGRNITVNEAQ 85 +MRDAIEGMNGQNLDGRNITVNEAQ Sbjct: 61 SMRDAIEGMNGQNLDGRNITVNEAQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25486 (460 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10966264 95 2e-21 >Vv10966264 Length = 513 Score = 95.1 bits (235), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 92/409 (22%), Positives = 163/409 (39%), Gaps = 67/409 (16%) Query: 84 TQKFKKLLLFSGNDYLGLSSHPTIGKAAAKAALEH-GMGPRGSALICGYTDYHRRLESCL 142 T K K L +YLG ++ +L+ G + + G T H+ +E C+ Sbjct: 96 TTKISKCLNLGSYNYLGFAASDEFCTPRVIESLKRFSPGTCSTRVDGGTTTLHKEVEECV 155 Query: 143 ADLKKKEDCLLCPTGFAANMALMVALGNVGSLLSAGKMPLTNEKIAVFSDALNHASIIDG 202 A+ K ++ G+ N A++ L G L + SD+LNH SI++G Sbjct: 156 ANFVGKPAAIVFGMGYVTNSAILPVLIGKGGL--------------IISDSLNHNSIVNG 201 Query: 203 IRLAERQKSVEIFIYRHCDMAHLNALLSSCTM----------RKKVVVTDTLFSMDGDFA 252 R + +++H +HL +L +K +VV + ++SM+G+ Sbjct: 202 ----ARGSGATVRVFQHNIPSHLEKVLREQIAEGQPRTHRPWKKIIVVVEGIYSMEGELC 257 Query: 253 PITELVKLRREHDF------------------------LLVIDDAHGTFVCGKNGGGVAE 288 + E+V + +++ + +D+AH GK G GV E Sbjct: 258 KLPEIVAICKKYKVCSSTQKNLQSSGACYRYASMTYKAYVYLDEAHSIGAVGKTGRGVCE 317 Query: 289 EYNCE-GDVDICVGTLSKAAGCHGGFIACSKRWKQFIQSRGRSFIFSXXXXXXXXXXXXX 347 + DVDI +GT +K+ G GG+IA SK Q+++ + +++ Sbjct: 318 LLGVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIIS 377 Query: 348 XXXXXRKE---------TWRRREIWNRVKDFRALTGIPI----NSPIISLIVGSEEKALQ 394 E R RE N + G + +SP++ +++ + K Sbjct: 378 SIKVILGEDGSSRGAQKLARIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPA 437 Query: 395 ASQSLLKSGFHVTAIRPPTVPPNSCRLRVTLSATHTRNDVERFTAALSR 443 S+ LK V + P P R R+ +SA+HTR D+ + +SR Sbjct: 438 FSRECLKQNVAVVTVAFPATPLLLARARICISASHTREDLIKGLEVISR 486 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14063 (580 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17040 100 6e-23 >Vv17040 Length = 210 Score = 100 bits (250), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 64/205 (31%), Positives = 105/205 (51%), Gaps = 30/205 (14%) Query: 77 VMISGAPASGKGTQCELIVNKFGLVHISTGDLLRAEVSSGTEIGNKAKEFMNAGRLVPDE 136 V + G P SGKGTQC IV FG H+S GDLLRAE+ SG+E GN + + G++VP E Sbjct: 25 VFVLGGPGSGKGTQCANIVKHFGYTHLSAGDLLRAEIKSGSENGNMIQSMIKEGKIVPSE 84 Query: 137 VVTAMVTARLSRDDAKEKGWLLDGYPRSFNQAQSLQKL-KIIPDVYIVLDVPDETLIDRC 195 VT + R +D+ +K +L+DG+PR+ + + + KI P+ + D +E + R Sbjct: 85 -VTIKLLQRAILEDSNDK-FLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRI 142 Query: 196 VGRRLDPVTGKIYHIKSFPPENQEIKARLITRPDDTEEKVKSRLEIYKKNADSISAAYSN 255 + R NQ R DD E ++ R +++ +++ + Y + Sbjct: 143 LNR------------------NQ-------GREDDNVETIRKRFKVFLESSLPVIEYYES 177 Query: 256 --IMKKIDGNHSKDVVFEVIDSILS 278 ++KID S + VFE + ++ + Sbjct: 178 KGKVRKIDAAQSIEEVFEAVKAVFT 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11077 (317 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3451 145 9e-37 >Vv3451 Length = 283 Score = 145 bits (366), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 88/222 (39%), Positives = 118/222 (53%), Gaps = 11/222 (4%) Query: 8 VLGSSHHVLSFARFAHRYGKKYESVEEMKLRYEIFLENKKLIRSTNRKGLSYTLAVNRFA 67 +L + HH F+ F R+GK Y S EE R+++F N + R + S T V +F+ Sbjct: 57 LLTADHH--HFSIFKRRFGKSYASQEEHDYRFKVFKANLRRARRHQQLDPSATHGVTQFS 114 Query: 68 DWSWEEFARHRLGAAQ-NCSATTKGNHKLTDAVLPESKNWKEEGIVTPVKDQGHCGSCWT 126 D + EF LG + L LPE +W++ G VT VK+QG CGSCW+ Sbjct: 115 DLTPAEFRGTYLGLRPLKLPHDAQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWS 174 Query: 127 FSTTGALEAAYVQAFGKQISLSEQQLVDCAGDFN-------NNGCNGGLPSQAFEYIKYN 179 FSTTGALE A A G +SLSEQQLV+C + + ++GCNGGL + AFEY Sbjct: 175 FSTTGALEGANFLATGNLVSLSEQQLVECDHECDPEEMGSCDSGCNGGLMNTAFEYTLKA 234 Query: 180 GGLDTEAAYPYVGVD-GACKFSSENVGVQVVDSVNITLGAEE 220 GGL E YPY G D G+CKF + V I+L ++ Sbjct: 235 GGLMKEEDYPYTGTDRGSCKFDKTKIAASVSHFQCISLDEDQ 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16441 (288 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754158 (214 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12583 (280 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20929 238 1e-64 >Vv20929 Length = 268 Score = 238 bits (606), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 140/285 (49%), Positives = 167/285 (58%), Gaps = 28/285 (9%) Query: 1 MSSSSETAE---VSGQRGMRTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQS 57 MSSSS+ A+ +GQR + S+F+QTCS+L QY+KEKG+FGDL+L C+ Sbjct: 1 MSSSSDIADSGRFTGQRAPARGPEKSSFSQTCSLLSQYIKEKGTFGDLSLGMTCS---LE 57 Query: 58 NGGTPEMFRQKAPP--MNFFPFVENS---RNMPTAVRDFKSMDLFPQQAGFGPSAPTPRE 112 GTPE RQ A MN FP E S +P + KSM+LFPQQAGFG S ++ Sbjct: 58 GNGTPESLRQTATTTTMNLFPMTERSAGVSGIPARNMNLKSMNLFPQQAGFGSS--VSKD 115 Query: 113 EVPMTADSSVKKSAPGEPQKAQMTIFYGGQVIVFNDFPADKAKEVMLLASKESSQSHTAP 172 + P +SSVKKS EPQ AQMTIFYGGQVIVFNDFPADKAKEVM LA SS + Sbjct: 116 DAPKIVNSSVKKSGNVEPQTAQMTIFYGGQVIVFNDFPADKAKEVMRLAGMGSSPVPSTT 175 Query: 173 ASPPAKTNNAFASHLGKXXXXXXXXXXXXXXMFPNFGNQAIQEGVKPSPRPVVCDLPIAR 232 P S + PNF N IQE ++ +PV C+LPIAR Sbjct: 176 VKNPIDAGGMAPS---------------TPNVVPNFANSLIQERIQRPAQPVACELPIAR 220 Query: 233 KASLHRFLEKRKDRLNTLAPYQTXXXXXXXXKPTENKSWLGLAAQ 277 KASLHRFLEKRKDR+ APY KP E+KSWLGLAA+ Sbjct: 221 KASLHRFLEKRKDRITARAPYNISNSPAGPHKPAESKSWLGLAAK 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2805 (271 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2685 (53 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21182 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46771 84 2e-18 >Vv46771 Length = 291 Score = 83.6 bits (205), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 61/196 (31%), Positives = 89/196 (45%), Gaps = 30/196 (15%) Query: 1 MNTNISYVDCFEDPGPHGNGRYSEHMLPEIEKKDFRKGAQWFSMKRQHAVIVMADSLYYS 60 M + SYVD F D GRY+ M P I K +RKG+QW S+ R HA +++ D + +S Sbjct: 86 MASPRSYVDSFLDVK---EGRYNPKMSPVIPKAKWRKGSQWISLVRSHAEVIVDDQVIFS 142 Query: 61 KFRDYCK--PGFDGR------------NCIADEHYLPTFFNIID-PGGIANWSVTHVDWS 105 F+ +CK P D R NCI DEHY+ T + + + ++T+ +W+ Sbjct: 143 VFKKFCKRRPPIDARKGKQNIKLQKQHNCIPDEHYVQTLLAMSELESELERRTLTYTEWN 202 Query: 106 ------ERK-WHPKLYKSQDITYELLKNIXXXXXXXXXXXXAKKVVQRWPCLWNGIQRPC 158 ER+ WHP + + + +K I + W C N PC Sbjct: 203 LSVTKMEREGWHPITFSYANAGPQRIKEIKDVNHVYYETEFRTE----W-CRANSTSVPC 257 Query: 159 YLFARKFHPETLNDLL 174 +LFARKF LL Sbjct: 258 FLFARKFSRGAAMRLL 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389866 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595856 (110 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265189 (68 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43368 60 7e-12 >Vv43368 Length = 465 Score = 60.5 bits (145), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 28/35 (80%), Positives = 32/35 (91%) Query: 2 AQQLIQEVITSRKEPVPSNYGVMDTGLRSSYSQLG 36 AQQLIQE I++ KEPVPS+YG MD+GLRSSYSQLG Sbjct: 400 AQQLIQEFISNHKEPVPSSYGKMDSGLRSSYSQLG 434 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3052 (287 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13812 (394 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31627 65 2e-12 >Vv31627 Length = 419 Score = 65.5 bits (158), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 78/343 (22%), Positives = 143/343 (41%), Gaps = 35/343 (10%) Query: 48 ALDKVKELVWEPSISRYGADEGLPELREALVQKLHRE--NKLYKSSVMVTAGANQAFVNL 105 A D + + V + Y GL R A+ + L R+ +L + +T G QA + Sbjct: 64 AEDAIADAVRSAKFNSYAPTVGLLPARRAVAEYLSRDLPYQLSPDDIYLTIGCTQAIEIM 123 Query: 106 ALTLCDAGDSVVMFAP--YYFNAYMSFQMTGVTNILVGPGHPKTLHPDADW---LEKTLS 160 L G ++++ P Y+ A + V + L P+ W LE + Sbjct: 124 IQVLARPGANILLPRPGFPYYEARAAADNLEVRHF--------DLLPEQGWEVDLEAVKA 175 Query: 161 ETKPTPKLVTVVNPGNPSGTYIPDSLLKRISNLCRDAGSWLVVDNTYEYFMYDD--LKHT 218 + +VNPGNPSG+ LK+++ R+ G ++ D Y + + Sbjct: 176 LADENTVAMVIVNPGNPSGSVFTYEHLKKVAETARNLGIMVISDEVYGHLAFGSKPFVPM 235 Query: 219 CVEGN--HIVNIFSFSKAYGMMGWRVGYIAYPSEVEGFGTQLLKVQDNIPICASIISQHL 276 V G+ IV + S SK + + GWR+G++ +++ G V ++I C + IS Sbjct: 236 GVFGSIVPIVTVGSISKRWVVPGWRLGWLVT-NDLNGI-LHKSGVVESIISCLN-ISSDP 292 Query: 277 ALYSLEMGPEWVIERVKGLVKNRDIVIEALSPLGDSAVKG---------GEGAIYLWAKL 327 A + PE + + + N ++ + + +KG EG++++ KL Sbjct: 293 ATFIQGAIPEILEKTKEDFFSNTISILRECADIIHDRIKGIPCITCPQKPEGSMFVMVKL 352 Query: 328 P----DKYADDDKFVHWLAHRHGVVVIPGSACGCPGNVRISFG 366 + DD +F L+ V+V+PG + G +R++F Sbjct: 353 NLFLLEDIDDDVEFCMKLSKEESVIVLPGVSVGMKNWLRVTFA 395 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32343 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10663 (212 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57566 80 3e-17 >Vv57566 Length = 286 Score = 80.1 bits (196), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 59/153 (38%), Positives = 79/153 (51%), Gaps = 26/153 (16%) Query: 55 AQLTIFYAGSVSVFDAITAEKVRELMLIXXXXXXDKKTSDVKNSATSCPPSPLIRTGSST 114 +Q+TIFYAG V VF+ AEK RE+ML+ + + +TS P I TGSST Sbjct: 128 SQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFL---STSGPEK--INTGSST 182 Query: 115 LQKSSTAPGSPVVQPFPEQNSSI---------------CKLQAEFPIARRHSLQRFLEKR 159 S + P SP P P+ SS L +E PIARR+SL RFLEKR Sbjct: 183 -APSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSELPIARRNSLHRFLEKR 241 Query: 160 RDRMVSNSPY----PTSPA-TPKDDNAKTIQSD 187 +DR+ S +PY P+ P+ P++D + D Sbjct: 242 KDRVNSKAPYQVNNPSRPSPKPEEDTNPKLNKD 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3173 (80 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46424042 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11014 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48056 110 3e-26 >Vv48056 Length = 118 Score = 110 bits (274), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 50/74 (67%), Positives = 55/74 (74%) Query: 154 MSPDGRYMASGDEDGAIMMWDLSTGRCVTPLMGHTSCVWTLDFXXXXXXXXXXXXDCTVK 213 MSPDG+YMASGDEDG IMMWDLS+GRCV PLMGH SCVW+L F D VK Sbjct: 1 MSPDGQYMASGDEDGTIMMWDLSSGRCVMPLMGHMSCVWSLAFSCEGSLLASGSADSXVK 60 Query: 214 LWDVTASTKLPRTE 227 LWDVT STK+PR+E Sbjct: 61 LWDVTTSTKVPRSE 74 Score = 59.3 bits (142), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 26/61 (42%), Positives = 39/61 (63%) Query: 117 NYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMSPDGRYMASGDEDGAIMMWDLS 176 Y+A+G D T+ +WD+ +G CV +GH S V SLA S +G +ASG D + +WD++ Sbjct: 6 QYMASGDEDGTIMMWDLSSGRCVMPLMGHMSCVWSLAFSCEGSLLASGSADSXVKLWDVT 65 Query: 177 T 177 T Sbjct: 66 T 66 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6023 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6911 96 2e-22 >Vv6911 Length = 157 Score = 95.5 bits (236), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 47/99 (47%), Positives = 70/99 (70%), Gaps = 7/99 (7%) Query: 2 RTGMFSYTTYEDQTNEPHFLDACHLCRKPLGNNSDIFMYRGNTPFCSKDCRQQEIKFDEN 61 R+ F +ED ++PHFL+AC LC KPLG+N DI+MYRG+TPFCS++CRQ++I+ DE Sbjct: 61 RSARFYDARFED--HQPHFLEACFLCNKPLGDNRDIYMYRGDTPFCSEECRQEQIEMDEA 118 Query: 62 KEKSWKVTSSRR-KSDPNKNSTPNKN----VRTGSVAVA 95 EK+ ++S + + + +STP+K+ RTG+VA A Sbjct: 119 TEKNRSISSIKAFRKEQKTSSTPSKSQNYPFRTGTVAAA 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20776 (259 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 84 3e-18 >Vv12866259 Length = 264 Score = 83.6 bits (205), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 71/207 (34%), Positives = 91/207 (43%), Gaps = 50/207 (24%) Query: 71 PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWS--GIP- 127 P +L G PGDYG+D GL DP RE E+IH RWAM +G + S G+ Sbjct: 65 PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKF 124 Query: 128 ----WFEAGA------------DPSAISPFSFGSLLGTQLLLMGWVESKRWVDFYNPESQ 171 WF+AGA +PS I S ++ Q++LMG VE R Sbjct: 125 GEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIA-------- 176 Query: 172 SVEWATPWSKTSENFANSTGEQGYPGGKFFDPLGFAGSIQDGVYVPDSEKLERLKLAEIK 231 P + ++ YPGG F DPLG A D E LK+ EIK Sbjct: 177 ----GGPLGEVTDPL--------YPGGSF-DPLGLAD---------DPEAFAELKVKEIK 214 Query: 232 HARLAMVAMLIFYFEA-GQGKTPLGAL 257 + RLAM +M F+ +A GK PL L Sbjct: 215 NGRLAMFSMFGFFVQAIVTGKGPLENL 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14244 (369 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26272 70 9e-14 >Vv26272 Length = 357 Score = 69.7 bits (169), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 32/70 (45%), Positives = 46/70 (65%) Query: 79 VRADADFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPGAETKFKEISNAYEVLSDD 138 V+ D+Y VLG+ ++ + +I+ AYRKL+ HPD NK PGAE FK +S A++ LS++ Sbjct: 108 VKKKKDYYEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNE 167 Query: 139 EKRSLYDKYG 148 E R YD G Sbjct: 168 ESRKKYDLVG 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7194 (216 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6720 (214 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35303 120 2e-29 >Vv35303 Length = 394 Score = 120 bits (300), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 8/170 (4%) Query: 10 ACVAILRNKQLFVANAGDSRCVISRKGQAYNLSRDHKPDLELEKERILKAGGFIHAGRVN 69 A A++ + L VANAGD R V+ RKGQA ++S+DH+P LE++R+ + GGF+ +N Sbjct: 197 ALTALIFGRTLMVANAGDCRAVLCRKGQAVDMSQDHRPSYPLERKRVEELGGFVDGEYLN 256 Query: 70 GSLNLARAIGDMEFKQNKFLPDEKQIITACPDINTVELCDDDEFIVLACDGIWDCMSSQQ 129 G L++ RA+GD + KF + A P+ V L ++DEF+++ CDGIWD MSSQ+ Sbjct: 257 GVLSVTRALGDWDM---KFPRGSASPLIAEPEFRQVALTEEDEFLIIGCDGIWDVMSSQE 313 Query: 130 VVDFVREQLLSESKLSVVCERALDRCLAPSTAGGEGCDNMTMIVVQFKKP 179 V VR L + L +T DN+T+IV+ F P Sbjct: 314 AVSLVRRGLRRHDDPEQSARDLVMEALRLNT-----FDNLTVIVICFSSP 358 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5669 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027352 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15697 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11006 (402 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26058 372 e-105 >Vv26058 Length = 329 Score = 372 bits (954), Expect = e-105, Method: Compositional matrix adjust. Identities = 177/243 (72%), Positives = 211/243 (86%) Query: 160 MMSFAKNCKGLKKLSCGSCTFGAKGMNAVLDNCSALEELSVKRLRGITDGSAAEPIGPGV 219 M + AKNCKGLKKLSCGSCTFG KG+NAVLD+CSALEELSVKRLRG+ D AEPIGPGV Sbjct: 1 MAALAKNCKGLKKLSCGSCTFGTKGINAVLDHCSALEELSVKRLRGMNDRGVAEPIGPGV 60 Query: 220 AAASLKTICLKELYNGQCFGPLIIGAKKLRTLKLFRCSGDWDKLLQVISERVTSMVEIHL 279 AA+SLK++CLKELYNGQCF L++ +KKLRTLKLF C GDWD+ L+ +++ +++VEIHL Sbjct: 61 AASSLKSLCLKELYNGQCFERLVVASKKLRTLKLFGCFGDWDRFLETVTDGNSNLVEIHL 120 Query: 280 EKLQVSDVGLTAISNCLDLEILHLVKTPECTNVGLVSVAERCKLLRKLHIDGWKANRVGD 339 E+LQV+D+GL+AIS CL+LEILH+++TPECTN+GLVSVA CKLLRKLHIDGW+ NR+GD Sbjct: 121 ERLQVTDMGLSAISKCLNLEILHILRTPECTNLGLVSVAGNCKLLRKLHIDGWRTNRIGD 180 Query: 340 EGLVSVAKNCANLQELVLIGVNPTKVSLEALASNCPNLERLALCGSDTVGDVEISCIAVK 399 EGL++VAK C NLQELVLIGVNPT S+ A+ASNC LERLALCGS T+GD EIS IA K Sbjct: 181 EGLIAVAKQCTNLQELVLIGVNPTSSSITAVASNCQKLERLALCGSQTIGDKEISSIAAK 240 Query: 400 CVA 402 C A Sbjct: 241 CTA 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21532 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14904 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226751914 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380225 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31677 (255 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17858 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13301 (130 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32324 (340 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5754 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9724 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8623 (321 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48899 202 9e-54 >Vv48899 Length = 338 Score = 202 bits (513), Expect = 9e-54, Method: Compositional matrix adjust. Identities = 137/339 (40%), Positives = 175/339 (51%), Gaps = 24/339 (7%) Query: 4 CIEAKALKSSLRR-ELAVKSTQH-VLLEELWCATGISGVPCEDFSVDDLLDLSNG----- 56 C+E KALKSS+ R ELA K TQ L+++ G SGV +DFS+DDLLD +NG Sbjct: 3 CVE-KALKSSVVRPELAFKLTQQPACLDDMCMGNGQSGVSGDDFSIDDLLDFTNGGIGEG 61 Query: 57 --------XXXXXXXXXXXXXXXXXXXXXXISNSSSLVLPDSDSGLATQLLVPDDDLAEL 108 ++ ++ V + S AT+L VP DDLA+L Sbjct: 62 LFQEEDEEDEDKGCGSLSPRRELTENDNSNLTTTTFSVKDEFPSVPATELTVPADDLADL 121 Query: 109 EWVSHFVDDSLPDLSLFHTIGTQKPEALLMNRFEPEPK-PVPLRAPL-FPFQVPVKPRTK 166 EW+SHFV+DS + S GT +A PEP+ P+ +++ L PF P K R+K Sbjct: 122 EWLSHFVEDSFSEYSAPFPHGTLTEKAQNQTENPPEPETPLQIKSCLKTPF--PAKARSK 179 Query: 167 RYKPASRVWXXXXXXXXXXXXXXXXXXXXTPC---LIF-NPVQSMDVFVGEXXXXXXXXX 222 R + RVW + LI+ N Q+++ F Sbjct: 180 RARTGGRVWSMGSPSLTESSSSSSSSSSSSLSSPWLIYPNTCQNVESFHSAVKPPAKKHK 239 Query: 223 XXVQTGEGSIGGQFQRRCSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPAC 282 + RCSHC VQKTPQWRTGPLG KTLCNACGVR+KSGRL PEYRPAC Sbjct: 240 KRLDPEASGSAQPTPHRCSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRLLPEYRPAC 299 Query: 283 SPTFSGAVHSNSHRKVLEMRKRKDVGEPEPLLNRMIRSF 321 SPTFS +HSN HRKVLEMR++K+V PE L + SF Sbjct: 300 SPTFSSEIHSNHHRKVLEMRRKKEVTRPESGLAPAVPSF 338 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12008 (392 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23925 300 2e-83 >Vv23925 Length = 183 Score = 300 bits (769), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 135/183 (73%), Positives = 157/183 (85%) Query: 210 MKNSIPLEKSDDCSWAPIFVRQSNFKLPADTKVPILMIGPGTGFAPFRGFLQERLALKED 269 MKN++ LEKS + SWAPIF+R SNFKLP D PI+M+GPGTG APFRGFLQERLALKED Sbjct: 1 MKNAVSLEKSHNSSWAPIFIRPSNFKLPVDPLTPIIMVGPGTGLAPFRGFLQERLALKED 60 Query: 270 GAELGSSTLFFGCRNSQMDYIYEDELNNFLATGALSELVVAFSRQGPTKEYVQHKMMQKA 329 G +LG + LFFGCRN +MD+IYEDELNNF+ G LSEL++AFSR+GP KEYVQHKMM +A Sbjct: 61 GVQLGPALLFFGCRNRRMDFIYEDELNNFVEQGILSELILAFSREGPQKEYVQHKMMDRA 120 Query: 330 SDVWNMISQGGYIYVCGDAKGMARDVHRTLHTIVQEQGCMDSSKAEGLVKNLQMNGRYLR 389 S +WN+ISQGGY+YVCGDAKGMA+DVHRTLHTIVQEQ ++SSKAE +VK L GRYLR Sbjct: 121 SYIWNIISQGGYLYVCGDAKGMAKDVHRTLHTIVQEQENVESSKAEAIVKKLHTEGRYLR 180 Query: 390 DVW 392 DVW Sbjct: 181 DVW 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8291 (342 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26023 600 e-173 >Vv26023 Length = 341 Score = 600 bits (1546), Expect = e-173, Method: Compositional matrix adjust. Identities = 283/342 (82%), Positives = 315/342 (92%), Gaps = 1/342 (0%) Query: 1 MADLKSKFLKVYSVLKSELLEDPAFDFTNDSRRWVERMLDYNVPGGKLNRGLSVIDSYQL 60 M++ KSKFL+VYSVLKSELL DPAF+FT+DSR+WVERMLDYNVPGGKLNRGLSV+DSY+L Sbjct: 1 MSETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKL 60 Query: 61 LQQGRELTEDEIFLASALGWCIEWLQAFFLVHDDLMDGSHTRRGQPCWFRLPKVGMIAVN 120 LQ GR+LT+DE+FLA LGWCIEWLQA+FLV DD+MD SHTRRGQPCWFR+PKVGMIA N Sbjct: 61 LQ-GRQLTDDEVFLACVLGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFRVPKVGMIAAN 119 Query: 121 DGVVLRNHIPRILRKHFREKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL 180 DGV+LRN IPRIL+ HF+ KPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL Sbjct: 120 DGVILRNQIPRILKNHFKGKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSL 179 Query: 181 SIHRRIVQYKTAYYSFYLSVACALLMSGEELEKHIDVKNILVEMGIYFQVQDDYLDCFGD 240 +HRRIVQYKTAYYSFYL VACALL++GE L+ H VK+ILV+MGIYFQVQDDYLDCFGD Sbjct: 180 PLHRRIVQYKTAYYSFYLPVACALLIAGENLDNHTSVKDILVQMGIYFQVQDDYLDCFGD 239 Query: 241 PETIGKIGTDIEDFKCSWLVVKALELCNEEQKKVLHENYGKPDPENVAKVKALYKELDIE 300 P+ IGKIGTDIEDFKCSWLVVKALE+CNEEQKK L+ NYGK DP NVAKVKALYK+LD++ Sbjct: 240 PQVIGKIGTDIEDFKCSWLVVKALEICNEEQKKTLYGNYGKADPANVAKVKALYKDLDLQ 299 Query: 301 GVFADYESKSHKKLTSWIEGHPSKAVQAVLKSFLGKIYKRQK 342 GVF +YESKS++ L S IE HPSKAVQAVLKSFLGKIYKRQK Sbjct: 300 GVFLEYESKSYETLVSSIEAHPSKAVQAVLKSFLGKIYKRQK 341 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7292 (258 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26979 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19649 (389 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15674 167 2e-43 >Vv15674 Length = 389 Score = 167 bits (424), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 108/326 (33%), Positives = 176/326 (53%), Gaps = 8/326 (2%) Query: 13 MIPIAIVQSFASLDGLEKVAPFLKPIVEVKFIKSVIAGFLPGIALKIFLIFLPTILMIMA 72 MIPI ++ + +L L K FLKPIVE+ IK+V+ +LP +AL IFL LP +L+ ++ Sbjct: 47 MIPIGLISAVTTLKNLVKYLSFLKPIVEIVAIKTVLEAYLPQLALIIFLALLPKLLLYLS 106 Query: 73 KFEGYIXXXXXXXXXXXXYYLFSLVNVFLGSIITGTAFEQLDSFTHQSASDIPKTIGVAI 132 K EG Y+ F+++NVF+G + T F+ + +I + ++ Sbjct: 107 KAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGATLFDTFKTIEEDQPKEIVSILAKSL 166 Query: 133 PMKATFFISYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMDPGSIGFNTG 192 P ATFF++++ + + G E+ + PLII+HLK +L KT+ + +EA PG +G+ + Sbjct: 167 PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR 226 Query: 193 EPQIQLYILLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDVHG 252 P L I + L Y+ + P +LPF +++FGL +++ R+Q + VY YES WP +H Sbjct: 227 VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV 286 Query: 253 RIITAXXXXXXXXXXXXXTKEAASSTPFLIALPVLTLSFHRYCKGRFEPAFTTYPLQEAM 312 R+I A K+ TPF+I L +L+L F C+ +F +F + PL+ A Sbjct: 287 RLIGALLLYQVTMLGYFGVKK-FHYTPFVIVLLILSLIFIFVCQKKFYRSFQSVPLEVA- 344 Query: 313 MKDTLERAREPNLNLKGYLQSAYIHP 338 + E PN+ ++ AYI P Sbjct: 345 ---SHELKESPNME---HIFRAYIPP 364 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5090 (224 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20048 (275 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22793 (406 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48577 628 0.0 >Vv48577 Length = 514 Score = 628 bits (1619), Expect = 0.0, Method: Compositional matrix adjust. Identities = 289/406 (71%), Positives = 341/406 (83%), Gaps = 1/406 (0%) Query: 1 GSSNLWVPSSKCYVSLACFFHAKYNSGQSRTYKNNGTSASIQYGSGAISGFFSNDNVKVG 60 GSSNLWVPSSKCY S+ C+FH+KY S QS TY+ NG SA I YG+GAISGFFS DNVKVG Sbjct: 110 GSSNLWVPSSKCYFSVPCYFHSKYKSSQSSTYRKNGKSADIHYGTGAISGFFSEDNVKVG 169 Query: 61 DIVVKNQDFIEATSEPGLTFVTAKFDGLLGLGFQEISVGGSVPVWYNMVERGLIKEPVFS 120 D+VVKNQ+FIEAT EP +TF+ AKFDG+LGLGFQEISVG +VPVWYNMV++GL+KEPVFS Sbjct: 170 DLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQEISVGNAVPVWYNMVKQGLVKEPVFS 229 Query: 121 FWLNRNAQDEAGGEIVFGGVDPKHFKGKHTYVPVTRKGYWQFNMGDVLIGGKPTGFCAGG 180 FWLNR D+ GGE+VFGGVDP HFKG+HTYVPVT+KGYWQF+MG+VLI G+ TG+CAGG Sbjct: 230 FWLNRKTDDDEGGELVFGGVDPDHFKGEHTYVPVTQKGYWQFDMGEVLIDGETTGYCAGG 289 Query: 181 CFAIADXXXXXXXXXXXXXXKINQAIGASGVVSQECKAVVNQYGRTILDLLVAHEVQPKK 240 C AIAD IN AIGA+GVVSQECK VV QYG TI+DLL++ E P+K Sbjct: 290 CAAIADSGTSLLAGPTAVVAMINHAIGATGVVSQECKTVVAQYGETIMDLLLS-EASPQK 348 Query: 241 VCSQIGVCTFDGTRSVSMGIESVVDEKNGKSSGILHDASCSACEMAVVWMQNELKKNITQ 300 +CSQIG+CTFDGTR V MGIESVVDEKNG S +HDA CSACEMAVVWMQ++L++N T+ Sbjct: 349 ICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACEMAVVWMQSQLRQNQTK 408 Query: 301 DRILNYVNELCEKMPDTLGQSTVDCGKLSSMPPVSFTIGGRAFKLTSDEYILKVGEGAQA 360 +RIL YVNELC+++P +G+S VDC +LSSMP VS TIGG+ F L+++EY+LKVGEGA A Sbjct: 409 ERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTIGGKVFDLSANEYVLKVGEGAAA 468 Query: 361 QCISGFTSLDIPRPRGPLWILGDIFMGRYHTVFDYGKMRVGFADAA 406 QCISGF ++D+P PRGPLWILGD+FMGRYHTVFDYG MRVGFA+AA Sbjct: 469 QCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 514 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32840 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743283 (163 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32423 (271 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12536 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18148 (365 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56585 278 1e-76 >Vv56585 Length = 289 Score = 278 bits (711), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 126/237 (53%), Positives = 169/237 (71%), Gaps = 1/237 (0%) Query: 1 MVGLTLINGAAAKGAVCLDGTLPAYHIHRGYGSGANSWLVQLEGGGWCDTIRNCVYRKKT 60 +V LTL+ A KGAVCLDG+ P YH G+GSG+N+W++ +EGGGWC+T+ +C+ RK T Sbjct: 47 LVDLTLVRHAKDKGAVCLDGSAPGYHFRSGFGSGSNNWVLHIEGGGWCNTVASCLIRKTT 106 Query: 61 RRGCSVYMEKQIPFSGILSNKAGENPDFYNWNRVKVRYCDGASFSGDSQNEAARLHFRGQ 120 G S YME+Q+ FSGILS+ + +NPDF++WN+VK+RYCDGASF+G+SQ +L FRGQ Sbjct: 107 ALGSSNYMERQVRFSGILSHDSSQNPDFFDWNKVKLRYCDGASFAGNSQKNETQLFFRGQ 166 Query: 121 RIWKAAMEDLMSKGMRYANQALLSGCSAGGVATVLHCDGFRGMFPSTTKVKCLSDGGLFL 180 RIW+A M++L+S G+ A Q LLSGCSAGG+AT++HCD FRG+ P VKCL+D G FL Sbjct: 167 RIWEAVMDELLSIGLSNAKQVLLSGCSAGGLATLIHCDDFRGILPKDATVKCLADAGFFL 226 Query: 181 DAIDVSGTRTLRSMFTRVVSLQGVQKNLPWSCTNRLNPT-LCFFPQHLIASVKTPLF 236 D DV+G R +RS ++ VV LQGV +L C R+ P+ F + K P F Sbjct: 227 DEKDVTGNRRIRSFYSDVVHLQGVANSLDKDCVGRMEPSQAVFLSSRIYQEHKNPSF 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2897 (435 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8750 (294 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65230 315 6e-88 >Vv65230 Length = 281 Score = 315 bits (807), Expect = 6e-88, Method: Compositional matrix adjust. Identities = 155/292 (53%), Positives = 197/292 (67%), Gaps = 17/292 (5%) Query: 2 ASCKQWTVFLSLLCLXXXXXXXXXXXXXXXXFGRNYMPTWAFDHIKYFNGGKEIQLHLDK 61 +S ++VFL L + F +++ TW + K FNGG+ + L LD+ Sbjct: 3 SSSNGYSVFLLLFAVVVATASASN-------FYQDFDLTWGDNRAKIFNGGQLLSLSLDQ 55 Query: 62 YTGTGFQSKGNYLFGHFHMQIKMVPGDSAGTVTAYYLSSQNNEHDEIDFEFLGNRTGQPY 121 +G+GFQSK YLFG MQ+K+V G+SAGTVTAYYLSSQ + HDEIDFEFLGN +G PY Sbjct: 56 ASGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGSTHDEIDFEFLGNLSGDPY 115 Query: 122 ILQTNVFTGGKGDREQRIFLWFDPTAAYHSYAVLWNLYQIVFLVDDIPIRVFKNSKDLGV 181 IL TNVFT GKG+REQ+ +LWFDPT +H+Y+++W I+FLVD++PIR+FKN++ +GV Sbjct: 116 ILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIIWTARHIIFLVDNVPIRLFKNAESMGV 175 Query: 182 KFPFNQPMKLYSSLWNADDWATRGGLEKTDWSKAPFIASYRGFHIDGCEASVEAKYCATQ 241 FP NQPM++YSSLWNADDWATRGGL KTDWSKAPF A YR F + + Q Sbjct: 176 PFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFRANSSTPTSSFPDSTFQ 235 Query: 242 GKRWWDQKEFQDLDAQQWRRLRWVRKKFTIYNYCTDRVRYP-SMPPECKRDR 292 Q+LD+ RRLRWV+K F IYNYCTD R+P +P ECKR R Sbjct: 236 T---------QELDSYSRRRLRWVQKNFMIYNYCTDLKRFPQGVPAECKRSR 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992109 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4475 (443 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57523 278 1e-76 >Vv57523 Length = 209 Score = 278 bits (712), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 146/211 (69%), Positives = 164/211 (77%), Gaps = 5/211 (2%) Query: 3 ASVSKLSNPTPASSLSST--FSPRTPQPRCLIRLLTTPGSTFNXXXXXXXXXXXXXXXXR 60 AS+SKL +P+P SS S + R+ QP+CLI + FN R Sbjct: 2 ASISKLVSPSPVSSYSVSGSLKSRSLQPKCLIDFHSR--DVFNARVSSSRLSVRNDVV-R 58 Query: 61 GSLVVRCSQSDGNGSPVKRTYLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNP 120 GSL+VRCSQ +GNGS +KRT LHDLYE+ GQSPWYDNLCRPVTDLLPLIASG RGVTSNP Sbjct: 59 GSLIVRCSQLEGNGSQIKRTTLHDLYEQGGQSPWYDNLCRPVTDLLPLIASGARGVTSNP 118 Query: 121 AIFQKAISTSNAYNDQFRELVHSGKDIESAYWELVVKDIQDACKLFESIYDQTDAGDGYV 180 AIFQKAIS+SNAYN+QFRELV +GKDIESAYWELVVKDIQDAC+LFE IYD+TD GDGYV Sbjct: 119 AIFQKAISSSNAYNEQFRELVLAGKDIESAYWELVVKDIQDACRLFEPIYDETDGGDGYV 178 Query: 181 SVEVSPRLADDTQGTVDAAKWLHKVVARPNV 211 SVE+SP LADDT GTV AKWL+KVV RPNV Sbjct: 179 SVEISPXLADDTVGTVKTAKWLYKVVDRPNV 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29010 (295 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65797 89 8e-20 >Vv65797 Length = 399 Score = 89.0 bits (219), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 24/123 (19%) Query: 172 RSLGELELEEVKGFIDLGFTFKKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEV 231 +SL +LE EEV+GF DLGFTF+KE LSP +++++PGLQ D +E Sbjct: 300 KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQ------------VKDRGGPME- 346 Query: 232 PXXXXXXXXXGEVMRPYLSEAWLIKRPDSPLLNLRLPRVSAAADMKKHLKFWARTVASEI 291 V RPYLSEAW+ + P+ N S+A DMK +KFWAR VAS + Sbjct: 347 ---------EDSVRRPYLSEAWIEQCSAPPIPNWV--GKSSAQDMKAQIKFWARAVASNV 395 Query: 292 HQE 294 HQE Sbjct: 396 HQE 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51912285 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11099 244 4e-67 >Vv11099 Length = 164 Score = 244 bits (624), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 118/154 (76%), Positives = 134/154 (87%) Query: 1 MDFSKSSKNALEWAIANLADKGDTLYIIHIKPNSLGESRSQLWAQSGSPLIPLTEFREPQ 60 MDFS SSK AL+WAI NLADKGD LYIIHIK +S ESR LW GSPLIPLTEFR+P+ Sbjct: 11 MDFSSSSKLALQWAIDNLADKGDLLYIIHIKSSSGDESRDVLWTTHGSPLIPLTEFRQPE 70 Query: 61 IMKNYGVQTDMEVLDTLDTVSRQKEVIVVTKLYWGDAREKLLQAVEDLKLDSLVMGSRGL 120 IMK YGV+TD+EVLDTLDT SRQKEV +VTKLYWGDAR+KL +AVEDLKLDSLVMGSRGL Sbjct: 71 IMKKYGVKTDIEVLDTLDTASRQKEVKIVTKLYWGDARDKLCEAVEDLKLDSLVMGSRGL 130 Query: 121 STIKRIVLGSVSNFVLTNASIPVTIVKDPSMQQH 154 STI+RI+LGSV+N+V+TNA+ PVTIVKDPS + Sbjct: 131 STIRRILLGSVTNYVMTNATCPVTIVKDPSSHKQ 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264770 (130 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7407 (215 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034055 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14166258 113 2e-27 >Vv14166258 Length = 161 Score = 113 bits (282), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 67/171 (39%), Positives = 96/171 (56%), Gaps = 15/171 (8%) Query: 4 VAESERRILV-AVDEGEESMHALSWCLKNVAGQ---NSKDTLVLLHAKPPRAVFTALDGT 59 +A +E+ ++V +D E S++A W L + + LV++HAKP A L G Sbjct: 1 MATAEKSVMVVGIDHSEHSLYAFEWTLDHFFAPFPGTAPFKLVIVHAKPSPATAIGLGGP 60 Query: 60 GRREDPSAYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPRDVI 119 G + D+L E AD V+EKAR++C + +V GD R+V+ Sbjct: 61 G----------AIDVLPYVEADLKKTADRVVEKAREICSS-KSVTDVTVEVVEGDARNVM 109 Query: 120 CQMVERVRADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTN 170 C+ VE+ A +LV+GSHGYG IKRA LGSVS++CA + C V+IVKKPKT Sbjct: 110 CEAVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8855 (167 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14166258 114 1e-27 >Vv14166258 Length = 161 Score = 114 bits (284), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 66/164 (40%), Positives = 95/164 (57%), Gaps = 8/164 (4%) Query: 4 VAESERRILV-AVDEGEESMHALSWCLKNVAGQ---NSKDTLVLLHAKPPRAVFTALDGT 59 +A +E+ ++V +D E S++A W L + + LV++HAKP A L G Sbjct: 1 MATAEKSVMVVGIDHSEHSLYAFEWTLDHFFAPFPGTAPFKLVIVHAKPSPATAIGLGGP 60 Query: 60 AYLFSSDILAATEKYGADVADCVMEKARKMCKDLQPDLKAETKVESGDPRDVICQMVERV 119 + D+L E AD V+EKAR++C + +V GD R+V+C+ VE+ Sbjct: 61 GAI---DVLPYVEADLKKTADRVVEKAREICSS-KSVTDVTVEVVEGDARNVMCEAVEKH 116 Query: 120 RADVLVMGSHGYGVIKRAFLGSVSNHCAQNVKCPVLIVKKPKTN 163 A +LV+GSHGYG IKRA LGSVS++CA + C V+IVKKPKT Sbjct: 117 HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19391 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49941 118 6e-29 >Vv49941 Length = 227 Score = 118 bits (295), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 59/134 (44%), Positives = 79/134 (58%), Gaps = 1/134 (0%) Query: 1 MHGGLSPELENLDQIKEISRPTDIPYNGLLCDLLWSDPDARVEGWAESDRGVSCTFGADR 60 +HGGLSP L+ LD I+ + R ++P+ G +CDLLWSDPD R GW S RG TFG D Sbjct: 84 LHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRC-GWGISPRGAGYTFGQDI 142 Query: 61 VSDFLDKNELDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDEALVC 120 S F N L LI R HQ+V +GY + ++ +VT+FSAPNY N A+L + E + Sbjct: 143 ASQFNHTNGLTLISRAHQLVMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGENMDQ 202 Query: 121 SFEILKPVDHKASP 134 +F P + P Sbjct: 203 NFLQFDPAPRQIEP 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5492 (304 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71921177 (235 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21748 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58826 181 6e-48 >Vv58826 Length = 240 Score = 181 bits (460), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 92/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%) Query: 1 MPYLRRINATSTKT-YASRTLLFLQDDGTLKPLAIELSLPHPDGDQFGCTSNVYTPSSQG 59 +PY+ ++ T Y SR L FL DGTLKPLAIEL+ P +G V+TP+S+ Sbjct: 22 LPYVSKVRQIEGTTLYGSRALFFLTPDGTLKPLAIELTRPPIEGKP--QWKQVFTPTSES 79 Query: 60 VESSIWQLAKAYVAVVDSGYHQLISHWLTTHAAMEPFIIATNRQLSVLHPIHKLLHPHFR 119 +W+LAK + DSGYHQL+SHWL TH EP+IIATNRQLSV+HPI++LLHPHFR Sbjct: 80 TGRWLWRLAKVHFLAHDSGYHQLVSHWLRTHCVTEPYIIATNRQLSVMHPIYRLLHPHFR 139 Query: 120 DNMNVNALARQVLINAGGILEATLFPAKFSMEWSSAMY-KNWVFPEQALPVDLI 172 M++NA AR+ LINA GI+E++ P K+S+E SS Y + W F +ALP DLI Sbjct: 140 YTMHINAHARESLINAEGIIESSFSPGKYSVELSSVAYDQQWRFDREALPADLI 193 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8501 (517 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10928 315 1e-87 >Vv10928 Length = 222 Score = 315 bits (808), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 144/218 (66%), Positives = 182/218 (83%), Gaps = 3/218 (1%) Query: 3 GTRRNSTLICAPVVADSVDQMLVQMGKAKEVGADLVELRVDFLKNFSPRQDLSVLIKQSP 62 G +NSTLIC P++ +++++M+V M KAK GADLVE+R+D LK F+PRQDL VLI++ P Sbjct: 5 GMSKNSTLICVPIMGETIEKMVVDMSKAKTSGADLVEVRLDTLKRFNPRQDLEVLIRKCP 64 Query: 63 LPTLVTYRPAWEGGQYKGDDKQRQDALRVAMDLGADFIDVELKVADEFYNSIQGRKPEKV 122 LPTL TYRP WEGGQY+GD+ R+DALR+AM+LGAD++D+ELKVA EF NSI GRKPEK Sbjct: 65 LPTLFTYRPKWEGGQYEGDENSRRDALRLAMELGADYVDIELKVAHEFINSIHGRKPEKF 124 Query: 123 KIIVSSHNYEKTPSAEEIGDLVARIQATGADIVKIATTGLDITDSARVFQVLAHSQ---V 179 K+IVSSHNY+ TPS E++G+LV IQATGADIVKIATT L+ITD AR+FQ+ HSQ V Sbjct: 125 KVIVSSHNYQNTPSVEDLGNLVVSIQATGADIVKIATTALEITDVARIFQITVHSQVSSV 184 Query: 180 PMIGLVMGEKGLISRVLSAKYGAFLTFGTIEAGVVSAP 217 P+IGLVMGE+GLISR+L K+ +LTFG++E G+VSAP Sbjct: 185 PVIGLVMGERGLISRILCPKFSGYLTFGSLEPGIVSAP 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26973 (68 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19383 (68 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8507 (182 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv7645 110 1e-26 >Vv7645 Length = 492 Score = 110 bits (276), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 50/103 (48%), Positives = 73/103 (70%) Query: 74 AALTPELKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENEL 133 + L+ LK L KV+ + V+LFMKG+ + P+CGFS V+ILR V F + +IL + Sbjct: 150 SGLSDTLKIHLQKVIETQPVMLFMKGSPEEPKCGFSRKVVEILREEKVKFGSFDILLDTE 209 Query: 134 LRQGLKEYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 +R+GLK++S+WPTFPQLY +GE GGCDI + ++SGEL+E+ Sbjct: 210 VREGLKKFSNWPTFPQLYCKGELLGGCDIAIAMHESGELKEVF 252 Score = 108 bits (269), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 49/97 (50%), Positives = 68/97 (70%) Query: 80 LKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENELLRQGLK 139 L++ + ++ S +LFMKGT D P+CGFSS V LR+ NV F + +IL +E +RQGLK Sbjct: 394 LEDRVRNLINSSPTMLFMKGTPDAPKCGFSSKVVDALRAENVSFGSFDILTDEEVRQGLK 453 Query: 140 EYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 +S+WPTFPQLY +GE GGCDI ++ +GEL+ L Sbjct: 454 VFSNWPTFPQLYYKGELIGGCDIIMELRNNGELKSTL 490 Score = 102 bits (253), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 47/102 (46%), Positives = 69/102 (67%) Query: 75 ALTPELKNTLDKVVTSHKVVLFMKGTKDFPQCGFSSTCVQILRSLNVPFETINILENELL 134 L+ L + L+ ++ S V+LFMKG D P+CGFS V+IL+ V F + +IL ++ + Sbjct: 282 GLSVTLTSRLESLINSSPVILFMKGKPDEPRCGFSRKVVEILQQEKVDFGSFDILSDDEV 341 Query: 135 RQGLKEYSSWPTFPQLYIEGEFFGGCDITVDAYKSGELQELL 176 RQGLK +S+W ++PQLYI+GE GG DI ++ KSGEL +L Sbjct: 342 RQGLKVHSNWSSYPQLYIKGELIGGSDIVLEMQKSGELARVL 383 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21722 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50889568 (193 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54621652 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10848 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3802 (163 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41528 164 9e-43 >Vv41528 Length = 105 Score = 164 bits (415), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 80/105 (76%), Positives = 85/105 (80%) Query: 59 MCQXXXXXXXXXXXXESIYGAKFADENFNKKHTGPGILSMANAGPGTNGSQFFICTAKTE 118 MCQ ESIYGAKF DENF KKHTGPGILSMANAGPGTNGSQFFICT KTE Sbjct: 1 MCQGGDFTRGDGTGGESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFFICTDKTE 60 Query: 119 WLDGKHVVFGQVVEGLDVVKNIEKVGSGQGRTSKPVVVADCGQLS 163 WLDG+HVVFGQVVEG+DVVK +EKVGSG GRT+K V + DCGQLS Sbjct: 61 WLDGRHVVFGQVVEGMDVVKAVEKVGSGSGRTAKTVKIEDCGQLS 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4196 (287 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32983 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16198 171 5e-45 >Vv16198 Length = 226 Score = 171 bits (433), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 79/137 (57%), Positives = 109/137 (79%), Gaps = 2/137 (1%) Query: 2 VGAALSLVGSSVVDSHTSPCLCLDALPTTAMNLKSGG-EMVLQRNSMAKKHVVKPGSLEL 60 + ALS+VGSS+ D T PCLCLDALP++ M++K+GG ++V QRNS+ KK + +PG++E+ Sbjct: 1 MSGALSVVGSSIFDPKTCPCLCLDALPSSNMSVKAGGGDLVWQRNSVGKKRLSRPGTVEM 60 Query: 61 GSSFIDFGHDRRFSMKSLPVTGNRSTRKR-KNRGFVIVNELGGQYEDSFEDVKTQLLNYF 119 GSSF++ H+ R K L N+S+R++ K R ++V+E+ GQYEDSFEDVKTQ++NYF Sbjct: 61 GSSFVESWHEWRLEAKVLSSIVNKSSRRQHKARRLLVVSEVAGQYEDSFEDVKTQIVNYF 120 Query: 120 TYKAVRTVMNQLYEMNP 136 TYKAVRTVM+QLYEMNP Sbjct: 121 TYKAVRTVMHQLYEMNP 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31477 (475 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21169 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32577 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23685 (328 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10975 186 7e-49 >Vv10975 Length = 393 Score = 186 bits (471), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 91/212 (42%), Positives = 139/212 (65%), Gaps = 2/212 (0%) Query: 104 GFFFFMWYFLNVIFNIMNKKIYNYFPYPYFXXXXXXXXXXXYCLISWAVGLPKRAPIDAN 163 G +F W+ LNV+FNI NKK+ N FPYP+ LISWAV + + D + Sbjct: 103 GIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAVRIAEPPKTDLD 162 Query: 164 LLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFVLGQSIPLSLWL 223 K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+ S+F+LG++ P+ ++ Sbjct: 163 FWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPVPVYF 222 Query: 224 SLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAM--TDMDSTNLYAYIS 281 SL P++ G ++A++TEL+FN GF+ AMISN++F +R+I+SK+ M + N YA +S Sbjct: 223 SLLPIIGGCALAAVTELNFNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVGGMNYYACLS 282 Query: 282 IIALIVCIPPALILEGPQLIKYGFNDAIAKVG 313 +++L++ P A+ +EGPQ+ G+ AI+++G Sbjct: 283 MLSLLILTPFAIAVEGPQMWAAGWQKAISQIG 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12258 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17701 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2398 108 7e-26 >Vv2398 Length = 226 Score = 108 bits (269), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 48/75 (64%), Positives = 58/75 (77%) Query: 82 CQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS 141 CQ + C ADL+ K Y+RRHKVC+ H+KA ++ G QRFCQQCSRFH LSEFD+ KRS Sbjct: 75 CQAEGCNADLTHAKHYHRRHKVCEFHSKASTVFAAGLTQRFCQQCSRFHLLSEFDNGKRS 134 Query: 142 CRRRLAGHNERRRKT 156 CR+RLA HN RRRK+ Sbjct: 135 CRKRLADHNRRRRKS 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20850 (307 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48703 167 3e-43 >Vv48703 Length = 273 Score = 167 bits (422), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 87/126 (69%), Positives = 98/126 (77%), Gaps = 1/126 (0%) Query: 179 RSFVAVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNTKYPLVVKKTTDKNGYFFIT 238 RS VAVQGVVYCK+C Y G+DTL GA P+LGATVKLQCNNTKYPLVV TDKNGYFFI Sbjct: 140 RSLVAVQGVVYCKACKYRGIDTLLGASPLLGATVKLQCNNTKYPLVVLGKTDKNGYFFIQ 199 Query: 239 APKTVTTFGAHKCKVSLVSAPSTACSKPCDLHGGLSGALLRPVK-PFVSQKLPFLLYNVG 297 APK +TTFGAHKCKVSLVS+ S C+ DLH GL GA+LRP K P P++ ++VG Sbjct: 200 APKKITTFGAHKCKVSLVSSSSPTCNLATDLHFGLKGAILRPEKPPAGLPPPPYVTFSVG 259 Query: 298 AFAFEP 303 FAFEP Sbjct: 260 PFAFEP 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6580 (269 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13242 301 1e-83 >Vv13242 Length = 216 Score = 301 bits (770), Expect = 1e-83, Method: Compositional matrix adjust. Identities = 149/185 (80%), Positives = 155/185 (83%), Gaps = 10/185 (5%) Query: 1 MESTNSSSGSQHPQLPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEVDLYKFDPWEL 60 MEST+SSSGS PQLPPGFRF+PTDEELVVHYLKKKA+S PLPV IIAEVDLYKFDPWEL Sbjct: 1 MESTDSSSGSPQPQLPPGFRFYPTDEELVVHYLKKKASSAPLPVAIIAEVDLYKFDPWEL 60 Query: 61 PSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSIGNHKVGVKKAL 120 P+KA+FGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVL+S G KVGVKKAL Sbjct: 61 PAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQKVGVKKAL 120 Query: 121 VFYGGKPPKGTKTNWIMHEYRLVXXXXXXXXXXXXXXKP--SDAANKKPSLRLDDWVLCR 178 VFYGGKPPKG KTNWIMHEYRL KP D NKK SLRLDDWVLCR Sbjct: 121 VFYGGKPPKGIKTNWIMHEYRLA--------DNKVNTKPPGCDMGNKKNSLRLDDWVLCR 172 Query: 179 IYKKN 183 IY KN Sbjct: 173 IYXKN 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2839 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34890 427 e-122 >Vv34890 Length = 312 Score = 427 bits (1099), Expect = e-122, Method: Compositional matrix adjust. Identities = 214/300 (71%), Positives = 234/300 (78%), Gaps = 25/300 (8%) Query: 1 MAGRYDSNPFAEEEEVNPFS--------------------NPGIVAPAKNSRLSPLPPER 40 MA RYD NPF +EEEVNPFS NPG V PA NSRLSPLPPE Sbjct: 1 MARRYDPNPF-DEEEVNPFSDPAVRGKTSTNYGGGAFYTTNPGSVPPASNSRLSPLPPEP 59 Query: 41 AGFNYGLGDPVDIPIDGNA----DLKKRERELQAKEAXXXXXXXXXXXXXXXXXXXGIVL 96 AGFNY G +DIP+D DLKK+ERELQAKEA GIVL Sbjct: 60 AGFNYDGGATIDIPLDTAGSNFQDLKKKERELQAKEAELRKREQEVKRKEDAAARAGIVL 119 Query: 97 EEKNWPPFFPIIHHDIANEIPIHLQRVQYVAFTTWLGLVLCLFWNVIAVTTAWIKGEGVK 156 EEKNWPPFFPIIHHDIANEIPIHLQ++QYVAFTT+LGL CL WN+IA TTAWIKGEGVK Sbjct: 120 EEKNWPPFFPIIHHDIANEIPIHLQKLQYVAFTTFLGLACCLTWNIIATTTAWIKGEGVK 179 Query: 157 IWFLAVIYFISGAPGSYVLWYRPLYRVFRSESALKYGWFFLFYLIHIGFCIFAAVAPPIF 216 IWFLA+IYFI+G PG+YVLWYRPLYR FR+ESALK+GWFF+FYL+HI FCIFAAVAPP+ Sbjct: 180 IWFLAIIYFIAGVPGAYVLWYRPLYRAFRNESALKFGWFFMFYLLHIAFCIFAAVAPPVI 239 Query: 217 FKGKSLTGILPAIDVLGDHVLVGIFYFIGFGMFCLESVLSIWVIQQVYMYFRGSGKAAEM 276 F GKSLTGILPA+D++GDHVLVGIFYFIGFGMFC+ESVLSIWVIQQVYMYFRGSGKAAEM Sbjct: 240 FHGKSLTGILPAVDLIGDHVLVGIFYFIGFGMFCVESVLSIWVIQQVYMYFRGSGKAAEM 299 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28943 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27411 (252 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8066257 319 2e-89 >Vv8066257 Length = 262 Score = 319 bits (818), Expect = 2e-89, Method: Compositional matrix adjust. Identities = 159/246 (64%), Positives = 198/246 (80%), Gaps = 3/246 (1%) Query: 2 EIEREKHAYQAKLAEQAERYDEMIEEMKKVAKLDVELSVEE--RNLLSVGYKSVIGARRA 59 E RE++ Y AKLAEQAERY+EM+E M+KVAK + RNLLSV YK+VIGARRA Sbjct: 5 ESSREENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEERNLLSVAYKNVIGARRA 64 Query: 60 SWRILSSIEQKEEAKGGEQNVKRIKEYRQRVEDELAKICHDILTVVDYHLLPSSSTGEST 119 SWRI+SSIEQKEE++G E +V IK+YR +E EL+KIC IL++++ HL+PS+ ES Sbjct: 65 SWRIISSIEQKEESRGNEDHVAIIKDYRATIEAELSKICDGILSLLESHLIPSAVIAESK 124 Query: 120 VFYHKMKGDYYRYLAEFKSGDDRKQAADHSLKAYLTAVDTAASELPPTHPIRLGLALNFS 179 VFY KMKGDY+RYLAEFK+G RK+AA+ +L AY +A D A +EL PTHPIRLGLALNFS Sbjct: 125 VFYLKMKGDYHRYLAEFKTGPGRKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFS 184 Query: 180 VFYYEILNSPERACHLAKKAFDETFAELDSIDQESSKDSTLIMQLLKDNLTLWTSDLP-E 238 VFYYEILNSP+RAC+LAK+AFDE +ELD++ +ES KDSTLIMQLL+DNLTLWTSD+ + Sbjct: 185 VFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDD 244 Query: 239 GGEKLK 244 G+ +K Sbjct: 245 AGDDIK 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800151 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4966261 184 7e-49 >Vv4966261 Length = 340 Score = 184 bits (467), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 82/118 (69%), Positives = 105/118 (88%) Query: 22 SPRIKLADGRHLAYRESGVPKSKANYKIIMVHGFGSSKEMSFLAPQELIDELGIYFLLYD 81 SPR++L+DGRHLAYRE+GV K +A YKII++HGF SSK+++ A QELI+ELGIYFL +D Sbjct: 39 SPRVRLSDGRHLAYRETGVSKEEAKYKIIVIHGFDSSKDLNLPASQELIEELGIYFLFFD 98 Query: 82 RAGYGESDPNPKRSVKSEALDIEQLADQLELGSKFYVIGVSMGSYSTWSCIKHIPHRI 139 RAGYG+SDPNPKRSVKSEA DI++LAD+L++GSKFYV GVSMG+Y W C+K+IP+R+ Sbjct: 99 RAGYGDSDPNPKRSVKSEAFDIQELADKLQIGSKFYVFGVSMGAYPIWGCLKYIPNRL 156 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3273 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv50341 89 3e-20 >Vv50341 Length = 194 Score = 88.6 bits (218), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 44/87 (50%), Positives = 59/87 (67%) Query: 1 MLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVI 60 +LELLTGR PLD+ R E LV WA P+L + L +MVDPAL G Y K L + A + Sbjct: 89 LLELLTGRVPLDTKRPPGEDVLVSWALPRLTNRQKLVEMVDPALQGHYSKKDLIQIAAIA 148 Query: 61 ALCVQPEPEFRPPMSEVVQALVRLVQR 87 A+CVQ E ++RP M++VVQ+L+ LV+ Sbjct: 149 AVCVQHEADYRPLMTDVVQSLIPLVKN 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226787059 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19027 152 3e-39 >Vv19027 Length = 124 Score = 152 bits (383), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 78/109 (71%), Positives = 83/109 (76%), Gaps = 12/109 (11%) Query: 1 MDTNKWRPSQVGEAAMDAGDWRSQLQADSRQRIVNNLMDTLKRHFPFSGQDGLQELSKIA 60 MDTN WRP+Q E AMD GDWR+QL DSRQ VN +MDTLKRH P SGQ+GL EL KIA Sbjct: 1 MDTNNWRPAQA-EQAMDLGDWRTQLSPDSRQGTVNRIMDTLKRHLPVSGQEGLHELRKIA 59 Query: 61 VRFEEKIYTAATSQSDYLRKISLKMLTLETKSQNSMGNPLQSNSAGNSK 109 VRFEEKIYTAATSQSDYL KISLKMLT+ETK NSAGNSK Sbjct: 60 VRFEEKIYTAATSQSDYLHKISLKMLTMETK-----------NSAGNSK 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26793 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16520 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13319 (281 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig495 (44 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12748 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11602 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21039 85 2e-18 >Vv21039 Length = 120 Score = 84.7 bits (208), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 68/131 (51%), Positives = 78/131 (59%), Gaps = 21/131 (16%) Query: 176 LESEALL-RTNLQSQV---PAEMHKYGQFTSRRPTAEDIQMXXXXXXXXXXXXXXXIQFP 231 +E+ LL T+LQS P EM++YGQF RR A + QM IQFP Sbjct: 1 METMQLLSHTHLQSPAALKPGEMYRYGQF--RR--AGETQMLHILPPQLSSPNYQ-IQFP 55 Query: 232 SSSEGGGRI---GSDLSLSMSDHHQQWQSATPTSDLFATAAASSGFPPQ-IKPSYTQNGW 287 SSS GG RI G DLSL+ +HQQWQS P LFATAAASSGFPPQ I+P+ W Sbjct: 56 SSSNGG-RIAVNGGDLSLA--TNHQQWQSGPP--QLFATAAASSGFPPQMIRPN---QQW 107 Query: 288 LQKNGFHSLTR 298 QKNGFHSL R Sbjct: 108 PQKNGFHSLIR 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27013 (213 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824050 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25288 (324 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23194 258 7e-71 >Vv23194 Length = 375 Score = 258 bits (660), Expect = 7e-71, Method: Compositional matrix adjust. Identities = 149/283 (52%), Positives = 179/283 (63%), Gaps = 47/283 (16%) Query: 1 MASFDAFSMDGDDLHAPNSHFDQDDVVVE-----------SYADY--------------G 35 M++FDA+S DG+D+ A ++ DD VE SYA + G Sbjct: 1 MSAFDAYSNDGEDVRASSNRPFDDDTFVEYDPSLPSRRFDSYASFATADDYAADDAPPAG 60 Query: 36 SY-------TDHGA----AAPASPDVFGFE------DPSPNYSHSTPFDSVPVENGNGNG 78 + DH + P ++GFE DP+PN+S + F SVP+ NGNG Sbjct: 61 GFPVEDEVTVDHVSHNVDGVHPLPGMYGFEGSSMADDPNPNFSEDS-F-SVPIANGNGKP 118 Query: 79 YGVDENGIDDGVFTSDGPVLPEPSEFV-EEGSALREWRRQNAIXXXXXXXXXXXXXNQII 137 Y + + D +F+SDGPVLP P+E EEG LREWRRQNAI NQII Sbjct: 119 YDISADNED--IFSSDGPVLPPPTEMQPEEGFILREWRRQNAIQLEEKEKREKEMRNQII 176 Query: 138 EEAEEFKRAFYEKRKLNVETNKVENREKEKLFLVNQENFHKNADKQSWKAIAELIPHEVP 197 EEAEE+KRAFYEKRK+N+ETNK NRE+EKL+L NQE FHK ADKQ WKAIAELIPHEVP Sbjct: 177 EEAEEYKRAFYEKRKVNIETNKTNNREREKLYLANQEKFHKEADKQYWKAIAELIPHEVP 236 Query: 198 NIEKRRGKKDQEKKPGIQVIQGPKPGKPTDLSRLRQVLVKLKH 240 NIEK+RGKKD +KKP I VIQGPKPGKPTDLSR+R +LVKLKH Sbjct: 237 NIEKKRGKKDPDKKPSITVIQGPKPGKPTDLSRMRHILVKLKH 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28895 (337 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6390 (230 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15978 64 3e-12 >Vv15978 Length = 274 Score = 63.9 bits (154), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/103 (35%), Positives = 61/103 (59%), Gaps = 2/103 (1%) Query: 16 QVMARSSPLDKHTLVQHLRTTFDEVVAVTGDGTNDAPALHEADIGLAMGIAGTEVAKESA 75 +V A + PL K +++L+ VA+ GDG ND+PAL AD+G+A+G AGT+VA E+A Sbjct: 116 EVYAETDPLGKAERIKNLQMK-GMTVAMVGDGINDSPALVAADVGMAIG-AGTDVAIEAA 173 Query: 76 DVIILDDNFSTIVTVAKWGRSVYINIQKFVQFQLTVNIVALIV 118 D++++ N ++T R I+ + L N++A+ V Sbjct: 174 DIVLIKSNLEDVITALDLSRKTMSRIRLNYVWALGYNVLAMPV 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9090 (102 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32643 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26167 (236 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815213 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14342 (372 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16354 646 0.0 >Vv16354 Length = 432 Score = 646 bits (1666), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/372 (82%), Positives = 322/372 (86%) Query: 1 MVDMSIRNSTERRKLGYFSCGTGNPVDDCWRCDPNWHKNRKRLADCGIGFGRNAIGGRDG 60 MVDMSIRNSTERRKLGYFSCGTGNP+DDCWRCD NW KNRKRLADCGIGFGRNAIGGRDG Sbjct: 61 MVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLADCGIGFGRNAIGGRDG 120 Query: 61 RFYXXXXXXXXXXXXXRAGTLRHAVIQSEPLWIVFKRDMVIQLKQELIMNSFKTIDGRGV 120 RFY + GTLRHAVIQ PLWIVFKRDMVI LKQELIMNSFKTIDGRGV Sbjct: 121 RFYVVTDPGDDDPVNPKPGTLRHAVIQDAPLWIVFKRDMVITLKQELIMNSFKTIDGRGV 180 Query: 121 NVHIANGGCITIQYVTNIIIHGLHIHDCKPTGNALVRSSPTHFGWRTMADGDAVSIFGSS 180 NVHIANG CIT+Q+VTN+IIHGLHIHDCKPTGNA+VRSSP+HFGWRTMADGDA+SIFGSS Sbjct: 181 NVHIANGACITVQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAISIFGSS 240 Query: 181 HIWVDHNSLSNCADGLVDAVMGSTAITISNNHMTHHNEVMLLGHSDSYTRDKQMQVTIAY 240 HIWVDHNSLS+CADGLVDAVMGSTAITISNNH HHNEVMLLGHSDSY RDKQMQVTIAY Sbjct: 241 HIWVDHNSLSSCADGLVDAVMGSTAITISNNHFAHHNEVMLLGHSDSYERDKQMQVTIAY 300 Query: 241 NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSGNPTINSQGNRYAAPTNPFAKEV 300 NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGS +PTINSQGNRY AP NPFAKEV Sbjct: 301 NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAPVNPFAKEV 360 Query: 301 TKRVETATTEWKNWNWRSEGDLLLNGAYFTPXXXXXXXXXXXXXXXXXKSSAMVGSITSG 360 TKRV+T + +WK WNWRSEGDLLLNGAYFTP KSS+MVGSITS Sbjct: 361 TKRVDTPSGQWKGWNWRSEGDLLLNGAYFTPSGAGASASYARASSLGAKSSSMVGSITSN 420 Query: 361 SGALPCRRGHPC 372 +GAL CRRG C Sbjct: 421 AGALSCRRGSQC 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780398 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32495 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4062 (281 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9914 (643 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4630 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25232 (273 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv64741 285 7e-79 >Vv64741 Length = 200 Score = 285 bits (728), Expect = 7e-79, Method: Compositional matrix adjust. Identities = 135/200 (67%), Positives = 160/200 (80%), Gaps = 1/200 (0%) Query: 74 MATAGNKNINAKLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVK 133 MA GNKNI AKLVLLGD+G GK+SLVLRFVKGQF +FQESTIGAAFF+Q L++N+AT+K Sbjct: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVKGQFYDFQESTIGAAFFTQVLSLNEATIK 60 Query: 134 FEIWDTAGQERYHSLAPMYYRGAAAAIIVYDLTNQASFERAKKWVLELKSQGNPNMVMAL 193 F+IWDTAGQERYHSLAPMYYRGAAAA++VYD+T+ SFERAKKWV EL+ QGNPN++M L Sbjct: 61 FDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLLMIL 120 Query: 194 AGNKADLVEARKVAAEDAQSYAQENGLFFLETSAKTADNVNDIFYEIAKRLPRVQPVQNP 253 NKADL R+V E + YA+ENGL F ETSAKTA NVN++FYEIAK+L + P + P Sbjct: 121 VANKADLETKREVENEKGEQYAKENGLLFFETSAKTAQNVNELFYEIAKKLAKACPSR-P 179 Query: 254 AGMVLVDRPSERVASSSCCS 273 G+ L R ER CCS Sbjct: 180 GGIKLHRRSQERGRRLFCCS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9192 (243 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56279 247 2e-67 >Vv56279 Length = 244 Score = 247 bits (630), Expect = 2e-67, Method: Compositional matrix adjust. Identities = 136/241 (56%), Positives = 155/241 (64%), Gaps = 3/241 (1%) Query: 1 MQSDQQFDPNKAAPPFSNQVGNNYMH-IPVASGCGAVLPNDANHFRPFHGVEFQTSSICP 59 MQ DQQF P K P +N+VGN+YM+ PV S GAV P A PFHGVEFQ S +CP Sbjct: 1 MQRDQQFCPEKVMLPLANEVGNDYMYNTPVESAFGAVFPPGAKDLGPFHGVEFQPSDVCP 60 Query: 60 KNFIIFDQTDHRSQIMFNPEISHKITGPAFNLCAAYIQDNLGLNKGNIDNREASSTLKXX 119 KNFIIFDQTDHRSQIMF+P I+ K P+ NLCA YI +NL + NID EASS LK Sbjct: 61 KNFIIFDQTDHRSQIMFHPAIAQKFNCPSLNLCATYIHNNLEKREINIDEGEASSALKED 120 Query: 120 XXXXXXXXXXXXXXXXXXXXXXVSTARTRGNYGXXXXXXXXXYGLKTKKERLCSSLEKST 179 VSTART GNYG YG K +K + S Sbjct: 121 SEDIDALLSLEEEDQEEYDEEEVSTARTHGNYGSNCEDTCSSYGSKPRKIK--LSSSILK 178 Query: 180 AIGSSSSCNSERKRQKMKKMVRTLRGIVPGANEMNTVAVLDEAVQYLKSLKVELQKLGVE 239 + S SSCNSERKRQKMKKMV+ LRGIVPG+++MNTVAVLDEAV+YLKSLKVE+QKLGV Sbjct: 179 SSSSGSSCNSERKRQKMKKMVKALRGIVPGSSQMNTVAVLDEAVRYLKSLKVEVQKLGVS 238 Query: 240 N 240 N Sbjct: 239 N 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54681722 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2794 90 1e-20 >Vv2794 Length = 297 Score = 89.7 bits (221), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 47/110 (42%), Positives = 68/110 (61%), Gaps = 13/110 (11%) Query: 1 MGGFWTLWEADDWVTRGGLGKINWSKAPFFSYYKDFDIEGCS-VPGPASCASST------ 53 M + +LW ADDW TRGGL K +W++APF + Y++F+ + C G +SC+S+T Sbjct: 188 MRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWFFGASSCSSNTPTSISP 247 Query: 54 -NNWWEGASYQALSALDYRRYRWVRINHMIYDYCTDRSRYPVA-PPECTA 101 +W+ Q L + R +WV+ N+MIY+YCTD R+P PPECTA Sbjct: 248 CTDWYS----QELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECTA 293 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3874 (240 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1749 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53094 168 2e-44 >Vv53094 Length = 331 Score = 168 bits (425), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 76/95 (80%), Positives = 87/95 (91%) Query: 1 MCPKNVDPDIAIDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAKNN 60 MCPKNVDP IAIDMDPTTP+KFDNVY+QNL +GKGLFTSD+VL+TDSRS+PTV TWA ++ Sbjct: 237 MCPKNVDPRIAIDMDPTTPKKFDNVYYQNLQQGKGLFTSDEVLFTDSRSKPTVNTWASSS 296 Query: 61 AAFNQAFITAMTKLGRVGMKTGKNGNIRRDCSVFN 95 AF AF+ A+TKLGRVG+KTGKNGNIRRDCSVFN Sbjct: 297 TAFQTAFVQAITKLGRVGVKTGKNGNIRRDCSVFN 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7893 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17966265 243 1e-66 >Vv17966265 Length = 389 Score = 243 bits (619), Expect = 1e-66, Method: Compositional matrix adjust. Identities = 109/122 (89%), Positives = 118/122 (96%) Query: 1 MQENLKRELFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGIFEAASFGGTNFDPSAWED 60 MQENLKR+LFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHG+FEAASFGGTN DP+AWED Sbjct: 268 MQENLKRQLFGLPPRYRDSVRAITPGLPLFLYNYSTHQLHGVFEAASFGGTNIDPTAWED 327 Query: 61 KKCPGESRFPAQVRVFTRKVCEPLEEDSFRPILHHYDGPKFRLELSVPEALSLLDIFADQ 120 KKCPGESRFPAQVRV TRK+CEP+EEDSFRP+LHHYDGPKFRLEL+VPEALSLLDIF ++ Sbjct: 328 KKCPGESRFPAQVRVVTRKICEPMEEDSFRPVLHHYDGPKFRLELNVPEALSLLDIFNEK 387 Query: 121 NP 122 P Sbjct: 388 TP 389 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10742 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29083 (358 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239951 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21497 (261 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8066257 347 2e-97 >Vv8066257 Length = 262 Score = 347 bits (889), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 173/254 (68%), Positives = 202/254 (79%), Gaps = 4/254 (1%) Query: 7 RENYVYTAKLAEQAERYDEMVEAMTKVAKLDVELTVEE--RNLLSVGYKNVIGARRASWR 64 RE VY AKLAEQAERY+EMVE M KVAK + RNLLSV YKNVIGARRASWR Sbjct: 8 REENVYMAKLAEQAERYEEMVEFMEKVAKTVEVEELTVEERNLLSVAYKNVIGARRASWR 67 Query: 65 ILSSIEQKEEGKGNDQNVSRIKEYRQKVESELSSICSDIMRVIDEHLIPSCTAFESTVFF 124 I+SSIEQKEE +GN+ +V+ IK+YR +E+ELS IC I+ +++ HLIPS ES VF+ Sbjct: 68 IISSIEQKEESRGNEDHVAIIKDYRATIEAELSKICDGILSLLESHLIPSAVIAESKVFY 127 Query: 125 YKMKGDYYRYLAEFKTGDDRKEVADQSMKAYQAASSKAETDLPPTHPIRLGLALNFSVFY 184 KMKGDY+RYLAEFKTG RKE A+ ++ AY++A A +L PTHPIRLGLALNFSVFY Sbjct: 128 LKMKGDYHRYLAEFKTGPGRKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFY 187 Query: 185 YEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGGE 244 YEILNSP+RAC+LAKQAFDEAISELDTL EESYKDSTLIMQLLRDNLTLWTSDI +D G+ Sbjct: 188 YEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDITDDAGD 247 Query: 245 DIQKVDGSAKPGGE 258 DI+ + S + GE Sbjct: 248 DIK--EASKRESGE 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18341 (266 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13283 143 2e-36 >Vv13283 Length = 420 Score = 143 bits (361), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 73/87 (83%), Positives = 76/87 (87%), Gaps = 2/87 (2%) Query: 1 MDRTVNLPKGFGYVEFKIRADAEKAQLYMDGAQIDGNVVRAKFTLPQRQKVSSPPKPVAT 60 MDRTVNLPKG+GYVEFK R+DAEKAQLYMDGAQIDGNVVRAKFTLPQRQK+SSPPK VAT Sbjct: 135 MDRTVNLPKGYGYVEFKTRSDAEKAQLYMDGAQIDGNVVRAKFTLPQRQKISSPPKAVAT 194 Query: 61 APKRDTVKTDGVSAD--KDAPKRPREA 85 A KRD KTD V AD KD PKR REA Sbjct: 195 ASKRDGPKTDNVGADVEKDGPKRQREA 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11362 (397 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25473 (444 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11952 (360 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6266261 640 0.0 >Vv6266261 Length = 425 Score = 640 bits (1650), Expect = 0.0, Method: Compositional matrix adjust. Identities = 308/362 (85%), Positives = 327/362 (90%), Gaps = 2/362 (0%) Query: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSHGSVHEVHDQPSVIQNSRWASLPPEL 60 MSFRSIVRDVRDGFGSLSRRSF+VRLPGHHRGKSHGSVHE+ DQP V+QNSRWA LPPEL Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSHGSVHELQDQPLVVQNSRWAGLPPEL 60 Query: 61 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVRSPEFCGKITFPVALKQPGSR 120 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIV+SPEF GK+TFP++LKQPG R Sbjct: 61 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVKSPEFSGKLTFPISLKQPGPR 120 Query: 121 DGTIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRTRRTTCTEYVISTDADNISR 180 DG IQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKR RRTTCTEYVIS DADNISR Sbjct: 121 DGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRNRRTTCTEYVISMDADNISR 180 Query: 181 SSNKYIGKLRSNFLGTKFIIYDTQPPYNSAQLSPPGR-SRRFYSKKVSPKLPTGSYNIAQ 239 SS+ YIGKLRSNFLGTKFIIYDTQPPYN +QLSPPGR SRRFYSKKVSPK+PTGSYNIAQ Sbjct: 181 SSSTYIGKLRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQ 240 Query: 240 VSYELNVLGTRGPRRMHCTMHSIPAASLEPGGIVPGQPEILQRSLEDSFRXXXXXXXXXX 299 V+YELNVLGTRGPRRMHCTMHSIPA+SLEPGG VPGQ E+L R+LEDSFR Sbjct: 241 VTYELNVLGTRGPRRMHCTMHSIPASSLEPGGTVPGQAELLPRNLEDSFRSISFSKSIDN 300 Query: 300 XXXXXXARFSDIVGAHCEED-GRERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQ 358 +RFSDI+G EED G++RPL+LRNK PRWHEQLQCWCLNFRGRVTVASVKNFQ Sbjct: 301 STEFSSSRFSDIIGPRDEEDEGKDRPLVLRNKPPRWHEQLQCWCLNFRGRVTVASVKNFQ 360 Query: 359 LI 360 LI Sbjct: 361 LI 362 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23011 (243 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34312 226 2e-61 >Vv34312 Length = 195 Score = 226 bits (577), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 108/177 (61%), Positives = 141/177 (79%), Gaps = 2/177 (1%) Query: 43 DVVPFVKWLDDELSYLVDERAVLKHF-EWPEQKADALREAAFGYCDLKKLESEASSFPDH 101 DV FVKWLD+ELSYLVDERAVLKHF +WPE+KADALREAAF Y DLK LE+E SSF D+ Sbjct: 1 DVEAFVKWLDEELSYLVDERAVLKHFPKWPERKADALREAAFSYRDLKNLEAEVSSFEDN 60 Query: 102 SRQPCGPTLKKMQALLEKLEHGVYNLSRMRDSATKRYKVFQIPTNWMLDSEFVSQIKLAS 161 ++QP +L+++QAL +++E V N+ +MRD A+KRYK FQIP WML++ + QIK++S Sbjct: 61 TKQPLTQSLRRIQALQDRVERSVANMEKMRDGASKRYKEFQIPWEWMLNTGLIGQIKISS 120 Query: 162 VKLAMKYMKRVSAELEIVGGVPEEEELIVQGVRFAFRVHQFAGGFDAETMRAFQVLR 218 KLA KYMKR+ E++ + +E+ L++QGVRFAFRVHQFAGGFD +TM AF+ L+ Sbjct: 121 TKLAKKYMKRIIKEMQSI-ECSQEDNLMLQGVRFAFRVHQFAGGFDVDTMHAFEELK 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6792 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15251 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15181 71 1e-14 >Vv15181 Length = 239 Score = 71.2 bits (173), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 29/58 (50%), Positives = 43/58 (74%) Query: 138 ETVPLPLDASSTLYVEGLPPDSTRREVAHIFRPFVGYKAVRLVSKESKHRGGDPLIPC 195 E++P P+ S+ L+V+GLP D TRREV H+FRPF+G+K +R+V KE +H G ++ C Sbjct: 129 ESLPPPVQESNILFVDGLPKDCTRREVGHLFRPFIGFKEIRVVHKEPRHSGDKAMVLC 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5349 (177 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60213 285 4e-79 >Vv60213 Length = 232 Score = 285 bits (729), Expect = 4e-79, Method: Compositional matrix adjust. Identities = 136/177 (76%), Positives = 152/177 (85%) Query: 1 MKETGLRKRARTGSNSVSGSKACREKMRRDRLNDRFAELSSILEPGRPPKTDKVAILGDA 60 +KE RKR R+G S SGSKACREK+RRDRLNDRF EL SILEPGRPPK DK IL DA Sbjct: 56 VKENHSRKRMRSGLCSASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILSDA 115 Query: 61 VRMVTQLRGEAQQLKESSANLQETINELKAEKNELRDEKQRLKAEKDNIERQIKALGTQP 120 +RM+TQLR E Q+LK+S +LQE INELKAEKNELRDEKQRLK EK+NI +QIKAL +Q Sbjct: 116 LRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSSQA 175 Query: 121 SFLPHPAAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA 177 FLPHP+AIP PF+APGQVVG K+MPF+GYPG+SMWQFMPPAAVDTSQDHVLRPPVA Sbjct: 176 GFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLRPPVA 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20536 (316 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23825 62 2e-11 >Vv23825 Length = 355 Score = 61.6 bits (148), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 28/36 (77%), Positives = 31/36 (86%) Query: 116 EFEEYDPTPYGGGFDIVQTYGKPLSPSLETCYPRSS 151 EF+EYDPTPYGGG+DI TYG+PL PS ETCYP SS Sbjct: 12 EFDEYDPTPYGGGYDITVTYGRPLEPSEETCYPISS 47 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30219 (231 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8592 (185 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8706 (404 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9954 (252 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3268 161 1e-41 >Vv3268 Length = 245 Score = 161 bits (407), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 120/267 (44%), Positives = 134/267 (50%), Gaps = 37/267 (13%) Query: 1 MAPREKTATAAVRMNGNGNVKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTXXXX 60 MAP+EK A + + N KEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDT Sbjct: 1 MAPKEKVAG----VKPSANAKEVHFRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEA 56 Query: 61 XXXXXXXXXXFRGAKAKTNFPQPSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRE 120 FRGAKAKTNFP SE Sbjct: 57 AKAYDSAAREFRGAKAKTNFPLVSENLNNNNQSPSQSSTVESSSREGFS----------- 105 Query: 121 PPALMVDSSPLDLNLAHGVSSGGFS------SAPMRFPFQHHQV----PGFGAVIGVPSS 170 PALMVDSSPLDLNL HG G + +RFPFQHHQ P A I VP+ Sbjct: 106 -PALMVDSSPLDLNLLHGGGVGVGVGAAAGYATALRFPFQHHQFQVSSPSPAAGI-VPTG 163 Query: 171 AAAAAKQVLYLDSVFRAGAMKNHQFHPRMRFDHPNFHQPDFHAA--GGAQXXXXXXXXXX 228 AA + Y D++ R G + N F R+RFD DF AA GG Q Sbjct: 164 GLPAANHLFYFDAMLRTGRV-NQDFQ-RLRFDRA---ASDFRAALTGGVQSDSDSSSVVD 218 Query: 229 LNQNDL-PRGGGGFDLNL--PPPPDLA 252 LN NDL PR DL+L PPPP++A Sbjct: 219 LNHNDLKPRARVLIDLDLNRPPPPEIA 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51564940 (67 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17453 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752406 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23749 219 2e-59 >Vv23749 Length = 237 Score = 219 bits (557), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 107/136 (78%), Positives = 116/136 (85%), Gaps = 3/136 (2%) Query: 1 MRPKIYLFGDSITEESFGDGGWGASLAHHFSRTVDVVLRGYSGYNTRWPLKVLERVFXXX 60 MRP+IYLFGDSITE SF DGGWGASLAHHFSRTVDVVLRGYSGYNTRW L+V+E+VF Sbjct: 1 MRPEIYLFGDSITEASFCDGGWGASLAHHFSRTVDVVLRGYSGYNTRWALEVIEKVFPVV 60 Query: 61 XXXXXXXXXXLAVTIFFGANDACLPDRCSAFQHVPLDEYKQNLLSIVSFLKKRWPSTHIL 120 LAVT+FFGANDACLPDRCSAFQHVP+ EYKQNL SIVSFLKKRWP+T +L Sbjct: 61 SRGGGAP---LAVTVFFGANDACLPDRCSAFQHVPIHEYKQNLHSIVSFLKKRWPTTLVL 117 Query: 121 LITPPPIDEDGRLRFP 136 LITPPPIDE+GRLR P Sbjct: 118 LITPPPIDEEGRLRNP 133 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8189 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33541 176 2e-46 >Vv33541 Length = 252 Score = 176 bits (446), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 2/138 (1%) Query: 1 MDRLTAYYKGLSTWARWVDSNVDTSRTKVFFQGISPTHYQGKEW-NSPKKTCSGELGPLS 59 M+RL A+ +GL+TW++WV+SN++ + T+VFFQGISPTHY G EW S TC+G+ PLS Sbjct: 114 MNRLVAFKEGLTTWSKWVESNINPAVTRVFFQGISPTHYNGDEWKQSGSTTCNGQTQPLS 173 Query: 60 GSTYPAGAPPSVAVVYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGD-HSGNDCSHWC 118 GS YP G P ++ +VLS + PV LLDITTLSQLRKD HPS Y + +DCSHWC Sbjct: 174 GSMYPGGMPSEAKILKEVLSKMSKPVQLLDITTLSQLRKDGHPSYYGNNGRKEDDCSHWC 233 Query: 119 LPGLPDTWNQLLYAALIM 136 L G+PDTWN+LLYA+LIM Sbjct: 234 LAGVPDTWNELLYASLIM 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28412 (361 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4036 62 2e-11 >Vv4036 Length = 296 Score = 61.6 bits (148), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Query: 231 PAVRLNKELDFILTYKLKGEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNIT-GKI 289 PA IL KL+ E IR+SGI YTI+RP L +P +++ + D ++ G I Sbjct: 191 PAYIFLNAFGLILIAKLQAEQYIRKSGINYTIIRPGGLRNDPPTGNIVMEPEDTLSEGTI 250 Query: 290 SREEVAQICVAALESPYATGKTFEVKS 316 SR+ VA++ V AL P A+ K E+ S Sbjct: 251 SRDHVAEVAVEALVHPEASYKVVEIVS 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51241402 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4366264 74 5e-16 >Vv4366264 Length = 166 Score = 73.9 bits (180), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 31/75 (41%), Positives = 55/75 (73%) Query: 2 PKKPPTAFFYFLEDYRKELQEQNPGIKQMREIGKVCGEKWKTMTYEEKVQYYDIATEKRA 61 PK+PP+AFF FLE++RK ++++P +K + +GK GEKWK+++ +K Y A ++++ Sbjct: 56 PKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPYEAKAAKRKS 115 Query: 62 EFEKAMAEYAQRKES 76 ++EK MA Y +++ES Sbjct: 116 DYEKLMAAYNKKQES 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21695 (895 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49875 84 2e-17 >Vv49875 Length = 448 Score = 83.6 bits (205), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 42/90 (46%), Positives = 59/90 (65%), Gaps = 2/90 (2%) Query: 762 RNFVKVYKSG-SFGRSLDITKFSSYQELRNELAHMFGLEGELDDPVRSGWQLVFVDREND 820 R+ KV+K G + GRS+D+TKF++Y EL EL +F GEL P + W +V+ D E D Sbjct: 322 RSCTKVHKQGIALGRSVDLTKFNNYDELIAELDQLFEFGGELMAP-KKNWLIVYTDDEGD 380 Query: 821 VLLLGDDPWPEFVNSVWCIKILSPQEVQQM 850 ++L+GDDPW EF V I I + +EVQ+M Sbjct: 381 MMLVGDDPWQEFCGMVRKIYIYTREEVQRM 410 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25190 (328 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56446 357 e-100 >Vv56446 Length = 240 Score = 357 bits (917), Expect = e-100, Method: Compositional matrix adjust. Identities = 165/222 (74%), Positives = 191/222 (86%) Query: 90 EFWREAEILSKLHHPNVVAFYGVVQNGPGGTLATVAEFMVNGSLRHVLLSKERHLDRRKR 149 +FW EA L+ LHHPNVVAFYGVV +GPGG++ATV E+MVNGSLR+ L E++LD+RKR Sbjct: 4 DFWNEAIKLADLHHPNVVAFYGVVLDGPGGSVATVTEYMVNGSLRNSLQKNEKNLDKRKR 63 Query: 150 LIIAMDAAFGMEYLHSKNIVHFDLKCDNLLVNLKDPQRPICKVADFGLSKIKRNTLVTGG 209 L+IAMD AFGMEYLH KNIVHFDLK DNLLVNL+DP RPICKV D GLSK+K L++GG Sbjct: 64 LLIAMDVAFGMEYLHGKNIVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQPLISGG 123 Query: 210 VRGTLPWMAPELLNGGSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTL 269 VRGTLPWMAPELLNG SS VSEKVDVFSFGIV+WE+LTGEEPYA++HYGAIIGGIV+NTL Sbjct: 124 VRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVSNTL 183 Query: 270 RPHVPPFCDSEWKLLMEQCWAADPVVRPSFTEITKRLRVMTA 311 RP VP FCD EW+ LME+CW+++P RPSFTEI +LR M A Sbjct: 184 RPSVPEFCDPEWRALMERCWSSEPSERPSFTEIANQLRSMAA 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417954 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765933 (139 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13466 (361 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 229 5e-62 >Vv31003 Length = 427 Score = 229 bits (585), Expect = 5e-62, Method: Compositional matrix adjust. Identities = 136/337 (40%), Positives = 194/337 (57%), Gaps = 18/337 (5%) Query: 12 EESYPSNENERLKSPNHYGDGNQKGSKVSAPVKSEVQKAAPPIEVPQLSVEELKEKTDNF 71 +E PS + ++ S N D N K P K++ + + +L TDNF Sbjct: 61 KEVNPSLDVKKEVSGNGLPDKNGSPDKNGLPDKNQAR---------TFTFHQLAVATDNF 111 Query: 72 GSKSLIGEGSYGRVYYASL-NDGKAVAVKKLDVASEPETNVEFLTQVSMVSRLKHENLVE 130 S +GEG +G+V+ L N + VA+K+LD + + EF +V +S + H NLV+ Sbjct: 112 RSDCFLGEGGFGKVFKGYLDNPSQVVAIKQLD-RNGLQGIREFFVEVLTLSSVDHPNLVK 170 Query: 131 LLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVRIAVEAARGLEY 190 L+GYC +G+ R+L YE+ +GSL + LH G +P LDW R++IA AA+GLEY Sbjct: 171 LIGYCAEGDQRLLVYEYMPLGSLENHLHDLP--PGTKP---LDWNSRMKIAAGAAKGLEY 225 Query: 191 LHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPE 250 LH+K+ P +I+RD++ SN+LL E + K++DF L+ P STRV+GT+GY AP+ Sbjct: 226 LHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGDKTHVSTRVMGTYGYCAPD 285 Query: 251 YAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSE-DKVKQCVD 309 YAMTGQLT KSD+YSF VVLLEL+TGRK +D++ +Q+LV WA P + K Q D Sbjct: 286 YAMTGQLTFKSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAWARPLFKDRRKFSQMAD 345 Query: 310 PKLK-DYPXXXXXXXXXXXXXCVQYESEFRPNMSIVV 345 P L YP CVQ + RP ++ VV Sbjct: 346 PLLHGQYPVRGLYQALAIAAMCVQEQPNMRPLIADVV 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5790 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23428 208 4e-56 >Vv23428 Length = 185 Score = 208 bits (530), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 99/117 (84%), Positives = 108/117 (92%), Gaps = 1/117 (0%) Query: 64 EGYVEAADDDDLSRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK 123 EGYVE AD+DDL RTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK Sbjct: 70 EGYVETADEDDLMRTKSLTDEDLDELKGCLDLGFGFSYEEIPELCNTLPALELCYSMSQK 129 Query: 124 FMDEHQKSPENSPAAVDSVSTQIANWKISSPGDHPEDVKERLKYWAQAVACTVKLCN 180 FMD+ QK+PE+SPAA +S IANWKISSPGDHPE+VK RLK+WAQAVACTV+LC+ Sbjct: 130 FMDDQQKAPESSPAASESPGP-IANWKISSPGDHPEEVKARLKFWAQAVACTVRLCS 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15232 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 112 1e-26 >Vv31003 Length = 427 Score = 112 bits (279), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/230 (32%), Positives = 115/230 (50%), Gaps = 21/230 (9%) Query: 57 VLSRVNHKNFVNLIGYCEEDEPFTRMMVFEYAPNGNLFEHLH--IEEMEHLDWNSRIRIV 114 LS V+H N V LIGYC E + R++V+EY P G+L HLH + LDWNSR++I Sbjct: 159 TLSSVDHPNLVKLIGYCAEGD--QRLLVYEYMPLGSLENHLHDLPPGTKPLDWNSRMKIA 216 Query: 115 MGTAYCLQYMHHELNPPVSHPNLTSASIFLTDDYAAKIAEICFWAE---------SIRKP 165 G A L+Y+H ++ PPV + +L ++I L + Y K+++ S R Sbjct: 217 AGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGDKTHVSTRVM 276 Query: 166 KNSGDDDKEHSVLPPLADPETNVYSFGVMLLEIITGKLQNSEEHGS----LLYWASAYLN 221 G ++++ L ++++YSF V+LLE+ITG+ G+ L+ WA Sbjct: 277 GTYGYCAPDYAMTGQLTF-KSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAWARPLFK 335 Query: 222 ENR--SDMVDPTLKS-FKNEELDVLCEVIKDCIQQDPRQRPTMKDVTNKL 268 + R S M DP L + L + C+Q+ P RP + DV L Sbjct: 336 DRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQPNMRPLIADVVTAL 385 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13680 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29208 (288 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35266258 375 e-106 >Vv35266258 Length = 339 Score = 375 bits (963), Expect = e-106, Method: Compositional matrix adjust. Identities = 184/287 (64%), Positives = 220/287 (76%), Gaps = 1/287 (0%) Query: 1 DSTHGIFDGS-ISVVDNSTLEINGKEIKVVSKRDPAEIPWGDYGVEYVVESSGIFTTLEX 59 DS HG + + V D+ TL K + V R+P EIPW + G +YVVES+G+FT + Sbjct: 53 DSVHGHWKHHDVKVKDSKTLLFGEKSVTVFGVRNPEEIPWAETGADYVVESTGVFTDKDK 112 Query: 60 XXXXXXXXXXXVVISAPSADAPMFVVGVNENTYKPNMDIVSNASCTTNCLAPLAKVIHEE 119 V+ISAPS DAPMFV+GVNE YKP++DIVSNASCTTNCLAPLAKVI++ Sbjct: 113 AAAHLKGGAKKVIISAPSKDAPMFVMGVNEKEYKPDIDIVSNASCTTNCLAPLAKVINDR 172 Query: 120 FGILEGLMXXXXXXXXXXXXXDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGK 179 FGI+EGLM DGPS KDWRGGR A NIIPSSTGAAKAVGKVLP LNGK Sbjct: 173 FGIVEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGK 232 Query: 180 LTGMAFRVPTPNVSVVDLTCRLEKSSSYEDVKATIRYAADGPLRGILGYTEEDVVSNDFV 239 LTGM+FRVPT +VSVVDLT RLEKS++Y++VKA I+ ++G L+GILGYTE+DVVS DF+ Sbjct: 233 LTGMSFRVPTVDVSVVDLTVRLEKSATYDEVKAAIKEESEGKLKGILGYTEDDVVSTDFI 292 Query: 240 GDSRSSIFDAKAGLALSSSFVKLVSWYDNEWGYSTRVLDLIEHMALV 286 GDSRSSIFDAKAG+AL+++F+KLVSWYDNEWGYS+RV+DLI HMA V Sbjct: 293 GDSRSSIFDAKAGIALNANFLKLVSWYDNEWGYSSRVIDLIRHMASV 339 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4719 (423 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 439 e-125 >Vv47659 Length = 393 Score = 439 bits (1129), Expect = e-125, Method: Compositional matrix adjust. Identities = 211/361 (58%), Positives = 269/361 (74%), Gaps = 6/361 (1%) Query: 68 QKQKYAYIPDNFTSLQQVTDALRKEGLESSNLIVGIDFTKSNEWTGKVSFRNRSLHAIGD 127 + + YI DNF SL QVTDALR+ GLESSNLI+GIDFTKSNEWTG+ SF +SLHAI + Sbjct: 33 HRGQLPYIADNFNSLDQVTDALRESGLESSNLILGIDFTKSNEWTGRHSFHRKSLHAISN 92 Query: 128 EPNPYEKAISIIGKTLSPFDEDNLIPCFGFGDATTHDQEVFSFHNDHSPCHGFEEVLACY 187 PNPYE+AISIIG+TLSPFDEDNLIPCFGFGDA+THD+ VFSF+ DH C GFEEVLA Y Sbjct: 93 TPNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDKYVFSFYPDHRYCRGFEEVLARY 152 Query: 188 KKIVPNLHLSGPTSYGPVVEAAMDIVEKSGGQFHVLVIIADGQVTRSIDTSDNELSPQEE 247 K+IVP L LSGPTS+ P+++AA+DIVE S GQ+HVLVIIADGQV+ S+D S SPQE+ Sbjct: 153 KEIVPYLKLSGPTSFAPIIDAAIDIVEGSNGQYHVLVIIADGQVSGSLDGSSGRFSPQEQ 212 Query: 248 KTIRSIADASFYPLSIVLVGVGDGPWEDMRKFDDKLPSREFDNFQFVNFTEIMSKHTTSS 307 T+ SI AS YPLSI+LVGVGDGPW+ M+ FDD +P R FDNFQFVNF++IMS++ +S Sbjct: 213 ATVNSIVAASRYPLSIILVGVGDGPWDAMKLFDDNIPQRSFDNFQFVNFSKIMSENMEAS 272 Query: 308 EKEAAFALAALMEIPIQYKAAVEF-GILGRTTGXXXXXXXXXXXXXYTHRAPTRE---PS 363 +KE AFAL+ALMEIP QY+A + I G H + + Sbjct: 273 KKETAFALSALMEIPFQYRATLRLQSIDNNLVGGPRTRPLPPPKEVLDHDREALQHMMAT 332 Query: 364 GLSAPAGDERS--EMLCPVCLTNVKDIAFGCGHMSCRDCAPRLSDCPICRQPIRSRLRVF 421 LS A ++ + + +CP+CLTN K++AFGCGH++C++C +S CP+CR+PI +RL+++ Sbjct: 333 TLSVEAVEQTAPVDQVCPICLTNPKNMAFGCGHLTCKECGESISLCPLCREPINTRLKLY 392 Query: 422 T 422 + Sbjct: 393 S 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226792919 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56435546 (182 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2866265 144 1e-36 >Vv2866265 Length = 276 Score = 144 bits (362), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 76/185 (41%), Positives = 114/185 (61%), Gaps = 4/185 (2%) Query: 1 MENNSLANALF-GPENRINLDWPTRVKICTGIARGLAFLHEESRLKIVHRDIKATNVLLD 59 M N S+A+ L P + LDW TR +I G ARGL++LH+ KI+HRD+KA N+LLD Sbjct: 30 MANGSVASCLRERPPSEPPLDWTTRKRIALGSARGLSYLHDHCDPKIIHRDVKAANILLD 89 Query: 60 GDLNPKISDFGLAKLYDEEKTHVSTKVAGTIGYMAPEYALLGHLTYKADVYSFGVVALEI 119 + + DFGLAKL D + THV+T V GTIG++APEY G + K DV+ +G++ LE+ Sbjct: 90 EEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLEL 149 Query: 120 VSGKKN---SYVPSNACVSLLDWAYQLQQGGNLKELIDESLMSEIHGKEAKVMVKVGLLC 176 ++G++ + + ++ V LLDW L + L+ L+D L + E + +++V LLC Sbjct: 150 ITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYVEAEVEQLIQVALLC 209 Query: 177 PNVSP 181 SP Sbjct: 210 TQGSP 214 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21329 (398 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23856 154 3e-39 >Vv23856 Length = 418 Score = 154 bits (388), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 103/318 (32%), Positives = 166/318 (52%), Gaps = 22/318 (6%) Query: 26 GQSTDGAVSNGSSSGVTANGNGHVKRTADLAIYEQFQNQGRSLATHSNGVLSDRHDEIPQ 85 GQ + N G T N +V+ + + R L S V RH Sbjct: 90 GQFMEMVDQNNGIVGSTTGSNYYVRILSTI---------NRELLKPSASVALHRHSNALV 140 Query: 86 KSLLPAFESAEMRSLGESLCRDIVRGSPDVKWESIKGLENAKRLLKEAVVMPIKYPKYFT 145 L P +S+ + L +S PDV + I G + K+ ++EAV +P+ + + + Sbjct: 141 DVLPPEADSS-ISLLSQS-------EKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYK 192 Query: 146 GL-LTPWKGILLFGPPGTGKTMLAKAVATECKTTFFNISASSVVSKWRGDSEKLVKVLFE 204 + + P +G+LL+GPPGTGKTMLAKAVA F + S V K+ G+ ++V+ +F Sbjct: 193 QIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFR 252 Query: 205 LARHHAPSTIFIDEIDAIISQRGEGRSEHEAS-RRLKTELLIQMDGLTKTSELVFVLAAT 263 LA+ +AP+ IFIDE+DAI + R + ++ + +R+ ELL QMDG +T V V+ AT Sbjct: 253 LAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVN-VKVIMAT 311 Query: 264 NLPWELDAAMLR--RLEKRILVPLPEPEARRAMFEELLPAQPDEEKLPYDLLVDRTEGYS 321 N LD A+LR RL+++I PLP+ +R +F+ +++ + V R + S Sbjct: 312 NRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLSDEVDLEDYVSRPDKIS 371 Query: 322 GSDIRLVCKEAAMQPLRR 339 ++I +C+EA M +R+ Sbjct: 372 AAEIAAICQEAGMHAVRK 389 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19474 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7882 (413 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53255 111 2e-26 >Vv53255 Length = 468 Score = 111 bits (278), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 92/352 (26%), Positives = 147/352 (41%), Gaps = 37/352 (10%) Query: 56 PVVFSQGKGSCIQDPEGNRYLDFLSAYSAVNQGHCHPKIMKALQEQAQRLTLSSRAFYN- 114 P+V + KG+ + D G +YLD L+ G P+++ A Q L +F+N Sbjct: 36 PLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSEPRLVAAAIAQLNTLPFY-HSFWNR 94 Query: 115 ---DRFPIFAEYLTSMFGYDM--VLPMNTGAEAVETALKVARKWGHEKKKIPKDEAIIVS 169 + E L + M N+G+EA +T +K+ W + ++ ++ Sbjct: 95 TTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQVKLV--WYYNNALGRPNKKKFIA 152 Query: 170 CCGCFHGRTLAVISMSCDNEATRGF---GPL-------------LPGHLKVDFGD--AVG 211 +HG TL S+S + F P LPG + +F A Sbjct: 153 RAKSYHGSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYWRYHLPGESEEEFSTRLANN 212 Query: 212 LEK-VFKENGDRIAGFLFEPIQGEAGVIIPPDGYLKTVRDLCSKYNILMIADEIQSGLAR 270 LE + KE + IA F+ EP+ G GVI PP Y ++ + KY+IL IADE+ R Sbjct: 213 LENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFDKIQPILKKYDILFIADEVICAFGR 272 Query: 271 SGKMLAVDWEEVRPDVVILGKALGGGVIPVSAVLADKDVMLCIRPG-------EHGSTFG 323 G M D ++PD+V + KAL +P+ AVL ++ I HG T+ Sbjct: 273 LGTMFGCDKYGMKPDLVSMAKALSSAYMPIGAVLVSPEISDVIDSQSNKLGVFSHGFTYS 332 Query: 324 GNPXXXXXXXXXXDVIRDEKLAERSAEMGQELRNQLVKIQQQFPNYIKEVRG 375 G+P + ++ +AE + + +N L I E+RG Sbjct: 333 GHPVSCAVALEALKIYKERNIAEVVQRISPKFQNGLKAFSDS--PIIGEIRG 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752629 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32686 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3887 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7121 (228 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv28330 201 1e-53 >Vv28330 Length = 238 Score = 201 bits (511), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 118/193 (61%), Positives = 132/193 (68%), Gaps = 31/193 (16%) Query: 31 KRGFSETESKISTDTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHXXXXXX 90 KRGFSET VDLKLNL + KD +A +++ KEK+ Sbjct: 43 KRGFSET-----------VDLKLNLLS----------KDSVADQAEKMKEKS---ALPPS 78 Query: 91 XXXXXXXXXXQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAP 150 QVVGWPPVRSFRKN+ T VQK+S++ E ++A VKVSMDGAP Sbjct: 79 NDPAKPPAKAQVVGWPPVRSFRKNILT-VQKNSSEEEKAS------SSAAFVKVSMDGAP 131 Query: 151 YLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVLNGSDYTPTYE 210 YLRKVDLKMYKSY ELSDAL KMFSSFTIGNCGSQGMKDFMNESKL+D+LNGSDY PTYE Sbjct: 132 YLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYE 191 Query: 211 DKDGDWMLVGDVP 223 DKDGDWMLVGDVP Sbjct: 192 DKDGDWMLVGDVP 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22063 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29817 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812271 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21393 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14022 259 2e-71 >Vv14022 Length = 487 Score = 259 bits (662), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 119/165 (72%), Positives = 138/165 (83%) Query: 1 MHVPLYNSNDVHYMEGESMRAVFERWFVQYKVDVVFAGHVHAYERSYRISNIRYNVTSGY 60 MHVP+YNSN+ H+MEGESMRA FE WF+ KVD+VFAGHVHAYERSYRISNI Y+V+SG Sbjct: 323 MHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHYSVSSGD 382 Query: 61 QYPIPDKSAPVYITVGDGGNQEGLAGRFRNPQPDYSAFREASYGHSTLELINRTHALYHW 120 YP+PD+SAPVYITVGDGGNQEGLAGRFR+PQPDYSAFREASYGHSTLE+ NRTHA Y W Sbjct: 383 PYPVPDESAPVYITVGDGGNQEGLAGRFRDPQPDYSAFREASYGHSTLEIKNRTHAFYRW 442 Query: 121 NRNDDGKKTAMDAFILDNQYWSTNHRRRKLKKHNVRKTMDEIAMY 165 NRN DGK+ + D+F+L NQYW++ RKLKKH + + A Y Sbjct: 443 NRNSDGKQVSTDSFVLHNQYWASKLGSRKLKKHRLGDLIGWTAPY 487 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26884 (260 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9236 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41067 96 6e-22 >Vv41067 Length = 148 Score = 95.5 bits (236), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 51/148 (34%), Positives = 78/148 (52%), Gaps = 3/148 (2%) Query: 1 MSSPSKRREM-DLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAY 59 M+S +E+ DL K + + + M + GP DS Y GGV+ + + P Y Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 60 PYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDP 119 P+K P + F K++HPN++ +GS+CLD++ + WSP + V + + LL PNP DP Sbjct: 61 PFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDP 118 Query: 120 LNGEAAALMMRDRPAYEQRVKEFCLKYA 147 L E A + DR YE + + KYA Sbjct: 119 LVPEIAHMYKTDRAKYETTARSWTQKYA 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30431 (228 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25866264 202 3e-54 >Vv25866264 Length = 226 Score = 202 bits (515), Expect = 3e-54, Method: Compositional matrix adjust. Identities = 86/144 (59%), Positives = 113/144 (78%) Query: 24 VVLNVYDLTPLNNYTVWFGLGIFHSGIEVHGKEYGFGAHDFPVSGVFEVEPRSCPGFIYR 83 V LNVYDLTP+N Y W GLGI+HSG++VHG EY FGAH+ P +G+FEVEP+ CPGF +R Sbjct: 17 VYLNVYDLTPMNGYAYWLGLGIYHSGVQVHGVEYAFGAHEHPTTGIFEVEPKQCPGFTFR 76 Query: 84 CSIQLGRINMPPSEFRTFIEHVAAEYHGDTYHLISKNCNHFTDDMARRLTEKQVPGWVNR 143 SI +GR ++ P + R+F+E +A EY G+TY+LI++NCNHF +D+ RLT K +P WVNR Sbjct: 77 KSILIGRTDLGPKDVRSFMEKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIPRWVNR 136 Query: 144 LARLGALCSCLLPESLQVTTVKQI 167 LARLG LC+C+LP SL T V+Q+ Sbjct: 137 LARLGFLCNCVLPVSLNETKVRQV 160 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10382 (351 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24860 (164 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18960 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2643 122 2e-30 >Vv2643 Length = 319 Score = 122 bits (306), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 66/142 (46%), Positives = 98/142 (69%), Gaps = 4/142 (2%) Query: 2 TGVPTKMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYRN 61 TGV T M++MN +V++T N ATFFG+HV+STP+ L YS + VA+G +KK+YQ RKS+R+ Sbjct: 179 TGVATDMVSMNSTVKLTFRNTATFFGVHVTSTPLDLSYSRLRVASGTIKKFYQSRKSHRS 238 Query: 62 VTVNLQGIKVPLYGAGASLAVSDNNGG--VPMMLVFEVRSRGNVVGRLVRSKHRRHVSCT 119 +T+ L G K+PLYG GASL+ S +P+ L F +RSR V+G+LV+ K + + C+ Sbjct: 239 LTIVLMGDKIPLYGGGASLSTSTGTTTEPLPLKLSFMLRSRAYVLGKLVKPKFYKRIECS 298 Query: 120 MEVGSHS-STPIKLKTSSCTYK 140 + + + P+ LK SCTY+ Sbjct: 299 VNLDPKKLNVPLSLK-KSCTYQ 319 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29178 (107 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16336 96 1e-22 >Vv16336 Length = 400 Score = 95.9 bits (237), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 8/114 (7%) Query: 1 MSRSIGDRYMKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQEACDIARRRILLWH 60 MSR+IGD Y+KP++I +PEV R EDECLILASDGLWD ++N AC +A R L Sbjct: 286 MSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVA-RMCLNAQ 344 Query: 61 KKYSDTMSTERGEG-------TDPAAQSAAEYLSKLAMQKGSKDNITGVVVHLK 107 S +S E G G +D A A+ L+KLA+ + S DN++ VVV L+ Sbjct: 345 APPSPPVSPETGAGIGAGGESSDKACLDASMLLTKLALARDSADNVSVVVVDLR 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7674 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13087 (237 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv37239 81 2e-17 >Vv37239 Length = 257 Score = 81.3 bits (199), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Query: 7 GKPSERNEIKYKGVRKRKWGKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGH 66 G+ S ++ + Y+GVR R WGKWVSEIR P + RIWLG++ PE AARA D A ++G+ Sbjct: 45 GRDSSKHPV-YRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAALSIKGN 103 Query: 67 TAKFNFPD 74 +A NFP+ Sbjct: 104 SAILNFPE 111 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19737 (188 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21204 (291 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv318 260 3e-71 >Vv318 Length = 316 Score = 260 bits (664), Expect = 3e-71, Method: Compositional matrix adjust. Identities = 125/211 (59%), Positives = 158/211 (74%), Gaps = 1/211 (0%) Query: 80 VEVISWEPRAFVYHNFLTKEECDYLIDLAKPTMHKSTVVDSETGKSKDSRVRTSSGTFLA 139 V +SW PRAF+Y FL++EECD+LI LAK + KS V D+E+GKS S VRTSSG FL Sbjct: 54 VTQLSWRPRAFLYKGFLSEEECDHLITLAKDKLEKSMVADNESGKSIMSEVRTSSGMFLL 113 Query: 140 RGRDKIIRNIEKKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIG 199 + +D+I+ +IE +IA +TFLPVE+GE +Q+LHYE G+K EPH+DYF D N GG RI Sbjct: 114 KAQDEIVADIEARIAAWTFLPVENGESIQILHYENGEKCEPHFDYFHDKVNQLLGGHRIA 173 Query: 200 TVLMYLSDVEEGGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDA 259 TVLMYL+ V+EGGETVFP ++G S P + S+C KKG +V PK GDALLF+S+ PDA Sbjct: 174 TVLMYLATVDEGGETVFPNSEGRFSQ-PKDDSWSDCAKKGYAVNPKKGDALLFFSLHPDA 232 Query: 260 SLDPSSLHGGCPVIKGNKWSSTKWIRVNEYN 290 + DPSSLHG CPVI G KWS+TKWI V ++ Sbjct: 233 TTDPSSLHGSCPVIVGEKWSATKWIHVRSFD 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6335 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18120 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4779 (606 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv351 150 8e-38 >Vv351 Length = 286 Score = 150 bits (378), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 88/271 (32%), Positives = 148/271 (54%), Gaps = 13/271 (4%) Query: 150 NKYEMGEEVGRGHFGYTCKATFKKGELKGQQAAVKVIPKAKMTTAIAIEDVRREVKILRA 209 N +++G+ +GRG FG+ A K+ A+KV+ K+++ + +RREV+I Sbjct: 21 NDFDIGKPLGRGKFGHVYLAREKRS---NHIVALKVLFKSQLQQSQVEHQLRREVEIQSH 77 Query: 210 LSGHDNLVKFYDAYEDQENVYIVMELCEGGELLDRILARGGKYTEDDARTVMTQILNVVA 269 L H N+++ Y + DQ+ VY+++E GEL L + ++E A T + + + Sbjct: 78 LR-HPNILRLYGYFYDQKRVYLILEYAAKGELYKE-LQKCKYFSERRAATYVASLARALI 135 Query: 270 FCHLQGVVHRDLKPENFLFTSKDEDSQLKAIDFGLSDFVKPDERLNDIVGSAYYVAPEVL 329 +CH + V+HRD+KPEN L ++ E LK DFG S V R + G+ Y+ PE++ Sbjct: 136 YCHGKHVIHRDIKPENLLVGAQGE---LKIADFGWS--VHTFNRRRTMCGTLDYLPPEMV 190 Query: 330 HR-SYATEADVWSVGVIAYILLCGSRPFWARTESGIFRVVLKADPSFDEPPWPSLSTEAR 388 + D+WS+GV+ Y L G PF A+ S +R +++ D F PP P +S+ A+ Sbjct: 191 ESVEHDASVDIWSLGVLCYEFLYGVPPFEAKEHSDTYRRIVQVDLKF--PPKPIVSSTAK 248 Query: 389 DFVKRLLNKDPRKRMTAAQALCHPWLKNSND 419 D + ++L KD +R+ + L HPW+ + D Sbjct: 249 DLISQMLVKDSSQRLPLHKLLEHPWIIQNAD 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5899 (524 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12925 (218 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19490 62 1e-11 >Vv19490 Length = 214 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 1/114 (0%) Query: 74 PSVEYSKSWRGWMIGMVFSVIIPFWRHKWGPLLQLKKXXXXXXXXXXXXXXXXXXXXXXX 133 P S W+ WM+ + S+I+P +RHKWGPL+ L+ Sbjct: 89 PEKRSSPEWKKWMVVITLSIILPSYRHKWGPLVFLRSKVDETIETVETVTDITEDLGEDV 148 Query: 134 XXXXXXIGDHLP-ADGKFRAASEVVESIAREVAKDAHLADQLIEKAEALEDQVE 186 + + +P + K + A E ++ +A++V K+ A +LI+K E E +VE Sbjct: 149 EKIAEALENKIPDQEAKLKEAVETIDRLAKDVVKETEEAKRLIQKVEDAEKKVE 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48261349 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34249 86 2e-19 >Vv34249 Length = 259 Score = 85.5 bits (210), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 39/72 (54%), Positives = 52/72 (72%) Query: 1 MDFFKDYVLSESSIHFTMNSEGRPTGEGFVEFASAEDSKAAMAKDRMTLGSRYIELFPST 60 ++FF D+ L + +H +G+ TGE +VEFASAE++K AM KD+MT+GSRY+ELFPST Sbjct: 187 LEFFGDFELGDDKVHIACRPDGKATGEAYVEFASAEEAKKAMGKDKMTIGSRYVELFPST 246 Query: 61 HDELDEAISRGR 72 DE A SR R Sbjct: 247 PDEARRAESRSR 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2672 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2078 122 5e-30 >Vv2078 Length = 199 Score = 122 bits (305), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 64/85 (75%), Positives = 69/85 (81%), Gaps = 1/85 (1%) Query: 1 MIGFAASLLGEAITGKGILSQLNLETGVPIYEAEPXXXXXXXXXXXGAIGALGDRGKFV- 59 M+GFAASLLGEAITGKGIL+QLNLETG+PIYEAEP GAI ALGDRG+FV Sbjct: 103 MLGFAASLLGEAITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIXALGDRGRFVD 162 Query: 60 DDPPTGIEGAVIPPGKGFKSALGLN 84 DDPPTGIEGAVIPPGKG +SAL L Sbjct: 163 DDPPTGIEGAVIPPGKGLRSALXLR 187 Score = 77.0 bits (188), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/49 (77%), Positives = 42/49 (85%) Query: 91 GFTKANELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPINEIEP 139 GFTK NELFVGR+A LGFA SL+GE ITGKG LAQLN+ETG+PI E EP Sbjct: 89 GFTKKNELFVGRVAMLGFAASLLGEAITGKGILAQLNLETGIPIYEAEP 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91044742 (207 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25685 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34451 154 2e-39 >Vv34451 Length = 176 Score = 154 bits (388), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 98/226 (43%), Positives = 113/226 (50%), Gaps = 50/226 (22%) Query: 1 MTTSSKGNNNASSVVQVQEQAAGSHECCMCGDFGFSYELFVCKVCQFRSQHRYCSNLYPN 60 MTTS G ++ + S ECCMCGD+GFSYELF CKVCQFRSQHRYCSNLYP Sbjct: 1 MTTSKAGTVGGAA-------SQPSPECCMCGDYGFSYELFQCKVCQFRSQHRYCSNLYPK 53 Query: 61 AESYRICNWCLTQKEDTXXXXXXXXXXXXXXXXXXXDQDHPITXXXXXXXXXXXNSHYPY 120 A+SYR+CNWCL QK+DT + SH Sbjct: 54 ADSYRVCNWCLNQKDDTPEKTQNSSNSSSSNKNNEENDGR------IKKKKIGSGSH--- 104 Query: 121 GGCLRGTMQLQPSGPIKKQRSLDXXXXXXXXRQXXXXXXXXXXXXXXXXXXTRKRIITNA 180 RG++QL SGPIKKQ+S + TRKRII + Sbjct: 105 AKAQRGSLQLPVSGPIKKQKSPE------------------------RSPTTRKRIIASG 140 Query: 181 AKEAERIKRTRSEDISNIKNTSTIGITRQVFRNKVRRYKLLDEVSS 226 E ER+ RT SE GIT+ VFRNKVRRYKLLDEVSS Sbjct: 141 CME-ERLTRTNSEG---------SGITKHVFRNKVRRYKLLDEVSS 176 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15104 (324 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31405 (317 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748637 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48408266 (99 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9925 (465 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3798 (193 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27037 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21324 205 4e-55 >Vv21324 Length = 195 Score = 205 bits (522), Expect = 4e-55, Method: Compositional matrix adjust. Identities = 124/229 (54%), Positives = 140/229 (61%), Gaps = 39/229 (17%) Query: 1 MASGFGESTSVPPQSVSCSGNNANDVGDFECNICFELAQDPIITRCGHLFCWPCLYRWLH 60 M SGFGESTS PPQS S S N +W Sbjct: 1 MTSGFGESTSRPPQSPSFSSN-----------------------------------KWQQ 25 Query: 61 HHSNSQECPFCKALIEEEKLVPLYGRGKTQTDPRSKSYPGINIPNRPSGQRPPTAPPPNT 120 S+SQECP CKAL+EEEKLVPLYGRGKT TDPRSKS PGINIPNRP+GQRP TAPPP+ Sbjct: 26 IQSHSQECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGINIPNRPTGQRPETAPPPDA 85 Query: 121 NQFANY---GFGFMGGFVPMATQRIGNFTLATAFGGLLPSLLNVQYHGFPDATVYGTTSG 177 N F + G +GGF PMAT R GNFTL+ AFGGL PSL N+Q HGFPDAT+YG +G Sbjct: 86 NHFMQHGFGFMGGLGGFAPMATARFGNFTLSAAFGGLFPSLFNLQVHGFPDATMYGPAAG 145 Query: 178 FPFAPFNSFXXXXXXXFVQPENHQWQPADVW-KYFFLFIGVFVIMAVIF 225 FP+ NSF F Q Q Q AD + K FL IGVFVI+A+I+ Sbjct: 146 FPYGFSNSFHGGHAHGFPQHPPTQGQQADYYLKMLFLMIGVFVIIALIW 194 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25063 (244 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12120 (258 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19744 80 3e-17 >Vv19744 Length = 229 Score = 80.1 bits (196), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 65/224 (29%), Positives = 111/224 (49%), Gaps = 7/224 (3%) Query: 36 KSSYADQEAEGSLLEVFQGTSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFSAAS 95 KS D+ L E+ G + IG L QQ++G +V Y++ + ++AG S Sbjct: 6 KSDRGDEIDAVKLSELLYGRHFRVVFIGSTLFALQQLSGINAVFYFSSTVFKSAG--VPS 63 Query: 96 DATRVSVVIGLFKFLMTGVAVLKVDDLGRRPLLI---VGVSGXXXXXXXXXXXXXXXGGF 152 D +V +G+ + A++ +D LGR+ LL+ G++ G Sbjct: 64 DLA--NVFVGIANLSGSITAMILMDKLGRKALLVWSFFGMAVAMSVQVAGASSFISGSGA 121 Query: 153 PLIAVASLLLYVGCYQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFASNAIVTFAFSP 212 ++V+ +LL+V + + GP+ L++ EIFP R R K +++ + ++ N V F Sbjct: 122 VFLSVSGMLLFVLTFALGAGPVPGLLLPEIFPNRIRAKAMAVCMSVHWVINFFVGLLFLR 181 Query: 213 LKEALGADNLFILFGAIALLSLIFVVLIVPETKGLTLEEIESKL 256 L E LG L+ +F L++++FV V ETKG +L+EIE L Sbjct: 182 LLEQLGPQLLYSMFCTFCLMAVVFVKRNVVETKGRSLQEIEIAL 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9746 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3410 139 2e-35 >Vv3410 Length = 180 Score = 139 bits (351), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 70/142 (49%), Positives = 98/142 (69%) Query: 21 LTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAI 80 LT + E KEAF LFD DG G I KEL MR+LG TE ++ MI +VD DG+G I Sbjct: 5 LTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTI 64 Query: 81 DFDEFAHMMTAKIGERDTKEELMKAFQLIDLDRNGKISAADIKSIAKDLGENFTDSEIQE 140 DF EF ++M K+ + D++EEL +AF++ D D+NG ISAA+++ + +LGE TD E+ E Sbjct: 65 DFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDE 124 Query: 141 MIEEADRDRDGEVNADEFIRMM 162 MI EAD D DG++N +EF+++M Sbjct: 125 MIREADVDGDGQINYEEFVKVM 146 Score = 61.2 bits (147), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 30/66 (45%), Positives = 45/66 (68%) Query: 27 QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIHQMIADVDKDGSGAIDFDEFA 86 +E+KEAF +FD D +G I A EL M LG ++T+E++ +MI + D DG G I+++EF Sbjct: 84 EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 143 Query: 87 HMMTAK 92 +M AK Sbjct: 144 KVMMAK 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11115 (331 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7520 (419 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv7913 165 1e-42 >Vv7913 Length = 224 Score = 165 bits (417), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 83/211 (39%), Positives = 125/211 (59%), Gaps = 11/211 (5%) Query: 197 DGSRPAYIKLASRFRETRGIVANTFVELETHAITLFSN-----DTRIPPVYPVGPGIDLD 251 D + ++ ++ + GI+ NTF LE A+ + D PP++ +GP I +D Sbjct: 10 DKAYEFFLNMSIHLPRSAGIIVNTFEALEPRAVETILDGLCVLDGPTPPIFCIGPLIAVD 69 Query: 252 DGQAHSNLDQAQRDKIIKWLDDQPQKSVVFLCFGSMGSFRAEQVKEIALGLEQSGQRFLW 311 D + + + WL+ QP++SV+FLCFGS+G F EQ+KEIA+GLE+SGQRFLW Sbjct: 70 DRSGGGGGGGSGIPECLTWLESQPKRSVLFLCFGSLGLFSEEQLKEIAVGLERSGQRFLW 129 Query: 312 SLRMQPPKG-----TVPSDCSNLEEVFPDGFLERTNGKKGLICGWAPQEEVLAHSATGGF 366 +R P K P + +L + PDGFL+RT + ++ WAPQ VL H++ G F Sbjct: 130 VVRSPPSKDPSRRFLAPPE-PDLNSLLPDGFLDRTKERGLVVKSWAPQVAVLNHASVGRF 188 Query: 367 LSHCGWNSILESLWHGVPIATWPMYAEHQLN 397 ++HCGWNS+LE++ GV + W +YAE + N Sbjct: 189 VTHCGWNSVLEAVCAGVAMVAWXLYAEQRFN 219 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16098 (339 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4947 265 1e-72 >Vv4947 Length = 441 Score = 265 bits (676), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 142/322 (44%), Positives = 192/322 (59%), Gaps = 14/322 (4%) Query: 1 GDRVKQWTTLNEPHSVSNNGFAVGSQAPGRCSYWQNRNCLGGDSAIEPYXXXXXXXXXXX 60 GDRVK W TLNEP + NG+ VG APGR + S+ EPY Sbjct: 125 GDRVKNWITLNEPLQTAVNGYGVGIFAPGRQEH----------SSTEPYLVAHHQLLAHA 174 Query: 61 XXVKVYKDKYQAFQKGLIGITLNTYWFVPASETKEDKHAALRSLDFMFGWFMEPLTSGDY 120 V +Y++KY+ Q G IG+ ++ W S+ EDK AA R LDF GWF++P+ GDY Sbjct: 175 AAVSIYRNKYKDKQGGQIGLVVDCEWAEAFSDKIEDKVAAARRLDFQLGWFLDPIYFGDY 234 Query: 121 PQSMRSLVGNRLPVFTNEESMLLTGSFDFLGLNYYTARYSSNDVPDNSSLPASYVTDSHV 180 P+ M +G+RLP F+ E+ LLT S DF+GLN+YT+R+ +++ SS+ + D + Sbjct: 235 PEVMHEKLGDRLPKFSEEQIALLTNSVDFVGLNHYTSRFIAHN---ESSVEHDFYKDQKL 291 Query: 181 KVTIELNGVP-IGPPTASDWLYVYPKGVYDLLLYIKKKYNDPLIYITESGVSEFNDPKLS 239 + E +G IG AS WLYV P G+ +L YI ++YN P IY+TE+G+ + ++ Sbjct: 292 ERIAEWDGGEVIGEKAASPWLYVVPWGIRKVLNYIAQRYNSPPIYVTENGMDDEDNDTSP 351 Query: 240 LQEALNDTNRVDYYYRHLCYVRAAIKNGSKVKGYIAWSLLDNFEWEIGYAVRFGINYVDY 299 L E L+D RV Y+ +L V AIK+G V+GY AWSLLDNFEW GY RFG+ YVDY Sbjct: 352 LHEMLDDKLRVFYFKGYLASVAQAIKDGVDVRGYFAWSLLDNFEWSQGYTKRFGLVYVDY 411 Query: 300 NNGLKRYPKLSAHWFKSFLKKD 321 N L R+PK SA WF FL+ D Sbjct: 412 RNDLSRHPKSSALWFLRFLRGD 433 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17391 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14966265 136 3e-34 >Vv14966265 Length = 246 Score = 136 bits (342), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 71/139 (51%), Positives = 90/139 (64%), Gaps = 7/139 (5%) Query: 64 VLPNCNRLLNQEILRVTTLLGNASVLGQSGIELASPLASRGMFSNGGA-DVNGWASRFQS 122 +LP C+RLLNQEI R++ + N + IE SP S G NGG D+ GW + Q+ Sbjct: 3 ILPQCSRLLNQEIRRLSAIAPNQGFVDLERIEHDSPFRSLGQHPNGGPMDLEGWPA-MQT 61 Query: 123 EMSGLLQ-----SSSTQNWLSPQSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNS 177 E +G L+ +S+ W + +VKR IR+D+PVDKYPNYNFVGR+LGPRGNS Sbjct: 62 EENGPLRRMAPFQASSLGWHRAPGIPTTPVVKRVIRLDVPVDKYPNYNFVGRILGPRGNS 121 Query: 178 LKRVEVTTECRVLIRGRGS 196 LKRVE TECRV IRG+GS Sbjct: 122 LKRVEAMTECRVYIRGQGS 140 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742802 (45 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226748171 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15466256 130 9e-33 >Vv15466256 Length = 322 Score = 130 bits (328), Expect = 9e-33, Method: Compositional matrix adjust. Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 4/153 (2%) Query: 7 VVCVTGGSGCIGSWLVRLLLHRDYTVHATVKDLKDDGETKHLEALVEGVESRLRLFQIDL 66 VVCVTG SG I SWLV+LLL R YTV A+V+D D +T+HL +L +G + RL LF+ +L Sbjct: 5 VVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLSL-DGAKERLHLFKANL 63 Query: 67 LDYNSILAAVNGCSGVFHLASPCIVDQVHDPEKELLDPAIKGTLNVL-TAAKQAGVSRVV 125 L+ S + V GC GVFH ASP V DP+ EL+DPA+KGTLNVL + AK + V RVV Sbjct: 64 LEEGSFDSIVEGCVGVFHTASP-FFHAVTDPQAELIDPAVKGTLNVLGSCAKASSVKRVV 122 Query: 126 LXXXXXXXXXXXXXXXDKVKGEDCW-TDIDYCK 157 + V ++ W TD D+CK Sbjct: 123 VTSSIAAVAYNRNPRTPDVVVDETWFTDPDFCK 155 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17314 (325 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57327 154 2e-39 >Vv57327 Length = 97 Score = 154 bits (390), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 72/97 (74%), Positives = 85/97 (87%) Query: 229 GLADIVGRRFGTQKLPYNRNKSIAGSVAMASAGFLTSIGYMYYFSSFGYVQESWGMALGF 288 GLAD+VGRRFG QK+PYNRNKS +GS+AMA AGFL SIGYM+YF+SFG++QESW M GF Sbjct: 1 GLADLVGRRFGIQKIPYNRNKSFSGSLAMAVAGFLASIGYMHYFASFGFIQESWEMVFGF 60 Query: 289 LVVSLASALVESLPISTELDDNLTVSLTSALIGSLVF 325 LVVSL S LVESLPIS E+DDNLT+ +TS L+G+LVF Sbjct: 61 LVVSLGSTLVESLPISNEIDDNLTIPVTSLLLGTLVF 97 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10510 (330 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6966261 107 2e-25 >Vv6966261 Length = 278 Score = 107 bits (268), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 49/82 (59%), Positives = 60/82 (73%), Gaps = 6/82 (7%) Query: 240 QKRIVRVPAISLKLADI------PPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARK 293 QKR+V VP ++ + + P D ++WRKYGQKPIKGSP+PRGYY+CSS +GCPARK Sbjct: 53 QKRVVSVPIKDVEGSRVKGDCAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARK 112 Query: 294 HVERALDDAAMLVVTYEGEHNH 315 VER+ D MLVVTY EHNH Sbjct: 113 QVERSRVDPTMLVVTYSCEHNH 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753563 (167 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19280 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4698 224 5e-61 >Vv4698 Length = 172 Score = 224 bits (572), Expect = 5e-61, Method: Compositional matrix adjust. Identities = 113/172 (65%), Positives = 126/172 (73%), Gaps = 3/172 (1%) Query: 1 MEHEETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQTKLAASSFGSIVN 60 M+H+ETGCQ+ PEGPILC+NNCGFFGS ATMNMCSKCHKDM+LKQEQ KLAASS SIVN Sbjct: 1 MDHDETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMMLKQEQAKLAASSIDSIVN 60 Query: 61 RTSSINANEP--VASVDVQPHPMEPKTLXXXXXXXXXXXXXXXXX-XXXXXRCNTCNKRV 117 +SS N EP ++VDVQ EPK + RC+TC KRV Sbjct: 61 GSSSNNGKEPAIASTVDVQVDAKEPKIISVQSSFSFGSEGSGEAKPKEGPNRCSTCKKRV 120 Query: 118 GLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVKADKLGKI 169 GLTGFNCRCGHLFCA HRYSDKHDC +DY TA +DAIAKANPVVKA+KL KI Sbjct: 121 GLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANPVVKAEKLDKI 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6064 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48263478 (124 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13107 (218 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60475 120 2e-29 >Vv60475 Length = 405 Score = 120 bits (300), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 71/188 (37%), Positives = 97/188 (51%), Gaps = 5/188 (2%) Query: 34 AAGDGTIVRGTGSK---SLNLYSAINQALHIALETDPRSYVFGEDV-SFGGVFRCTTGLA 89 AA V T SK L L+ A+ + L ++ DPR V GEDV +GG ++ T GLA Sbjct: 67 AAKADASVTSTASKPGHELLLFEALREGLEEEMDRDPRVCVMGEDVGHYGGSYKVTKGLA 126 Query: 90 DRFGKQRVFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRS 149 ++G RV +TP+ E G GIG A G R + E ++ AF+QI N Y S Sbjct: 127 TKYGDLRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLAFNQISNNCGMLHYTS 186 Query: 150 GNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQTKSLLLSCIRD 209 G QF + IR P G G HSQ E++F PG+++V +P K L+ + IR Sbjct: 187 GGQFKI-PVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLMKAAIRS 245 Query: 210 PNPVVFFE 217 NPV+ FE Sbjct: 246 ENPVILFE 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25792 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14448 184 1e-48 >Vv14448 Length = 243 Score = 184 bits (466), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 85/139 (61%), Positives = 110/139 (79%), Gaps = 4/139 (2%) Query: 39 QKLDVHKHLNRLNKPAVKSIKSPDGDIIDCVHISQQPAFDHPYLKDHKIQMRPTYHPEGL 98 +KL++ KHL RLNK AVK+IKS DGDIIDCV ++ QPAFDHP LK+H IQM+P++HPEGL Sbjct: 27 RKLEIKKHLKRLNKRAVKTIKSRDGDIIDCVRVTHQPAFDHPMLKNHTIQMKPSFHPEGL 86 Query: 99 FAENKVAESTKERVN--TQLWHVNGRCPEDTIPVRRTKEDDILRASSMKHYGRKKQRTI- 155 F E K + +R TQLW +NGRCP+ T+P+RRTK +D+LRA+S+ +G+KK RT Sbjct: 87 FTEMKAPSKSHKRSKPVTQLWQLNGRCPKGTVPIRRTKREDVLRANSISRFGKKKHRTFP 146 Query: 156 -PKSADPDLANESGHQHAI 173 P+SADPDL ++SGHQHAI Sbjct: 147 QPRSADPDLISQSGHQHAI 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27485 (179 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764350 (235 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17999 (210 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22123 149 3e-38 >Vv22123 Length = 266 Score = 149 bits (377), Expect = 3e-38, Method: Compositional matrix adjust. Identities = 74/124 (59%), Positives = 95/124 (76%) Query: 16 LSLSALQSLRHLEKLNLKDTKVTDAALDPLKSFHELTDLTLKSASLTDNSLYHTSSIPKL 75 LSL+AL SL ++++L+L+ T+V D AL PL F +L +L+LK LTD SLY SS+P L Sbjct: 102 LSLAALHSLNYVKRLDLEGTQVEDEALCPLLRFQQLNELSLKGTRLTDLSLYQLSSLPNL 161 Query: 76 TNLCVHDGVLTNSGLNSYKPPSTLRMMDLSGCWLLTEDAISSFCKAHSQIELRHELVHIS 135 NL + D VLTN GLNS+KPP+ L+++DL GCWLLTEDAI SF K QIE+RHELVHI+ Sbjct: 162 MNLSIGDTVLTNGGLNSFKPPAALKLLDLRGCWLLTEDAILSFHKNDPQIEVRHELVHIT 221 Query: 136 PSKQ 139 PS+Q Sbjct: 222 PSEQ 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9623 (673 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2902 (228 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20530 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48390652 (64 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46607608 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5266 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv7681 129 1e-32 >Vv7681 Length = 153 Score = 129 bits (324), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 63/105 (60%), Positives = 80/105 (76%) Query: 1 MKLVSRIKKIQEELSTLEDHCRQLLSAKQDLIDKARTTLVGNRNQLQRMETSMGVXXXXX 60 M LVSRIKK+QE+L +L++ C++LL+AKQDLIDKARTTLVGNR+ LQRM+ MG+ Sbjct: 46 MILVSRIKKLQEDLCSLKEQCQELLAAKQDLIDKARTTLVGNRSLLQRMQAPMGIPLASD 105 Query: 61 XXXXXXXXXXQVIDEWTAQVRSKTGDENRDSDSEDINQLLFSAIV 105 Q+IDEWT QVRS+TGD +S+SEDIN++LFSAIV Sbjct: 106 SDDPAYANFNQIIDEWTNQVRSRTGDVTHESESEDINKMLFSAIV 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5745 (214 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9413 (278 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25148 (197 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20341 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226795738 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25866264 168 4e-44 >Vv25866264 Length = 226 Score = 168 bits (425), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 87/132 (65%), Positives = 95/132 (71%), Gaps = 1/132 (0%) Query: 1 MEKLAEEYSGNTYHLISKNCNHFCNDVCTRLTGKPIPRWVNRLARLGFFCNCVLPAGLNE 60 MEKLAEEYSGNTY+LI++NCNHFCNDVC RLTGKPIPRWVNRLARLGF CNCVLP LNE Sbjct: 95 MEKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIPRWVNRLARLGFLCNCVLPVSLNE 154 Query: 61 TKVRQVRS-DGVCNGDKKKLRSHXXXXXXXXXXXXXXXXXXXXXAGRSSRQRHCVLPSQS 119 TKVRQVRS D VC G+KKKLRSH A RS RQ+ C+ PS S Sbjct: 155 TKVRQVRSEDRVCQGEKKKLRSHSSRFVSSSNTPPSLSPHSSGSANRSCRQKRCLPPSSS 214 Query: 120 LVHSSSTSAVTL 131 L+H SS S + L Sbjct: 215 LIHKSSPSTLKL 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7498 (333 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12106 (334 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3789 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19861 (370 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31805 (242 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4146 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812193 (80 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15327 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6626 195 6e-52 >Vv6626 Length = 210 Score = 195 bits (495), Expect = 6e-52, Method: Compositional matrix adjust. Identities = 102/168 (60%), Positives = 124/168 (73%), Gaps = 1/168 (0%) Query: 1 MVRKKVEMKRIENNTSRQVTFSKRRKGLLKKAYELSVLCDAEVAVIVFSQKGRIYEFSSS 60 MVR K++M+RIEN TSRQVTFSKRR GLLKKAYELSVLCDAEVAVI+FSQKGR+YEFSSS Sbjct: 1 MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSS 60 Query: 61 DMQRTINRYHKHENGSGPTNKVEVEQYVQHLXXXXXXXXXXXXXXXXSQRKLLGNDLDSC 120 +MQ I RY +H TN E+EQY+Q+L SQRKLLG L SC Sbjct: 61 NMQSAIERYREHAK-QVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSC 119 Query: 121 PVEELQEISSQLERSLRSISERKAQLYTEHMEQHKARERFLLQENAQL 168 ++E+ EI SQLE+SL+SI RKAQ++ E +E+ K RE+ LL+ENA+L Sbjct: 120 SLDEILEIDSQLEKSLKSIRARKAQIFQEQIEELKEREKQLLEENARL 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18565 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26462 (338 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv44349 184 2e-48 >Vv44349 Length = 263 Score = 184 bits (467), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 98/214 (45%), Positives = 141/214 (65%), Gaps = 7/214 (3%) Query: 34 LRPGGMLVQKRNPDSDRNSAPP-------PTIRVRVKYGSIYHEMSISAQSSFGDLKKML 86 LRPGGMLVQKR + I ++V +GS +H++ + QS+FGDLKK L Sbjct: 11 LRPGGMLVQKREDGDNNGGVGGGDSGSGSAMINIKVCHGSNHHQLHVPIQSTFGDLKKRL 70 Query: 87 VGPTGLHHEDQKLIFKDKERDSKAFLDMSGVKDRSKMVLVEDPISQEKRYLEMRRNAKME 146 V TGL +DQ+L+F+ KE D + L GVKDRSK++L+E+ S+E++ E RR+ ++ Sbjct: 71 VQETGLEPKDQRLLFRGKEIDDQECLQQVGVKDRSKLLLLEEMASKERKLEEARRSDEIS 130 Query: 147 KASKSISEISLEVDRLAGQVSALESIITKGKKVAEQDVLVLIEQLMNQLLKLDGIMGDGD 206 KA K+++E+ EVD+L +V ALE+ + G V ++ +VL E LM QLLKLDGI +G+ Sbjct: 131 KACKAVAEVKAEVDKLLEKVVALEATVNGGTTVENKEFVVLTELLMRQLLKLDGIEAEGE 190 Query: 207 VKLQRKMQVKRVQKYVETLDVLKAKNSSPSSNGS 240 K+QR+ +V+RVQ VE LD LKA+NS+P S S Sbjct: 191 AKVQRRAEVRRVQSLVEMLDTLKARNSNPFSTKS 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5729 (216 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11429 (321 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2466261 238 1e-64 >Vv2466261 Length = 322 Score = 238 bits (606), Expect = 1e-64, Method: Compositional matrix adjust. Identities = 140/268 (52%), Positives = 162/268 (60%), Gaps = 27/268 (10%) Query: 72 YYEADRPPPTR--VSHVSHSSHGFAPPSPPSQPEGFLHHPPPVQNYNY---------PSS 120 +Y D PPP R V H+SH+ PP PP P +HH V++ + P Sbjct: 58 FYGEDEPPPPRAQVHHISHAD----PPRPP--PSSHVHHISHVEDQGFGRENYTHEGPPY 111 Query: 121 QXXXXXXXXXXXXXXXQFHHESPAAQFGTE---THQTSHLPSSSPHN-------SYLSNK 170 HH +P GTE TH HLP H+ S LSNK Sbjct: 112 ARPPPVSYSASAPVRHVSHHLNPQQPQGTEQVETHHLHHLPGFLHHHNEAHGVGSNLSNK 171 Query: 171 PTFRIFSKADPNFSLSIREGKVILARSQPTDDFQLWYKDEKYSTQVKDEERFPSFALINK 230 PT R+F KA PN SL+I +GKV LA S TD Q W KDEKYST VKDEE FPSFAL+NK Sbjct: 172 PTVRVFCKAKPNHSLTILDGKVYLAPSDKTDMLQHWIKDEKYSTSVKDEEGFPSFALVNK 231 Query: 231 ATGHALKHSIGATQPVQLRPYNPDDLDESLLWTESADLGDGFRTVRMVNNIHLNLDAYHG 290 ATG A+KHSIGA+ PVQL PYNPD LDES+LWTES DLGD FR++RM+NNIHLN+DA HG Sbjct: 232 ATGQAMKHSIGASHPVQLIPYNPDVLDESVLWTESKDLGDNFRSIRMINNIHLNVDALHG 291 Query: 291 DKKSGGVHDGTTIVVWNKNKGDNQRWKI 318 D+ G VHD TTIV+ KGDNQ WKI Sbjct: 292 DRSHGSVHDCTTIVLNKWKKGDNQLWKI 319 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48386554 (134 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5037 215 3e-58 >Vv5037 Length = 229 Score = 215 bits (547), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 103/134 (76%), Positives = 119/134 (88%) Query: 1 MSSLRNAVSRRAHKERAQPESRKKFGLLEKHKDYVERAKAYHKKEETLRILKQKAFYRNP 60 MSS RNA+SRRA+KERAQP R KFGLLEK KDYV RA+A+HKKEE L+ L +KA +RNP Sbjct: 1 MSSFRNAISRRAYKERAQPHLRNKFGLLEKRKDYVVRAQAFHKKEEALQKLIEKAAFRNP 60 Query: 61 DEFNFKMIKTRTVNGVHKLESQANKYTPEELMLMKTQDIGYIFQKVQSEKKKIEKLTATL 120 DEF FKMIKTRTV+GVH+ ESQANKY+PEELMLMKTQD+GY+ QKVQSEKKKIEKLTA L Sbjct: 61 DEFYFKMIKTRTVDGVHRPESQANKYSPEELMLMKTQDMGYVLQKVQSEKKKIEKLTAML 120 Query: 121 HSLDNRPSSRHVYF 134 HSLDN+P++R VY+ Sbjct: 121 HSLDNQPTNRSVYY 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27915 (279 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10166 (230 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391848 (61 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8351 (612 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv994 96 2e-21 >Vv994 Length = 390 Score = 95.9 bits (237), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 71/214 (33%), Positives = 108/214 (50%), Gaps = 26/214 (12%) Query: 242 LLKALLDCARLAESDPDGAVKSLVRLRESI---SDHGDPTQRVAFYFAEALQNRVSFLQS 298 L+ ++ CA + SL+ +++ + G +VA YF +AL RV Q+ Sbjct: 156 LVHMMMTCAESVQRGDLPLAGSLIEEMQALLTRVNTGCGIGKVARYFIDALNRRVFTPQA 215 Query: 299 EKSFTTAHDTPC-----EDFTLSYKALNDACPYSKFAHLTANQAILEATERATKLHIVDF 353 PC + + Y +ACPY KFAH TANQAILEA + +H+VDF Sbjct: 216 ----------PCATGWSNENEILYHHFYEACPYLKFAHFTANQAILEAFDGHDCVHVVDF 265 Query: 354 GIVQGVQWAALLQALATRSTGKPVSIRISGI--PAPSLGDSPAASLIATGNRLREFAKLL 411 ++ G+QW AL+QALA R G P+ +R++GI P+P D SL G RL E A+ + Sbjct: 266 NLMHGLQWPALIQALALRPGGPPL-LRLTGIGPPSPDGRD----SLREIGLRLAELARSV 320 Query: 412 ELNFEFEPI-LTPVHQLDESCVRVDPDEALAVNL 444 + F F + + + + ++V P EA+ L Sbjct: 321 NVRFAFRGVAASRLEDVKPWMLQVSPKEAVXYKL 354 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32119 (141 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36389 66 3e-13 >Vv36389 Length = 542 Score = 65.9 bits (159), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Query: 78 SGED-AVCCICLAKYADDDELRELPCLHVFHVECVDKWLK-INASCPLCKSEAGE 130 SGED A C ICLA+Y + D++R LPC H +H+ CVDKWLK I+ CPLC+ + E Sbjct: 473 SGEDVAQCYICLAEYEEGDKIRVLPCHHEYHMSCVDKWLKEIHGVCPLCRGDVRE 527 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2613 (159 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30148 (305 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13327 73 5e-15 >Vv13327 Length = 259 Score = 73.2 bits (178), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 54/212 (25%), Positives = 93/212 (43%), Gaps = 9/212 (4%) Query: 88 HCQIFSLHMELNAVEADR-FPSMCRVVALQYIKEGQYARDLNSTVSMIQNYFSSITPTHD 146 C + +E N + + P C Y+ Y DL + Y S+ + D Sbjct: 46 ECTSWRFGVEANNLGPWKTIPVACAEYVKDYMTGRAYEIDLGRVANEAAIYARSVELSAD 105 Query: 147 GXXXXXXXXXXXXSSNRR--------LHRYDQYGGSDFVEEAKHLKQMFILRLYMELHAG 198 G SN L +D+ + +VE+A L+LY + + Sbjct: 106 GNDVWVFDVDETLLSNLPYYAEHGYGLEVFDEMEFAKWVEKATAPAIGSSLKLYEVVQSL 165 Query: 199 GWPLILLSRKPEAERNSSIEDLISAGYRAWSSLIMRSEDELHMESHDYFSKRRDAMQKEG 258 G+ LL+ + E +R+ ++E+LI+AG++ W LI+R ++ ++ Y S++R M KEG Sbjct: 166 GFKTFLLTGRSENQRSVTVENLINAGFQNWDKLILRGSNDHGKQATVYKSEKRSEMVKEG 225 Query: 259 FRAIASVSSHMDALRSPFSGERIFKLPNPIFY 290 +R + + L R FKLPNP++Y Sbjct: 226 YRIVGNSGDQWSDLLGSEMSLRSFKLPNPMYY 257 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13560 (238 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11572 309 2e-86 >Vv11572 Length = 233 Score = 309 bits (792), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 157/235 (66%), Positives = 179/235 (76%), Gaps = 3/235 (1%) Query: 1 MASLTSITLNPSYS-SPLGSFASNHCQHNQNSCWLTAVGXXXXXXXXXXXXXXXQGLRIR 59 MA+L SIT + S S P +SN H+ +S +T +GL+I+ Sbjct: 1 MAALASITPHSSSSLHPKSHLSSNTSHHSISSYCVTR--SVRTNRQRLYSESGSRGLKIQ 58 Query: 60 SAATKQAKTPAEEDWKTKRELLLQKKVRSVDVKEALRLQKENNFVILDVRPEAEFKEAHP 119 SAATK AK+PAEEDWK KRE+LL+KKVRSVD KEALRLQ+ENNFVILDVRPEAEFKEAHP Sbjct: 59 SAATKPAKSPAEEDWKIKREVLLEKKVRSVDAKEALRLQQENNFVILDVRPEAEFKEAHP 118 Query: 120 PGAINVQIYRLIKEWTAWDXXXXXXXXXXXXXXXTEENPDFISSVGSQLDKKAKIIVACA 179 PGAINVQIYRLIKEWTAWD TEENP+F+ SV S++DK AKIIVAC+ Sbjct: 119 PGAINVQIYRLIKEWTAWDIARRAAFAFFGIFAGTEENPEFMQSVESKIDKSAKIIVACS 178 Query: 180 AGGTMRPTQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYAWFKEGLPSVAEE 234 +GGTM+P+QNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLY WFKEGLPSV+EE Sbjct: 179 SGGTMKPSQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYTWFKEGLPSVSEE 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17501 (39 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7849 (333 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14765 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26595 280 7e-78 >Vv26595 Length = 393 Score = 280 bits (717), Expect = 7e-78, Method: Compositional matrix adjust. Identities = 134/172 (77%), Positives = 155/172 (90%) Query: 2 PQLMEDDVQFVMLGSGDPVCEDWMRATEATYKDKFRGWVGFNVPVSHRITAGCDILLMPS 61 P+LM +DVQ VMLGSG+P E+WMR E+TY+DKFRGWVGFNVP+SHRITA CDILLMPS Sbjct: 222 PELMGEDVQLVMLGSGNPEDEEWMRVMESTYRDKFRGWVGFNVPISHRITASCDILLMPS 281 Query: 62 RFEPCGLNQLYAMRYGTVPVVHSTGGLRDTVVNFNPYAQGGKGDGTGWTFSPLTKESMLA 121 RFEPCGLNQLYAMRYG VPVVH TGGLRDTV NFNPYA GG G+GTGWTFSPL+K++MLA Sbjct: 282 RFEPCGLNQLYAMRYGAVPVVHGTGGLRDTVENFNPYAGGGSGEGTGWTFSPLSKDTMLA 341 Query: 122 ALKLACRTFREYKPSWEGLMKRGMERDFTWESAAIKYERVFGWAFIDPPYVK 173 AL++A RT+RE+KPSWE LMKRGME+D+TW+ AA++YE+VF WAFIDPPYV Sbjct: 342 ALRVAIRTYREHKPSWERLMKRGMEKDYTWDKAALEYEQVFKWAFIDPPYVS 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22425 (431 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825516 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22065 (269 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46022 61 2e-11 >Vv46022 Length = 288 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/89 (37%), Positives = 49/89 (55%) Query: 8 GPPDIRDTYSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGDSRGFAFVRYKYQ 67 G ++ T + V N+++ L LF + GKV + + DR TG SRGF FV Y Sbjct: 196 GGANLNSTNRIYVGNLSWGVDDLALETLFSEQGKVTEARVIYDRETGRSRGFGFVTYNSA 255 Query: 68 DEAHKAVEKLDGRVVDGREIMVQFAKYGP 96 +E ++A+E LDG ++GR I V A+ P Sbjct: 256 EEVNRAIESLDGVDLNGRSIRVTMAEARP 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11175 (375 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47924 615 e-178 >Vv47924 Length = 371 Score = 615 bits (1586), Expect = e-178, Method: Compositional matrix adjust. Identities = 298/375 (79%), Positives = 331/375 (88%), Gaps = 4/375 (1%) Query: 1 MAALRSFLKKRSSVLCNGGAVRHRLFSAQVSQPIPDSPSFAQRIGNLPKDLPATQIKTQV 60 MAAL SF K++SS+ A+R R FS +QPI DSPSF+QRI +LPKDLP T IK +V Sbjct: 1 MAALSSFFKRKSSIPFTSLAIR-RWFS---TQPILDSPSFSQRIRDLPKDLPGTNIKKEV 56 Query: 61 SQLIGRTPIVYLNKVTEGCGAFIAVKQEMFQPTASIKDRPALSMINDAEEKGLITPGETT 120 SQLIG+TP+V+LNKVTEGCGA++AVKQEM QPTASIKDRPAL+MI DAE K LITPG+T Sbjct: 57 SQLIGKTPLVFLNKVTEGCGAYVAVKQEMMQPTASIKDRPALAMITDAENKQLITPGKTV 116 Query: 121 LIEPTSGNMGISMAFMAAMKGYKMVLTLPSYTSLERRVCMRCFGADLILTDPTKGMGGTV 180 LIEPTSGNMGISMAFMAAMKGYKMVLT+PSYTSLERRV MR FGADLILTDPTKGMGGTV Sbjct: 117 LIEPTSGNMGISMAFMAAMKGYKMVLTMPSYTSLERRVTMRAFGADLILTDPTKGMGGTV 176 Query: 181 KKAYDLLESTPNAFMLQQFSNPANTKVHFETTGPEIWEDTNGQVDIFVMXXXXXXXXXXX 240 KKAY+LLESTP+AFMLQQFSNPANT+VHFETTGPEIWEDT GQVDIF+M Sbjct: 177 KKAYELLESTPDAFMLQQFSNPANTQVHFETTGPEIWEDTRGQVDIFIMGIGSGGTVSGV 236 Query: 241 XQYLKSKNPNVQIYGVEPAESNVLNGGKPGPHSITGNGVGFKPDILDMDMMERVIEVRSE 300 +YLKS+NPNV+IYG+EP ESNVLNGGKPGPH ITGNGVGFKPDILDMD+ME V+ V SE Sbjct: 237 GRYLKSQNPNVKIYGLEPTESNVLNGGKPGPHHITGNGVGFKPDILDMDVMEEVLMVSSE 296 Query: 301 DAVNMARQLALKEGLMVGISSGANTVAAMELAKKPENKGKLIVTVHASFGERYLSSVLFQ 360 DAVNMARQLALKEGLMVGISSGANTVAA+ LA++PENKGKLIVT+H SFGERYLSSVLFQ Sbjct: 297 DAVNMARQLALKEGLMVGISSGANTVAALRLARRPENKGKLIVTIHPSFGERYLSSVLFQ 356 Query: 361 DLRQEAENMQPVAVD 375 +LR+EAENMQPV+VD Sbjct: 357 ELRKEAENMQPVSVD 371 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32802 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2671 344 7e-97 >Vv2671 Length = 215 Score = 344 bits (882), Expect = 7e-97, Method: Compositional matrix adjust. Identities = 157/195 (80%), Positives = 180/195 (92%) Query: 15 LNERILSSLSRRSVAAHPWHDLEIGPSAPDIFNVVIEITKGSKVKYELDKKTGMIKVDRI 74 LNERILSS+SRRS+AAHPWHDLEIGP AP +FN V+EI KGSKVKYELDK +G+IKVDR+ Sbjct: 21 LNERILSSMSRRSIAAHPWHDLEIGPGAPSVFNCVVEIGKGSKVKYELDKASGLIKVDRV 80 Query: 75 LYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGVMPMIDQGEKDDK 134 LYSSVVYPHNYGFIPRT+CED+DP+DVL+LMQEPVLPG FLRARAIG+MPMIDQGEKDDK Sbjct: 81 LYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSFLRARAIGLMPMIDQGEKDDK 140 Query: 135 IIAVCADDPEYTHYTALDDLPPHRLSEIRRFFEDYKKNENKEVAVNAFLPASTALEAIQY 194 IIAVCADDPE+ HY + ++PPHRL+EIRRFFEDYKKNENKEV VN FLPA +A+EAI+Y Sbjct: 141 IIAVCADDPEFRHYKDIKEIPPHRLAEIRRFFEDYKKNENKEVNVNDFLPADSAIEAIKY 200 Query: 195 SMDLYAEYIMHTLRR 209 SMDLYA YI+ +LR+ Sbjct: 201 SMDLYASYIVESLRQ 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20614 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47095 227 1e-61 >Vv47095 Length = 204 Score = 227 bits (579), Expect = 1e-61, Method: Compositional matrix adjust. Identities = 116/165 (70%), Positives = 132/165 (80%), Gaps = 3/165 (1%) Query: 49 SHQLKLLKSTPRASSEREGVPGELIEDSKFVPLNADEMIXXXXXXXXXXXXXXXXXKIQQ 108 +H LKL + PRASSE G+P ELIEDSKFVPLN+D+ I KI+Q Sbjct: 41 AHPLKL-QHPPRASSE--GIPTELIEDSKFVPLNSDDPIYGPPALLLLGFEVEEEVKIRQ 97 Query: 109 FLKQLDGEFLKVIYCTEDMITRSLWDAMNTSQPNLEALKIAKPLPRICFFSGLSGEEMMV 168 LK+LDGEFL+VIYCTEDMITRSLW+AMNT Q NLEALKIAK LPRICF SGLSGEEMM+ Sbjct: 98 LLKELDGEFLQVIYCTEDMITRSLWEAMNTKQSNLEALKIAKALPRICFLSGLSGEEMMM 157 Query: 169 FIDSFPESGLEPAIFAALVPNSADKPLAELIEEIVGDHEMLTAKE 213 FID+FPE+GLE A+FAALVPNSADKPL ELIEEI+GDHEML+ K+ Sbjct: 158 FIDAFPETGLEAAVFAALVPNSADKPLQELIEEIMGDHEMLSGKQ 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25574 (534 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22156 (283 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3467 298 6e-83 >Vv3467 Length = 229 Score = 298 bits (764), Expect = 6e-83, Method: Compositional matrix adjust. Identities = 146/199 (73%), Positives = 165/199 (82%), Gaps = 1/199 (0%) Query: 71 CGGVGTLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLCLARKVSPVRAVLYMVAQSL 130 C VG GIAWAFGGMIF LVYCTAGISGGHINPAVTFGL LARK+S RA+ Y++ Q L Sbjct: 24 CASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAIFYIIMQCL 83 Query: 131 GAIAGVALVKAIQKSY-YTKYGGGANSLSDGYSTGVGLAAEIIGTFVLVYTVFSATDPKR 189 GAI G +VK + S Y GGGAN ++ GY+ G GL AEI+GTFVLVYTVFSATD KR Sbjct: 84 GAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDGLGAEIVGTFVLVYTVFSATDAKR 143 Query: 190 SARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGPAVIFNQDKAWDDQWIFWV 249 +ARDSHVP+LAPLPIGFAVF+VHLATIPITGTGINPARSLG A+IFN++ AWDD WIFWV Sbjct: 144 NARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNREHAWDDMWIFWV 203 Query: 250 GPFIGAAIAAFYHQFILRA 268 GPFIGAA+AA Y Q ++RA Sbjct: 204 GPFIGAALAAMYQQIVIRA 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12962 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17147 (235 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22807 (267 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5939 (292 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16336 373 e-105 >Vv16336 Length = 400 Score = 373 bits (958), Expect = e-105, Method: Compositional matrix adjust. Identities = 189/279 (67%), Positives = 210/279 (75%), Gaps = 8/279 (2%) Query: 1 MTSVCGRRRDMEDAVSIHPSFLQKENPESNGTHFYGVFDGHGCSHVALKCKDRLYEIVKQ 60 MTSV GRRRDMEDAVSIHPSF ++ G H+YGV+DGHGCSHVA+KCKDR++EI K+ Sbjct: 108 MTSVRGRRRDMEDAVSIHPSFWGQDAQNCTGLHYYGVYDGHGCSHVAMKCKDRMHEIAKE 167 Query: 61 ELETEGESVQWKDAMERSFLKMDEEVQEGNLKAQSSNCRCELQTPQCDAVGSXXXXXXXX 120 E+E G+S W+ MERSF +MD+EV E SSNCRCEL+TPQCDAVGS Sbjct: 168 EIERCGQS--WEQVMERSFSRMDKEVVEWCNGQWSSNCRCELRTPQCDAVGSTAVVAIVT 225 Query: 121 PEKIVVSNCGDSRAVLCRSGAAVPLSSDHKPDRPDELVRIEAAGGRVIYWDGARVLGVLA 180 PEK+VVSNCGDSRAVLCR+G A+PLSSDHKPDRPDEL+RI+AAGGRVIYWD RVLGVLA Sbjct: 226 PEKVVVSNCGDSRAVLCRNGVAIPLSSDHKPDRPDELLRIQAAGGRVIYWDVPRVLGVLA 285 Query: 181 MSRAIGDNYLKPYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCLRAQT 240 MSRAIGDNYLKPYVISEPEVT DR+ EDECLILASDGLWDVVSNDTACGV RMCL AQ Sbjct: 286 MSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVARMCLNAQA 345 Query: 241 AAS------QSELXXXXXXXXXXXXXXXXILLTKLALAR 273 S +LLTKLALAR Sbjct: 346 PPSPPVSPETGAGIGAGGESSDKACLDASMLLTKLALAR 384 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6728 (361 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26683 688 0.0 >Vv26683 Length = 361 Score = 688 bits (1776), Expect = 0.0, Method: Compositional matrix adjust. Identities = 333/360 (92%), Positives = 348/360 (96%) Query: 1 MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM 60 MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPEVM Sbjct: 1 MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM 60 Query: 61 MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE 120 + FLKEFE K+GI ITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE Sbjct: 61 LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPFKE 120 Query: 121 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGKVQKFVEKPKLFVGNKINAGIYLLN 180 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEES G+V +FVEKPKLFVGNKINAGIYLLN Sbjct: 121 MIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESIGRVDRFVEKPKLFVGNKINAGIYLLN 180 Query: 181 PSVLDKIELRPTSIEKEVFPKIAAENKLFAMVLPGFWMDIGQPRDYITGLRLYLDSLRKN 240 PSVLD+IELRPTSIEKEVFPKIAAE KL+AMVLPGFWMDIGQPRDYITGLRLYLDSLRK Sbjct: 181 PSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK 240 Query: 241 SSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIIESGVRLSRCTVMRGVRIKN 300 SSSKLA GAHIVGNVLVDE+AKIGEGCLIGPDVAIGPGC++E+GVRLSRCTVMRGVRIK Sbjct: 241 SSSKLASGAHIVGNVLVDESAKIGEGCLIGPDVAIGPGCVVEAGVRLSRCTVMRGVRIKK 300 Query: 301 HACISSSIIGWHSTVGQWARVENMTILGEDVHVSDEIYSNGGVVLPHKEIKSSILKPEIV 360 HACISSSIIGWHSTVGQWARVENMTILG+DVHV DEIYSNG VVLPHK+IKSSILKPEIV Sbjct: 301 HACISSSIIGWHSTVGQWARVENMTILGKDVHVCDEIYSNGSVVLPHKKIKSSILKPEIV 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27027 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29186 (153 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21228 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3449 85 1e-18 >Vv3449 Length = 162 Score = 85.1 bits (209), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 38/76 (50%), Positives = 54/76 (71%) Query: 44 KLFIGGVSYQTDDQSLREAFQKYGEVVDARIIMDRESGRSRGFGFVTFTSNXXXXXXXXX 103 + F+GG+++ TDDQSL AF ++GE+++++II DRE+GRSRGFGFVTF+S Sbjct: 9 RCFVGGLAWATDDQSLERAFSQFGEILESKIINDRETGRSRGFGFVTFSSEQSMRDAIEG 68 Query: 104 XDGQELHGRRVRVNYA 119 +GQ L GR + VN A Sbjct: 69 MNGQNLDGRNITVNEA 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6269 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4366264 155 4e-40 >Vv4366264 Length = 166 Score = 155 bits (392), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 90/143 (62%), Positives = 103/143 (72%) Query: 1 MKASKGKGPVRKDKKEVLKPVEDVKVGKRKAAIEADKSRRKLAKNAKLGKKDPNKPKRPA 60 MK +KGK RKDKKE LKPVED ++GKRKAA++ADKS +KLAK KL KKDPNKPKRP Sbjct: 1 MKVTKGKAAARKDKKEALKPVEDRRLGKRKAALKADKSTKKLAKKEKLAKKDPNKPKRPP 60 Query: 61 SAFFVFLEEFRTVYKKEHPNVKAVSAVGKAGGEKWKSMSXXXXXXXXXXXXXXXTEYEKL 120 SAFFVFLEEFR VYK+EHPNVKAVSAVGKAGGEKWKS+S ++YEKL Sbjct: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLSEADKAPYEAKAAKRKSDYEKL 120 Query: 121 MKAYNNKXXXXXXXXXXVAEKSK 143 M AYN K +++SK Sbjct: 121 MAAYNKKQESMADDDEEESDRSK 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14104 (283 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10171 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24080 (250 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49087 72 8e-15 >Vv49087 Length = 362 Score = 72.4 bits (176), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 61/204 (29%), Positives = 94/204 (46%), Gaps = 12/204 (5%) Query: 38 FKLPSIGPNDVRIRIKAVGICGSDVHYLRTMKCADFEVKEPMVIGHECAGIVDKVGSEVK 97 F + G DVR ++ GIC SD+H ++K PMV GHE G+V +VGS+V+ Sbjct: 30 FSRRATGEEDVRFKVLYCGICHSDLH---SIKNEWGNAAYPMVPGHEIVGVVTEVGSKVE 86 Query: 98 HLVPGDRVAVEPGI-SCSRCQQCKGGQYNLCPDMKFFATPPVH------GSLANQIVHPA 150 GD+V V + +C C+ C N C + P H G ++ +V P Sbjct: 87 KFKVGDKVGVGCLVGACHSCESCSDDLENYCSKLILTYNMPYHDGTRTYGGYSDTMVAPE 146 Query: 151 DLCFKLPENVSLEEGA--MCEPLSVGVHACRRANVGPETTVLIIGAGPIGLVSVLAARAF 208 ++P+N+ L GA +C ++V P + I+G G +G V+ A+AF Sbjct: 147 RYVVRIPDNMPLAAGAPLLCAGITVYSPLKYFGFTQPGMHIGIVGLGGLGHVAAKFAKAF 206 Query: 209 GAPRIVIMDMDDKRLAMAKSLGAD 232 G +I K+ + LGAD Sbjct: 207 GVKVTLISTSPSKKKEAIEHLGAD 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9795 (400 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3316 374 e-105 >Vv3316 Length = 531 Score = 374 bits (960), Expect = e-105, Method: Compositional matrix adjust. Identities = 188/398 (47%), Positives = 249/398 (62%), Gaps = 2/398 (0%) Query: 1 MRTIQGSLIVSSFLNIFIGFSKAWGNFTRFFSXXXXXXXXXXXGLGLFARGFPLLANCVE 60 MR IQG++IV+S L I +GFS W N TRF S G GL+ GFP +A CVE Sbjct: 133 MRAIQGAMIVASTLQIVLGFSGLWRNVTRFLSPLSAVPLVSLAGFGLYEFGFPGVAKCVE 192 Query: 61 IGLPMLILLVITQQYLRRALPRAHHILERFALLLCIALVWSFAAVLTEAGAYNNAKQQTK 120 IGLP LI+L++ QY+ + +I +RFA++ + +VW +A +LT GAYN A +T+ Sbjct: 193 IGLPQLIILILVSQYMPHVIHSGKNIFDRFAVIFTVVIVWIYAHLLTVGGAYNGAAPKTQ 252 Query: 121 QSCRTDRSFLISSAPWIKFPYPFQWGAPIFRASHVFGMMGAAIVTSAESTGTYFAAARLS 180 SCRTDR+ LI +APWI+ PYPFQWGAP F A F MM + V ESTG + A +R + Sbjct: 253 ASCRTDRAGLIDAAPWIRIPYPFQWGAPTFDAGEAFAMMVTSFVALVESTGAFIAVSRFA 312 Query: 181 GATPPPASVVSQSIGLQGVGMLLEGIFGAAVGTTASVENVGLLGLTHIGSRRVVQISTXX 240 AT P+S++S+ +G QG+G+LL G+FG G++ SVEN GLL LT +GSRRVVQIS Sbjct: 313 SATHLPSSILSRGVGWQGIGILLSGLFGTVNGSSVSVENAGLLALTRVGSRRVVQISAGF 372 Query: 241 XXXXXXXXXXXXXXXSIPLPIFAAMYCVLFGIVAAVGITFIQFANNNSLRNIYVLGLSLF 300 SIP PI AA+YC+ F V + G++F+QF N NS R ++LG S+F Sbjct: 373 MIFFSILGKFGAVFASIPAPIVAALYCLFFAYVGSGGLSFLQFCNLNSFRTKFILGFSIF 432 Query: 301 LGISIPQYFVSNTSPNGVGPVKTDGGWFDNILNTIFSSSPTVAIIVGTLLDNTLDAKYAV 360 +G S+PQYF T+ G GPV T G WF++++N FSS VA + LLD TL K Sbjct: 433 MGFSVPQYFNEFTAIRGYGPVHTSGRWFNDMINVPFSSEAFVAGCLAFLLDITLHRKDGS 492 Query: 361 --DDRGLAWWRPFQSRKGDARNEEFYSLPVRIREYIPT 396 DRG WW F+S K D R+EEFYSLP + +Y P+ Sbjct: 493 VRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFPS 530 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925660 (214 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8462 78 1e-16 >Vv8462 Length = 305 Score = 78.2 bits (191), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 30/59 (50%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Query: 148 VKDGYQWRKYGQKVTRDNPSPRAYYKCSFAPSCPVKKKVQKSAENPCVLVATYEGEHNH 206 ++DGY+WRKYGQK +++P PR+YY+C+ + C VKK+V++S+E+P +++ TYEG+H H Sbjct: 161 LEDGYRWRKYGQKAVKNSPFPRSYYRCTNS-KCTVKKRVERSSEDPSIVITTYEGQHCH 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14309 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6611 (285 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26640 196 5e-52 >Vv26640 Length = 292 Score = 196 bits (497), Expect = 5e-52, Method: Compositional matrix adjust. Identities = 104/234 (44%), Positives = 146/234 (62%), Gaps = 7/234 (2%) Query: 56 TDKLLVLGGNGFVGSHVCREALDRGLSVASLSRSGRSKLHDLWANSVTWHQGNLLSPESL 115 +++++VLGGNGFVGS +C+ A+ +G+ V SLSRSGR W + V W G++ + Sbjct: 58 SERVVVLGGNGFVGSAICKAAVSKGIEVTSLSRSGRPSQSSSWVDQVNWVTGDVFYV-NW 116 Query: 116 KDAFNGVTSVISCVGGFGSNSYMYKINGTANINAIRVAAEQGVKRFVYISAADFGVANYL 175 + G T+V+S +GGFGS M +ING AN+ A+ A + GV +F+ IS D+ + +L Sbjct: 117 DEVLVGATAVVSTLGGFGSEEQMKRINGEANVLAVGAAKDYGVPKFILISVHDYNLPQFL 176 Query: 176 LQ-GYYEGKRAAETELLTKFPYGGVILRPGFIYGTRSVGSLKIPLGVIGSPLEMLFQN-- 232 L GY+ GKR AE+E+L+K+P GV+LRPGFIYG R V +IPL +IG PLE + + Sbjct: 177 LDSGYFTGKRKAESEVLSKYPNSGVVLRPGFIYGKRRVDGFEIPLDLIGEPLEKILRATE 236 Query: 233 --TRPLSQLPLVGPLFTPPVNVTSVANVAVRAATDPVFPPGIVDVQGIQRYTQK 284 TRPLS LP + PPV+V VA AV A TD F GI ++ I+ K Sbjct: 237 NLTRPLSALPASDLILAPPVSVDDVALAAVNAITDDDF-FGIFTIEQIKEAAAK 289 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9638 (311 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9983 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33766 130 9e-33 >Vv33766 Length = 134 Score = 130 bits (327), Expect = 9e-33, Method: Compositional matrix adjust. Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 8/134 (5%) Query: 1 MKKVVLKLELHDEKGKKKAMRAVSGLEGLDSISMDMKDKKLTVTGDIDPVDLVGRLRKLC 60 MKKVVLKL+LHD+K K+KAM+AVS L G++SI+ DMKDKKLTV GD+DPVD+V +LRK Sbjct: 1 MKKVVLKLDLHDDKAKQKAMKAVSSLSGVNSIATDMKDKKLTVVGDVDPVDIVSKLRKGW 60 Query: 61 RTEIVSVGPA--------XXXXXXXXXXXXXXXXXXXXXXMAELIKAYQAHCPPMPAYYY 112 T+I++VGPA + EL+ AY+A+ P + YY+ Sbjct: 61 HTDILTVGPAKEEKKEDGKKDEGKKDEKKDGDKKKDTEKQIQELVDAYKAYNPHLTRYYH 120 Query: 113 VKSSEEDPNACVIC 126 V+S+EE+PNACVIC Sbjct: 121 VQSAEENPNACVIC 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18841 (355 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54620195 (55 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2940 (312 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv38760 117 3e-28 >Vv38760 Length = 149 Score = 117 bits (293), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 57/125 (45%), Positives = 83/125 (66%), Gaps = 5/125 (4%) Query: 187 LMALSGINDQDTEEH--GGNSQDTWEE-IDPDELSYEELLALGEVVGTENRGLSADTIAS 243 +M + I ++ + H +SQ W++ +DPD ++YEELL LGE VGT++RGLS + I Sbjct: 18 VMNVHAIPEECSPNHYSATSSQAIWQDNVDPDNMTYEELLDLGEAVGTQSRGLSQEHINL 77 Query: 244 LPSVSYKTGS--SQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKICPV 301 LP+ YK+G S+ S E CVIC++ ++ G+ L CKH YH++C WLTINK+CPV Sbjct: 78 LPTCRYKSGRLFSRKRSAERCVICQMGYKRGDRQIKLPCKHVYHTDCGTKWLTINKVCPV 137 Query: 302 CSAEV 306 C+ EV Sbjct: 138 CNIEV 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9199 (466 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8274 (386 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824541 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040105 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815077 (113 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15446 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3410 88 2e-19 >Vv3410 Length = 180 Score = 87.8 bits (216), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 48/146 (32%), Positives = 82/146 (56%), Gaps = 1/146 (0%) Query: 57 IAEHLSIKEVEVIKDMFTLMDTDKNGKITYEELKLGLRKVGSQLAEPEIKMLMEVADVDG 116 +A+ L+ ++ K+ F+L D D +G IT +EL +R +G E E++ ++ D DG Sbjct: 1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60 Query: 117 NGVLDYGEFAAVTIH-LQKLENDEHLHKAFVFFDKDGSGYIXXXXXXXXXXXXXXXTDIE 175 NG +D+ EF + ++ +++E L +AF FDKD +G+I E Sbjct: 61 NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 120 Query: 176 VLNDIMREVDTDKDGRISYEEFVAMM 201 +++++RE D D DG+I+YEEFV +M Sbjct: 121 EVDEMIREADVDGDGQINYEEFVKVM 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121754 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43714 224 4e-61 >Vv43714 Length = 152 Score = 224 bits (570), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 106/106 (100%), Positives = 106/106 (100%) Query: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT Sbjct: 1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60 Query: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL Sbjct: 61 EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29024 (282 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32258 (193 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746664 (63 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774769 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6115 (281 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41361 207 1e-55 >Vv41361 Length = 161 Score = 207 bits (528), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 100/159 (62%), Positives = 121/159 (76%) Query: 2 NFDHLPEDCFAHILSFTSPGDACRSSLVSSSFRATADADSVWRKFLPSDHKQILSRFVSP 61 F L DC +HILS TSP DACRS LVS++ R D+DSVW KFLPSD+++ILSR VSP Sbjct: 3 EFRALASDCISHILSCTSPRDACRSELVSTTVRHAGDSDSVWEKFLPSDYQEILSRLVSP 62 Query: 62 IAYSSSKDLFMKLCSPNLIDGGDKMFFVEKSTGKKCYMLSARDLSISWGSHPLYWTWRPC 121 + ++S K+L+ KLCSP LID G K F + K+TGKK YMLSAR+LSI+W S+ LYW+W+P Sbjct: 63 LVFASKKELYSKLCSPLLIDEGRKSFSISKTTGKKGYMLSARNLSITWSSNTLYWSWKPL 122 Query: 122 LQSRFAEVAELRTIWWLEICGTTNTQMLSQKTVYGAYLI 160 LQSRFAE ELRTI WLEI G +T +LS KT Y AYLI Sbjct: 123 LQSRFAETVELRTICWLEIQGKISTSVLSPKTTYRAYLI 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4754 (82 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10827 (320 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56337 209 7e-56 >Vv56337 Length = 311 Score = 209 bits (531), Expect = 7e-56, Method: Compositional matrix adjust. Identities = 111/229 (48%), Positives = 145/229 (63%), Gaps = 41/229 (17%) Query: 116 NEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPESYVQRGDQASIIGGAINFVKELEQ 175 N+EE E QRMTHIAVERNRR+QMNE+L++LRS+MPESYVQRGDQASI+GGAI FVKELE Sbjct: 91 NKEEAETQRMTHIAVERNRRRQMNEHLAILRSLMPESYVQRGDQASIVGGAIEFVKELEH 150 Query: 176 EVQFLGVQKPNNC-----------------------------APFSEFFTFPQYSTRSTS 206 +Q L +K PFS+FF +PQY+ Sbjct: 151 LLQSLEARKHKMLQGVRENVDDSSSSSSSSTGTGITANKFMPPPFSQFFVYPQYTWSQMP 210 Query: 207 DHESTVAAMAELPLLECRSSNIAADIEVTMVESHASLKVRSKRLPKQLLKIVSGLHDMHL 266 + ++ +S ADIEVT++E+HA+L++ S + P+ L K+V+G ++L Sbjct: 211 NKYTS------------KSKAAVADIEVTLIETHANLRILSHKSPRLLSKMVTGFQTLYL 258 Query: 267 TVLHLNVVTADDIVLYSLSLKVEDECMLTSVDEIATAVHEMLARIQEEA 315 T+LHLNV T D +VLYS+S KVE+ C LTSVD+IA AVH ML I+EEA Sbjct: 259 TILHLNVTTVDPLVLYSISAKVEEGCQLTSVDDIAGAVHHMLRIIEEEA 307 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4986 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3379 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286303 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25772 (267 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33590 343 2e-96 >Vv33590 Length = 198 Score = 343 bits (881), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 161/185 (87%), Positives = 176/185 (95%) Query: 1 MEGSANERLDFGKMGYGCKHYRRRCQIRAPCCNEIHPCRHCHNEATSMLSNPFDRHELVR 60 MEGSANERLDFGKMG+GCKHYRRRC+IRAPCCNEI PCRHCHNEATSML NPFDRHELVR Sbjct: 1 MEGSANERLDFGKMGFGCKHYRRRCRIRAPCCNEIFPCRHCHNEATSMLRNPFDRHELVR 60 Query: 61 YDVKQVVCSVCDTEQPVAKVCTNCGISMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGG 120 +DVKQV+C+VCDTEQPVA+VCTNCG++MGEYFC++CKFYDDDTTK QFHC+DCGIC +GG Sbjct: 61 HDVKQVICAVCDTEQPVAQVCTNCGVNMGEYFCEVCKFYDDDTTKGQFHCDDCGICIVGG 120 Query: 121 RDKFFHCKKCGSCYSIRLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHREC 180 RDKFFHCKKCG CYS+ LRDNH CVENSMRHHCPICYE+LFDSLKDTTVM CGHTMH EC Sbjct: 121 RDKFFHCKKCGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCGHTMHCEC 180 Query: 181 YNEMM 185 YNEM+ Sbjct: 181 YNEMI 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8555 (367 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6266261 416 e-118 >Vv6266261 Length = 425 Score = 416 bits (1068), Expect = e-118, Method: Compositional matrix adjust. Identities = 217/400 (54%), Positives = 283/400 (70%), Gaps = 33/400 (8%) Query: 1 MSIRSIIQDMKFSRSQRVVQDSAARPGGQAVGES-------------LKQSCWAQMPQEL 47 MS RSI++D++ + R G G+S ++ S WA +P EL Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSHGSVHELQDQPLVVQNSRWAGLPPEL 60 Query: 48 LREVLVRIEASEAAWPPRKSVVACAGVCRSWRHLTKEIVKAPELSGKLTFPISVKQPGPR 107 LR+V+ R+EASE+ WP RK VVACA VCRSWR + KEIVK+PE SGKLTFPIS+KQPGPR Sbjct: 61 LRDVIKRLEASESTWPSRKHVVACAAVCRSWREMCKEIVKSPEFSGKLTFPISLKQPGPR 120 Query: 108 DDLVQCFIKRNRSDQTYYLFLGLTPA-LIDEGKFLLAARKFKRPTCTDYVISLYADDMSK 166 D ++QCFIKR++S+ TY+LFL L+PA L++ GKFLL+A++ +R TCT+YVIS+ AD++S+ Sbjct: 121 DGIIQCFIKRDKSNLTYHLFLCLSPALLVENGKFLLSAKRNRRTTCTEYVISMDADNISR 180 Query: 167 GSSYYVGKLRSNFLGTKFTIFDGQPSHSGAKIA-KSRSTRLVNLKQVSPRVPAGNYPVAQ 225 SS Y+GKLRSNFLGTKF I+D QP ++G++++ R++R K+VSP+VP G+Y +AQ Sbjct: 181 SSSTYIGKLRSNFLGTKFIIYDTQPPYNGSQLSPPGRTSRRFYSKKVSPKVPTGSYNIAQ 240 Query: 226 IQYELNMLGSRGPRRMQCTMDSIPSSSIEPGGVAPTQAEFSHSNAE-LFPSLSFNRSKSN 284 + YELN+LG+RGPRRM CTM SIP+SS+EPGG P QAE N E F S+SF++S N Sbjct: 241 VTYELNVLGTRGPRRMHCTMHSIPASSLEPGGTVPGQAELLPRNLEDSFRSISFSKSIDN 300 Query: 285 RME------SFLSGPLARQ---KDGVLVLRNKSPRWHEQLQCWCLNFHGRVTVASLKNFQ 335 E S + GP + KD LVLRNK PRWHEQLQCWCLNF GRVTVAS+KNFQ Sbjct: 301 STEFSSSRFSDIIGPRDEEDEGKDRPLVLRNKPPRWHEQLQCWCLNFRGRVTVASVKNFQ 360 Query: 336 LVAS--PENGPPEP------EHEKIIPQFGKMEQDQFIME 367 L+A+ P G P P +H+KII QFGK+ +D F M+ Sbjct: 361 LIAATQPAAGAPTPSQPPASDHDKIILQFGKVGKDMFTMD 400 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48121400 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20782 (358 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv351 77 4e-16 >Vv351 Length = 286 Score = 77.4 bits (189), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 73/261 (27%), Positives = 112/261 (42%), Gaps = 24/261 (9%) Query: 108 DISALSKVQFS--DLDWRTILYSTDCSEIGLACLRDSEKLLSLKRFSKQKVRRMGKEAQV 165 D+ A+ K +++ D D L + LA + S +++LK K ++++ E Q+ Sbjct: 9 DVPAVEKKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQL 68 Query: 166 LREKDLIKSMSSSACVPQFMCTCVDQTHA---------GILYNTCLACPLASILRTPLDE 216 RE + I+S + + DQ G LY C S E Sbjct: 69 RREVE-IQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFS-------E 120 Query: 217 PSAKFCAASLVAGLADLHKNDVLYRGLSPDVLMLDQTGYLQLVDFRFGKKLSGERTYTIC 276 A ASL L H V++R + P+ L++ G L++ DF + R T+C Sbjct: 121 RRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRR-TMC 179 Query: 277 GMVDLLAPEVVHGKGHGFPADWWALGVLIYFMLQGEMPFGSWRQSELDTFAKIAKGQLTL 336 G +D L PE+V H D W+LGVL Y L G PF + S DT+ +I + L Sbjct: 180 GTLDYLPPEMVESVEHDASVDIWSLGVLCYEFLYGVPPFEAKEHS--DTYRRIVQVDLKF 237 Query: 337 P--QTFRPEAADLITKILEVD 355 P A DLI+++L D Sbjct: 238 PPKPIVSSTAKDLISQMLVKD 258 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808433 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6029 (375 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17966265 422 e-120 >Vv17966265 Length = 389 Score = 422 bits (1086), Expect = e-120, Method: Compositional matrix adjust. Identities = 227/395 (57%), Positives = 262/395 (66%), Gaps = 26/395 (6%) Query: 1 MENNNQSFWQFSDQLRVQGSNFANLNINDSIWSNSYSKRPDERRNFDIKVGGEVSPIVNL 60 ME N QSFWQFSDQLRVQ SN ANL++N+SIWS+ Y+KR DERRNFDI+VGGE++P +L Sbjct: 1 MEGNQQSFWQFSDQLRVQTSNLANLSLNESIWSSPYTKRQDERRNFDIRVGGEINPGSSL 60 Query: 61 TPKGSDFNGFNDSWV-------DNLKPK-----AAFSDANGSSNDGWNSFKPKASELNSG 108 KG DFNG D V +LK K + G + +S K K S+ N G Sbjct: 61 KQKGLDFNGGYDMRVGGEINSGSSLKQKVLDFNGGYEMRVGGEINSGSSLKQKGSDFNGG 120 Query: 109 FND------NRWNSFKPKASDFNNSFNDGWKLGGAAV--SQNTTVGLNGGFNKGIYSKPA 160 + N N + K +D+N FN GWK+G + + VG+NGGFNKG+YSKP Sbjct: 121 YEMMVGREMNSVNDLRQKGNDYN-GFNGGWKIGVSPFMGGAQSNVGVNGGFNKGVYSKPG 179 Query: 161 IHXXXXXXXXXAMNLKPYKNKAHEDDQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 220 + N N ED+ Sbjct: 180 NYVNSNINVKNGNNKN--GNFKGEDEHGVKVGKKNKGNKNNNNNNNNDGDNNSNGTKTA- 236 Query: 221 XXVDKRFKTLPPAESLPRNETIGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGL 280 DKRFKTLPP+ESLPRNET+GGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGL Sbjct: 237 --ADKRFKTLPPSESLPRNETVGGYIFVCNNDTMQENLKRQLFGLPPRYRDSVRAITPGL 294 Query: 281 PLFLYNYSTHQLHGIFEAASFGGTNFDPSAWEDKKCPGESRFPAQVRVFTRKVCEPLEED 340 PLFLYNYSTHQLHG+FEAASFGGTN DP+AWEDKKCPGESRFPAQVRV TRK+CEP+EED Sbjct: 295 PLFLYNYSTHQLHGVFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEPMEED 354 Query: 341 SFRPILHHYDGPKFRLELSVPEALSLLDIFADQNP 375 SFRP+LHHYDGPKFRLEL+VPEALSLLDIF ++ P Sbjct: 355 SFRPVLHHYDGPKFRLELNVPEALSLLDIFNEKTP 389 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20067 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48488286 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7228 (400 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22766257 91 4e-20 >Vv22766257 Length = 356 Score = 90.9 bits (224), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 60/197 (30%), Positives = 98/197 (49%), Gaps = 3/197 (1%) Query: 142 RFSGQIPETLRDLTALQELDLSNNDFSGSFPTVTLQIPNLIYLDLRYNSYSGTIPGELFN 201 + +G IP + L L L++++N SG P + + +L++LDLR N +G IP + Sbjct: 138 KITGVIPADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGK 197 Query: 202 -QKLDAIFLNNNNFEGEIPESL-GNSQASVINFANNQFTGNLPASFGFMGTKLKEILFLN 259 L L N G IP S+ G + + + + NQ +G +PA G M L + + Sbjct: 198 LTMLSRAMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPV-LSTLNLDS 256 Query: 260 NRLTGCIPEGVGIFTDVKVFDASHNSLMGHLPDTISCLEEIEVLNLAHNELSGVLPDLVC 319 NRL+G IP + T + + + S NSL G LPD L+L++N L G +P + Sbjct: 257 NRLSGSIPASLLSNTGLNILNLSRNSLEGKLPDVFGSKTYFIGLDLSYNNLKGQIPKSLS 316 Query: 320 SLKSLENLTVAYNFFSG 336 S + +L +++N G Sbjct: 317 SAAYIGHLDLSHNHLCG 333 Score = 85.9 bits (211), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 78/281 (27%), Positives = 125/281 (44%), Gaps = 23/281 (8%) Query: 70 ALQAWKSAISDDPSKILDSWVGPNVCS-YKGVFCSPDSQEVTGIDLNHANLKGXXXXXXX 128 AL +K+A+++ I SW G + CS + G+ C + + NL+G Sbjct: 28 ALLDFKAALNEPYLGIFKSWSGNDCCSSWFGISCDSAGR------VADINLRGESEDPIF 81 Query: 129 XXXXXXXXXXXXXRFSGQIPETLRDLTALQELDLSN-NDFSGSFPTVTLQIPNLIYLDLR 187 +G I ++ L +L L +++ SG P + L LDL Sbjct: 82 ERAGRSGY------MTGAISPSICKLDSLTTLIIADWKGISGEIPPCISSLSKLRILDLV 135 Query: 188 YNSYSGTIPGELFN-QKLDAIFLNNNNFEGEIPESLGNSQASV-INFANNQFTGNLPASF 245 N +G IP ++ Q+L + + +N+ G IP S+ N + + ++ NNQ TG +P F Sbjct: 136 GNKITGVIPADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDF 195 Query: 246 GFMGTKLKEILFLNNRLTGCIPEGVGIFTDVKVFDASHNSLMGHLPDTISCLEEIEVLNL 305 G + T L + N+LTG IP + + FD S N + G +P + + + LNL Sbjct: 196 GKL-TMLSRAMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNL 254 Query: 306 AHNELSGVLPDLVCSLKSLENLTVAYNFFSGFSQECTKLPD 346 N LSG +P + S L L ++ N G KLPD Sbjct: 255 DSNRLSGSIPASLLSNTGLNILNLSRNSLEG------KLPD 289 Score = 80.9 bits (198), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 58/175 (33%), Positives = 87/175 (49%), Gaps = 3/175 (1%) Query: 143 FSGQIPETLRDLTALQELDLSNNDFSGSFPTVTLQIPNLIYLDLRYNSYSGTIPGELFN- 201 SG IP ++ +L +L LDL NN +G P ++ L L N +GTIP + Sbjct: 163 ISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGKLTMLSRAMLGRNQLTGTIPSSISGL 222 Query: 202 QKLDAIFLNNNNFEGEIPESLGNSQA-SVINFANNQFTGNLPASFGFMGTKLKEILFLNN 260 +L L+ N G IP LG+ S +N +N+ +G++PAS T L + N Sbjct: 223 YRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRLSGSIPASL-LSNTGLNILNLSRN 281 Query: 261 RLTGCIPEGVGIFTDVKVFDASHNSLMGHLPDTISCLEEIEVLNLAHNELSGVLP 315 L G +P+ G T D S+N+L G +P ++S I L+L+HN L G +P Sbjct: 282 SLEGKLPDVFGSKTYFIGLDLSYNNLKGQIPKSLSSAAYIGHLDLSHNHLCGSIP 336 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31538 (359 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv273 65 1e-12 >Vv273 Length = 153 Score = 65.5 bits (158), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 25/31 (80%), Positives = 27/31 (87%) Query: 209 RVCSDCNTTKTPLWRSGPRGPKSLCNACGIR 239 + C+DC TTKTPLWR GP GPKSLCNACGIR Sbjct: 34 KTCADCGTTKTPLWRGGPAGPKSLCNACGIR 64 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31941 (280 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13566256 93 5e-21 >Vv13566256 Length = 272 Score = 93.2 bits (230), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 43/84 (51%), Positives = 58/84 (69%) Query: 190 DGNINXXXXXXXXXXXXHRKEIEDTMEIVREEMKLLAEVDQPGSLIDNYVTQLSFVLSRK 249 D ++N HRK++E+TM IVREEM LL E DQPG+ +D+YV++L +LS+K Sbjct: 183 DDDLNALLQEEEDLVNAHRKQVEETMNIVREEMNLLVEADQPGNQLDDYVSRLKSILSQK 242 Query: 250 AAGLVSLQARLARFQHRLKEQEIL 273 AAG++ LQA LA FQ RLKE +L Sbjct: 243 AAGIMQLQAHLAHFQKRLKEHNVL 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489292 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226785200 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29065 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859309 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71818683 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21408 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57583 144 1e-36 >Vv57583 Length = 212 Score = 144 bits (362), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 70/96 (72%), Positives = 82/96 (85%), Gaps = 2/96 (2%) Query: 76 RDQDIGSRSNEDASATGASMFGSDEEGGTQIPTQAQSVVEGSGAVMVSEYRPVDDVDYLQ 135 +DQD GS +E+ + +F SDEE +Q+PTQAQS+VEGSGAV+VSE++PV DVDYLQ Sbjct: 2 KDQDGGSWRDEEENP--GRIFCSDEEVASQVPTQAQSLVEGSGAVLVSEFKPVPDVDYLQ 59 Query: 136 ELLAIQQQGPRAIGFFGTRNMGFMHQELVEILSYAM 171 ELLAIQQQGPRAIGFFGTRNMGF HQEL+EILSYAM Sbjct: 60 ELLAIQQQGPRAIGFFGTRNMGFTHQELIEILSYAM 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26510 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58683 157 1e-40 >Vv58683 Length = 247 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 75/110 (68%), Positives = 89/110 (80%), Gaps = 3/110 (2%) Query: 1 MTPANLAGQFGDTTYTKVFVGGLAWETQKETMKKYFEQFGDILEAVVITDKATGRSKGYG 60 MT +N GQFGDTT TKVFVGGLAWET KE M+ +FE++G+ILEAV+I+DK TGRSKGYG Sbjct: 1 MTMSNAIGQFGDTTLTKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYG 60 Query: 61 FVTFREAEAAMRACVDAAPVIDGRRANCNLASLGVQRSK---PSTPKHGG 107 FVTF+E EAA +AC D P+I+GRRANCNLASLG +R + STP H G Sbjct: 61 FVTFKEPEAAKKACEDTTPMINGRRANCNLASLGARRPRSAASSTPPHQG 110 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32071 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32041 233 2e-63 >Vv32041 Length = 333 Score = 233 bits (595), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 114/173 (65%), Positives = 127/173 (73%), Gaps = 7/173 (4%) Query: 4 GGDEXXXXXXLELPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIREIDLYKFDPWQLPE 63 G E L LPPGFRF+PTDEEL+ YLCRK A Q ++ II EIDLYKFDPW LP Sbjct: 2 GVPETDPLSQLSLPPGFRFYPTDEELLVQYLCRKVAGQGFSLEIIGEIDLYKFDPWVLPS 61 Query: 64 MALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKHI-GKPKALGIKKALVFYA 122 A++GEKEWYFFSPRDRKYPNGSRPNR AG+GYWKATG DK I + + +GIKKALVFY Sbjct: 62 KAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFYI 121 Query: 123 GKAPKGIKTNWIMHEYRLANVDRSAAAAKKNQNLRLDDWVLCRIYNKKGSIEK 175 GKAPKG KTNWIMHEYRL R KN + +LDDWVLCRIY K + K Sbjct: 122 GKAPKGTKTNWIMHEYRLLENSR------KNGSSKLDDWVLCRIYKKNSNSSK 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3455 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226808946 (145 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9602 (808 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12739 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2737 326 1e-91 >Vv2737 Length = 169 Score = 326 bits (836), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 157/169 (92%), Positives = 165/169 (97%) Query: 1 MSNSLRLYLACIRNTLDAAMCLQNFPCQEVERHNKPEVELKTSSELLLNPVLICRNEAEK 60 M+N+ RLY CIRNTL+AAMCLQNFPCQEVERHNKPEVELKTS E+LLNPVLICRNEAEK Sbjct: 1 MANTSRLYFTCIRNTLEAAMCLQNFPCQEVERHNKPEVELKTSPEVLLNPVLICRNEAEK 60 Query: 61 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLVTN 120 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFL+TN Sbjct: 61 CLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITN 120 Query: 121 YHCEEMQKHKLIDFIVQFMEDIDKEISELKMSVNTRGRLVATEFLKQFM 169 YHCE+MQKHKLIDFIVQFMEDIDKEISELK+SVNTRGRLVATEFLKQF+ Sbjct: 121 YHCEDMQKHKLIDFIVQFMEDIDKEISELKLSVNTRGRLVATEFLKQFI 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6823 (225 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19045 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18573 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12900 (322 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799534 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28541 (531 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3666261 660 0.0 >Vv3666261 Length = 382 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 302/382 (79%), Positives = 350/382 (91%) Query: 150 MSLAPKDEHEAQVQFALERGIPAISAVMGTKRLPFPGQVFDVVHCARCRVPWHIEGGKLL 209 MS APKDEHEAQVQFALERGIPAISAVMGT RLPFP +VFDVVHCARCRVPWHIEGGKLL Sbjct: 1 MSFAPKDEHEAQVQFALERGIPAISAVMGTTRLPFPSRVFDVVHCARCRVPWHIEGGKLL 60 Query: 210 LELNRVLRPGGFFVWSATPVYKKLGEDVEIWNAMKELTKSICWELVSITKDTVNGVGIAI 269 LELNRVLRPGG+FVWSATPVY+K+ EDV IWNAM E+TK ICW+LV+++KD++NG+G AI Sbjct: 61 LELNRVLRPGGYFVWSATPVYRKVPEDVGIWNAMSEITKKICWDLVAMSKDSLNGIGAAI 120 Query: 270 YKKPTSNECYEKRSQNEPPICAKSDDPNAAWNVPLQSCIHKVPVNATKRGSEWPEQWPVR 329 Y+KPTSNECYEKR +NEPP+C +SD+ +AAWN+PLQ+C+HKVPV ++RGS+WPEQWP+R Sbjct: 121 YRKPTSNECYEKRLRNEPPLCEESDNADAAWNIPLQACMHKVPVLTSERGSQWPEQWPLR 180 Query: 330 LDKAPYWLLSSQVGVYGKPAPEDFTSDNEHWKRVVTKSYLNGMGINWKSVRNVMDMRAVY 389 ++KAP WL SSQVGVYGK APEDFTSD EHWK VV+ SYL GMGI W SVRNVMDM+AVY Sbjct: 181 VEKAPNWLKSSQVGVYGKAAPEDFTSDYEHWKTVVSSSYLKGMGIKWSSVRNVMDMKAVY 240 Query: 390 GGFAAALKDLKIWVMNVVSVDSPDTLPIIYERGLFGMYHDWCESFNTYPRSYDLLHADHL 449 GGFAAALKDLK+WVMNVV ++SPDTLPII+ERGLFG+YHDWCESF+TYPRSYDL+HADHL Sbjct: 241 GGFAAALKDLKVWVMNVVPINSPDTLPIIFERGLFGIYHDWCESFSTYPRSYDLVHADHL 300 Query: 450 FSKLKKRCNLVAVVAEVDRILRPEGKLIVRDDVETIYELENMARSMQWEVSLTYSKDKEG 509 FS LKKRC L AV+AEVDRILRPEG LIVRD+VET+ E+E+MA+S+QWEV LTYSKDKEG Sbjct: 301 FSDLKKRCQLTAVIAEVDRILRPEGMLIVRDNVETVSEVESMAKSLQWEVRLTYSKDKEG 360 Query: 510 LLCVQKSMWRPKESETLKYAIA 531 LLCV+K+ WRP E++T+K AIA Sbjct: 361 LLCVKKTFWRPTETQTIKSAIA 382 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28491 (278 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12502 127 3e-31 >Vv12502 Length = 228 Score = 127 bits (318), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 60/79 (75%), Positives = 71/79 (89%) Query: 55 KKRRLSSEQVKALERSFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLER 114 KKRRL++ QV+ LER+FEVENKLEPERK +LA+ELGLQPRQVAIWFQNRRAR+KTKQLE+ Sbjct: 86 KKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWFQNRRARFKTKQLEK 145 Query: 115 DYSALKADYDGLKHNYDSL 133 DY +LKA YD LK +YD + Sbjct: 146 DYDSLKASYDSLKADYDCI 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19141 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3819 (362 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13719 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32118 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5558 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8275 (380 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6548 (451 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16354 660 0.0 >Vv16354 Length = 432 Score = 660 bits (1704), Expect = 0.0, Method: Compositional matrix adjust. Identities = 329/411 (80%), Positives = 355/411 (86%), Gaps = 7/411 (1%) Query: 43 NSRFVGPKESISSKNSSIAERFEEALNEHAVDNPDEIASMVDMSIRNSTERRNLGFFSCA 102 N R G ++ SS NSS+A R NEHAVD+PD +ASMVDMSIRNSTERR LG+FSC Sbjct: 27 NDRNGGTEQLQSSNNSSMAAR-----NEHAVDDPDAVASMVDMSIRNSTERRKLGYFSCG 81 Query: 103 TGNPIDDCWRCDPHWQLHRKRLANCGIGFGRNAVGGRDGKYYXXXXXXXXXXXXXRAGTL 162 TGNPIDDCWRCD +WQ +RKRLA+CGIGFGRNA+GGRDG++Y + GTL Sbjct: 82 TGNPIDDCWRCDHNWQKNRKRLADCGIGFGRNAIGGRDGRFYVVTDPGDDDPVNPKPGTL 141 Query: 163 RHAVIQDRPLWIVFKRDMVITLKQELIMNSFKTIDARGVNVHIAYGACITIQYVTNVIIH 222 RHAVIQD PLWIVFKRDMVITLKQELIMNSFKTID RGVNVHIA GACIT+Q+VTNVIIH Sbjct: 142 RHAVIQDAPLWIVFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACITVQFVTNVIIH 201 Query: 223 GLHIHDCKPTGNAMVRSSPNHYGWRTMADGDAISIFGSSHIWIDHNSFSKCADGLVDAIM 282 GLHIHDCKPTGNAMVRSSP+H+GWRTMADGDAISIFGSSHIW+DHNS S CADGLVDA+M Sbjct: 202 GLHIHDCKPTGNAMVRSSPSHFGWRTMADGDAISIFGSSHIWVDHNSLSSCADGLVDAVM 261 Query: 283 GSTALTISNNYFTHHNEVMLLGHSDSYVRDKLMQVTIAYNHFGEGLIQRMPRCRHGYFHV 342 GSTA+TISNN+F HHNEVMLLGHSDSY RDK MQVTIAYNHFGEGLIQRMPRCRHGYFHV Sbjct: 262 GSTAITISNNHFAHHNEVMLLGHSDSYERDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHV 321 Query: 343 VNNDYTHWEMYAIGGSAEPTINSQGNRYLAPNNGFAKEVTHRVN--PNDWKHWNWRSEGD 400 VNNDYTHWEMYAIGGSA PTINSQGNRYLAP N FAKEVT RV+ WK WNWRSEGD Sbjct: 322 VNNDYTHWEMYAIGGSASPTINSQGNRYLAPVNPFAKEVTKRVDTPSGQWKGWNWRSEGD 381 Query: 401 LLLNGAYFIASGTGSGASYARASSLGAKSSSMVGSITASAGVLNCRRGFQC 451 LLLNGAYF SG G+ ASYARASSLGAKSSSMVGSIT++AG L+CRRG QC Sbjct: 382 LLLNGAYFTPSGAGASASYARASSLGAKSSSMVGSITSNAGALSCRRGSQC 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27547 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15188 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71826098 (125 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3518 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486536 (83 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25668 (535 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226742903 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6266260 312 3e-87 >Vv6266260 Length = 394 Score = 312 bits (799), Expect = 3e-87, Method: Compositional matrix adjust. Identities = 156/174 (89%), Positives = 156/174 (89%) Query: 19 EIVDLCLDRIRKLAYNCTGLQGFLVFNAVXXXXXXXXXXXXXXXXXVDYGKKSKLGFTVY 78 EIVDLCLDRIRKLA NCTGLQGFLVFNAV VDYGKKSKLGFTVY Sbjct: 57 EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY 116 Query: 79 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 138 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS Sbjct: 117 PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVS 176 Query: 139 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 192 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL Sbjct: 177 QVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQL 230 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2543 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv64741 339 2e-95 >Vv64741 Length = 200 Score = 339 bits (869), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 162/199 (81%), Positives = 173/199 (86%) Query: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVTGKFLEYQESTIGAAFFTQVLSLNEATIK 60 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFV G+F ++QESTIGAAFFTQVLSLNEATIK Sbjct: 1 MARTGNKNIQAKLVLLGDMGTGKTSLVLRFVKGQFYDFQESTIGAAFFTQVLSLNEATIK 60 Query: 61 FDIWDTAGQERYHSLAPMYYRGXXXXXXXYDITSMDSFLRAKKWVLEVQRQANPTLIMFL 120 FDIWDTAGQERYHSLAPMYYRG YDITSMDSF RAKKWV E+QRQ NP L+M L Sbjct: 61 FDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLLMIL 120 Query: 121 AGNKADLEDKRKVGSEEGEQYAKENGLVFLETSAKTAQNVNELFYEIAKKLAKASPSRQS 180 NKADLE KR+V +E+GEQYAKENGL+F ETSAKTAQNVNELFYEIAKKLAKA PSR Sbjct: 121 VANKADLETKREVENEKGEQYAKENGLLFFETSAKTAQNVNELFYEIAKKLAKACPSRPG 180 Query: 181 GIKLHSRSPQNSRRMFCCS 199 GIKLH RS + RR+FCCS Sbjct: 181 GIKLHRRSQERGRRLFCCS 199 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1247 (240 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29234 (344 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761285 (46 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10798 62 2e-12 >Vv10798 Length = 267 Score = 62.0 bits (149), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 28/40 (70%), Positives = 32/40 (80%) Query: 1 VERNEKFILEPPAYNMTPIRVPENSVFVMGDNRNNSYDSH 40 V + E FILEP AYNM P+ VPE VFV+GDNRNNS+DSH Sbjct: 187 VAQEEDFILEPLAYNMDPVLVPEGYVFVLGDNRNNSFDSH 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4244 (308 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6365 (256 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv52045 447 e-128 >Vv52045 Length = 256 Score = 447 bits (1150), Expect = e-128, Method: Compositional matrix adjust. Identities = 216/257 (84%), Positives = 235/257 (91%), Gaps = 2/257 (0%) Query: 1 MSFTGPSVGSGGRTARRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWSQLLESLPLP 60 MSFTGPSV SGGRT +RAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSW QLLE+LPLP Sbjct: 1 MSFTGPSV-SGGRTVKRAFEFGRTYVVRPKGKHQATVVWLHGLGDNGSSWFQLLETLPLP 59 Query: 61 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDVEGLDASAAHVANLLSTEPDDI 120 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDD+EGLDASAAHVANLLSTEP DI Sbjct: 60 NIKWICPTAPTQPISIFGGFPSTAWFDVGELSEDAPDDLEGLDASAAHVANLLSTEPADI 119 Query: 121 KLGIGGFSMGAATALYSATCFSTRKYGNGNQYPCNLSAVVGLSGWLPCSKTLSKKLE-VD 179 KLG+GGFSMGAA ALYSATCF+ KY NGN YP NLSAVVGLSGWLPC+KTL KLE V+ Sbjct: 120 KLGVGGFSMGAAIALYSATCFALGKYENGNLYPSNLSAVVGLSGWLPCAKTLGNKLERVE 179 Query: 180 EAARRAASIPLLLCHGKSDDVVPYKFGEKSSQTLSSTGFQNVTFKSYNGLGHYTIPEEMD 239 EAARR AS+P+LLCHG+ DDVVP+KFGEKSS+ L+S GF+++ FK Y+GLGHYTIPEEMD Sbjct: 180 EAARRIASLPILLCHGRGDDVVPFKFGEKSSKALTSAGFRDLMFKEYDGLGHYTIPEEMD 239 Query: 240 EVCAWLRSKLGLDGTSS 256 EVC+WL SKL L+G SS Sbjct: 240 EVCSWLTSKLALEGCSS 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22441 (367 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26272 436 e-124 >Vv26272 Length = 357 Score = 436 bits (1122), Expect = e-124, Method: Compositional matrix adjust. Identities = 223/367 (60%), Positives = 262/367 (71%), Gaps = 10/367 (2%) Query: 1 MDGNKDDALKCFRIGKDALEAGDRSRAVKFLTKARRLDPALPIDDLLSSIDGNSNPQSGS 60 MDGNKD+ALKC +IGKDALEAGDR+RA+KF+TKARRLDP LP+DDLLS+I+ + QS + Sbjct: 1 MDGNKDEALKCLKIGKDALEAGDRARALKFVTKARRLDPNLPVDDLLSAIERETG-QSET 59 Query: 61 DADGSANGPSGLGSAKPFDQPSLRQRXXXXXXXXXXXXXXXXXXEEQIAMVRQLKKKKDY 120 A G+ + S K D PS+R R EEQI++VRQ+KKKKDY Sbjct: 60 PAGGANDEAS-----KASDHPSVRHRVPSSGSSASSSSSSVAYTEEQISIVRQVKKKKDY 114 Query: 121 YEILGVERSCTVEDVRKAYRKLSLKVHPDKNKAPGAEEAFKSVSKAFQCLSNQESRKKYD 180 YE+LG+E+SCTVED+RKAYRKLSLKVHPDKNKAPGAEEAFK+VSKAFQCLSN+ESRKKYD Sbjct: 115 YEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNEESRKKYD 174 Query: 181 VMGSDEPVYERRATXXXXXXXXXXXXXYDADVDAEEIFRNFFFGGGMAPATQFRGFSFGH 240 ++GSDEPVYER YD DVDAEEIFRNFFFGG TQFRGF+FG Sbjct: 175 LVGSDEPVYERHPA---TRRANGFNGFYDGDVDAEEIFRNFFFGGMPQATTQFRGFAFGP 231 Query: 241 NXXXXXXXXXXXXXSHIRTXXXXXXXXXXXXXNFMPSSEPIYALSRSYPYEYRITTEKGV 300 +IR NF+PSSEP+YA +RSYPYEYR T+KGV Sbjct: 232 GMGTRTGNNDSGGF-NIRALIQLLPVLIILLLNFLPSSEPMYAFARSYPYEYRFVTQKGV 290 Query: 301 NFYVKSTKFEQEFPPGTSERVNLEHRVEREFFNILSQNCRLEMQRRQWGFIRETPHCDML 360 N+YVKSTKFEQ++P + ERV E RVERE+F +LSQNCR E+QR QWGFIRETPHCDML Sbjct: 291 NYYVKSTKFEQDYPSNSHERVAFEARVEREYFALLSQNCRHELQRLQWGFIRETPHCDML 350 Query: 361 QKFETAA 367 ++FE A Sbjct: 351 KQFEAVA 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5233 (79 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7103 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6932 (244 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14854 134 2e-33 >Vv14854 Length = 195 Score = 134 bits (337), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 66/185 (35%), Positives = 103/185 (55%), Gaps = 1/185 (0%) Query: 24 CNYIRR-FILLKEGYNDTLSFPYHTEIPRVLLFGFIGFTCSXXXXXXXXXXXXXXXXAYF 82 C+ IR+ F+ ++ + S PYH EIP++L FG +G T Y Sbjct: 1 CSLIRKPFVKSEDDDIEVPSIPYHKEIPKILFFGLLGITYFFLAPLILPFLLVYLCLGYI 60 Query: 83 IYRNQILNVYIAEYESGGQFWPMIHNTVIISLLMMQIIALGVFGLRRTPIASGXXXXXXX 142 I+RNQ LNVY +YE+ G+FWP++HN++I SL++M IA+G+F +++ IAS Sbjct: 61 IFRNQFLNVYAPKYETAGKFWPIVHNSMIFSLVLMHAIAIGIFTVKKLSIASTLIFPLPV 120 Query: 143 XXXXXNEYCRQQFKPVFKNHVAEILIDMDQKDEQSGRMEEAYQQLHSAYCQAPITPDDSC 202 NEYCR++F P+F + AE LI D++D+ M+E + +L +AY + P Sbjct: 121 LTLLFNEYCRKRFLPIFIAYSAESLIKRDRQDQNEPSMDEFFHELVTAYQDPALAPIQYS 180 Query: 203 SSGGS 207 S+ S Sbjct: 181 SNRDS 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3765 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6950 (358 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19889 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23566259 72 9e-15 >Vv23566259 Length = 399 Score = 71.6 bits (174), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 54/195 (27%), Positives = 92/195 (47%), Gaps = 2/195 (1%) Query: 1 MPICDVIKSSSQGQVSACGKLEAGALRSGFKVLVMPSGESGTVRLLERDSQACAIARAGD 60 +P+ DV K G V G++E G L+ G V PSG + V+ +E ++ A GD Sbjct: 188 LPLQDVYKIGGIGTV-PVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGD 246 Query: 61 NVAVTLQGIDGGRVMAGGVLCH-PSFPVAVAKHLELKVLVLDVTTPILIGSQLEFHIHHA 119 NV ++ + + G V + P A + +V++++ I G H + Sbjct: 247 NVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTS 306 Query: 120 KEAARVVKISSLLDPKTGKVTRKAPRCLTAKQSAVVEVILHAPVCVEEFSNSRALGRAFL 179 A + +I + +D ++GK K P+ L + V++I P+ VE FS LGR + Sbjct: 307 HIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAV 366 Query: 180 RALGSTIAVGVVTRI 194 R + T+AVGV+ + Sbjct: 367 RDMRQTVAVGVIKSV 381 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28976 (293 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33590 222 5e-60 >Vv33590 Length = 198 Score = 222 bits (566), Expect = 5e-60, Method: Compositional matrix adjust. Identities = 106/183 (57%), Positives = 134/183 (73%), Gaps = 1/183 (0%) Query: 33 GEATELLEKGYMQYGCSHYRRRCRIRAPCCNEIFDCRHCHNEAKNDISIDQKYRHDIPRH 92 G A E L+ G M +GC HYRRRCRIRAPCCNEIF CRHCHNEA + + + RH++ RH Sbjct: 3 GSANERLDFGKMGFGCKHYRRRCRIRAPCCNEIFPCRHCHNEATSMLR-NPFDRHELVRH 61 Query: 93 QVKQVICSLCNTEQEVQQVCINCGVCMGKYFCETCKLFDDDVSKKQYHCNXXXXXXXXXX 152 VKQVIC++C+TEQ V QVC NCGV MG+YFCE CK +DDD +K Q+HC+ Sbjct: 62 DVKQVICAVCDTEQPVAQVCTNCGVNMGEYFCEVCKFYDDDTTKGQFHCDDCGICIVGGR 121 Query: 153 ENFFHCDKCGCCYSMLMKNSHPCVEGAMHHDCPVCFEFLFETRDDVTVMPCGHTIHKNCL 212 + FFHC KCGCCYS+ ++++H CVE +M H CP+C+E+LF++ D TVM CGHT+H C Sbjct: 122 DKFFHCKKCGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCGHTMHCECY 181 Query: 213 NEM 215 NEM Sbjct: 182 NEM 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2074 (294 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380944 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9025 217 7e-59 >Vv9025 Length = 428 Score = 217 bits (552), Expect = 7e-59, Method: Compositional matrix adjust. Identities = 104/113 (92%), Positives = 108/113 (95%), Gaps = 1/113 (0%) Query: 22 KAPDSAA-KVNGEAPKKGYVGIHSSGFRDFLLKPELLRSIVDSGFEHPSEVQHECIPQAI 80 KAPDS KVNGEA KKGYVGIHSSGFRDFLLKPELLR+IVDSGFEHPSEVQHECIPQAI Sbjct: 23 KAPDSVTGKVNGEAAKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 82 Query: 81 LGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVSALVLCHTRELAYQICHEF 133 LGMDVICQAKSGMGKTAVFVLS+LQQI+PV GQV+ALVLCHTRELAYQICHEF Sbjct: 83 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALVLCHTRELAYQICHEF 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24201 (434 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19252 (125 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31880 94 8e-22 >Vv31880 Length = 249 Score = 94.0 bits (232), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%) Query: 40 AETCPKDTLKLGACVDLLG-LVNLQIGSPPTSGCCALLEGLSDLEAAICLCTVIKANALG 98 + TCP DTLKLGACVDLLG LV++ +G P + CC +L GL +LEAA+CLCT +K L Sbjct: 163 SATCPIDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLN 222 Query: 99 LNMEVPVALSLLVSACQKTVPPGFKC 124 LN+ VP+AL LL++ C KT PPG+ C Sbjct: 223 LNIFVPLALQLLIT-CGKTPPPGYTC 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27035 (291 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv61809 149 4e-38 >Vv61809 Length = 101 Score = 149 bits (377), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 69/95 (72%), Positives = 78/95 (82%) Query: 20 KLSEEIEGWLRASGLNKSPDVRGVIAPHXXXXXXXXXXXXXFGNIDPTNIKRVFLLGPSH 79 KL+EE++GWLRASGL KSPDVRGVIAPH FGNIDP++I RVFLLGPSH Sbjct: 7 KLAEELDGWLRASGLAKSPDVRGVIAPHAGYSYSGRAAAYAFGNIDPSSISRVFLLGPSH 66 Query: 80 HHYTPKCALSTATVYKTPIGDLPIDLEVIEELKAS 114 H+YTPKCALS ATVYKTP+GDL IDLEV+EELKA+ Sbjct: 67 HYYTPKCALSRATVYKTPVGDLQIDLEVVEELKAT 101 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6103 (363 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9892 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25846 321 5e-90 >Vv25846 Length = 432 Score = 321 bits (822), Expect = 5e-90, Method: Compositional matrix adjust. Identities = 150/173 (86%), Positives = 160/173 (92%) Query: 1 MEAVMACWEIEQSLQSLTGVSPGEGTGATMSXXXXXXXXXXANLFDGSMEGHDSMGFGPL 60 MEAVMACWE+EQSLQSLTGVSPGEGTGATMS NLFDGS++G DSMGFGPL Sbjct: 248 MEAVMACWELEQSLQSLTGVSPGEGTGATMSDDEDDQADSETNLFDGSLDGPDSMGFGPL 307 Query: 61 IPTESERSLMERVRQELKHELKQGYKEKIVDIREEIMRKRRAGKLPGNTTSVLKAWWQSH 120 +PTE+ERSLMERVRQELKHELKQGYKEKIVDIREEI+RKRRAGKLPG+TTS+LKAWWQSH Sbjct: 308 VPTETERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSLLKAWWQSH 367 Query: 121 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR 173 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPS+S VLK+KRKR Sbjct: 368 SKWPYPTEEDKARLVQETGLHLKQINNWFINQRKRNWHSNPSSSAVLKTKRKR 420 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4888 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27130 (494 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22262 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14651 387 e-109 >Vv14651 Length = 241 Score = 387 bits (993), Expect = e-109, Method: Compositional matrix adjust. Identities = 185/227 (81%), Positives = 201/227 (88%) Query: 61 VAQIVSASIAGDLVLAAAYAHELPHYGLEVGLTNYAAAYCTGLLLARRVLKKLEMDDEYE 120 + QI SASIAGD+VLA+AY+HELPHYGLEVGLTNYAAAYCTGLLLARRVLK LEMD EYE Sbjct: 1 MPQITSASIAGDIVLASAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDGEYE 60 Query: 121 GNVEATGEDYSVEPAESRRPFRALLDVGLIRTTTGNRVFXXXXXXXXXXXXIPHSEKRFA 180 GNVEATGEDYSVEP +SRRPFRALLDVGL+RTTTGNRVF IPHS+KRFA Sbjct: 61 GNVEATGEDYSVEPTDSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFA 120 Query: 181 GFSKDSKQLDAEVHRKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYK 240 GFSKDSKQLDAEVHRKYIYGGHV+AYM TL EDEPEKYQ+HFSEYIKKG+E D+IEE+YK Sbjct: 121 GFSKDSKQLDAEVHRKYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYK 180 Query: 241 KVHAAIRADPTAKKTEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF 287 KVHAAIRA+P KK EKQPPKEHKRYNLKKLT++ERK KL+ERL A Sbjct: 181 KVHAAIRANPIQKKVEKQPPKEHKRYNLKKLTYEERKAKLIERLNAL 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9171 (496 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv39142 137 4e-34 >Vv39142 Length = 325 Score = 137 bits (346), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 96/313 (30%), Positives = 150/313 (47%), Gaps = 10/313 (3%) Query: 178 KIAPALIAGNALVLKPPTQGAVSCLHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPG 237 K+ PAL G +V+KP ++ L AG P G ++ V G EIGD L Sbjct: 5 KVGPALACGCTVVIKPSELTPLTALAAAELALQAGIPPGAVNVVFGNAPEIGDALLASRQ 64 Query: 238 VNCISFTGGDTGIAISKKAG----MIPLQMELGGKDACIVLEDADLDLVAANIIKGGFSY 293 V I+FTG T + AG + + +ELGG CI+ +DADL++ + F Sbjct: 65 VRKITFTG-STAVGKKLMAGAAQTVKKVSLELGGNAPCIIFDDADLEVAVKGALGTKFRN 123 Query: 294 SGQRCTAVKVVLVMESVADALVAKVNARVAKLTVGPPEDNSDIT-PVVSESSANFIEGLV 352 SGQ C +LV E + + + V + VG + P+++E++ +E V Sbjct: 124 SGQTCVCANRILVQEGIYEKFAIAFSQAVQSMQVGEGFTEGVVQGPLINEAAVQKVESFV 183 Query: 353 VDAKQKGATFCQEYKRDG---NLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRITTVEEGI 409 DA KGA KR P ++ +++ DM IA E FGPV P++R T EE I Sbjct: 184 KDAVSKGAKVLLGGKRHSLGMTFYEPTVIGDIKNDMLIARNEVFGPVAPLLRFKTEEEAI 243 Query: 410 HHCNASNFGLQGCVFTKDINKAMLIGDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 469 N + GL VFT+++ + + +A+E G V +N + PF G+K+SG+G + Sbjct: 244 RIANDTAAGLAAYVFTENVQRMWRVTEALEYGLVGVNEGLVS-TEVAPFGGVKESGLGRE 302 Query: 470 GITNSINMMTKIK 482 G ++ ++K Sbjct: 303 GSKYGMDEFLEMK 315 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9060 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41852 120 2e-29 >Vv41852 Length = 205 Score = 120 bits (301), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 57/108 (52%), Positives = 76/108 (70%), Gaps = 5/108 (4%) Query: 65 GGASTDL-----YYQKMIDANPGNPMLLSNYARFLKEVQGDFGKAEEYCGRAILACANDG 119 GG S D YY++M++ NP NP+ L NYA+FL + + D AEEY RAILA DG Sbjct: 70 GGESGDRPGVEEYYKRMLEENPSNPLFLRNYAQFLYQSKHDLQAAEEYLCRAILADPRDG 129 Query: 120 TVLSMFADLVWQIHKDAPRAQSYFDQAVQAAPDDSYVLASYAKFLWDS 167 +LS +A LVW++H+D RA SYF++AVQAAP+DS+V A+YA FLW + Sbjct: 130 EILSQYAKLVWELHRDQDRASSYFERAVQAAPEDSHVQAAYASFLWQT 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20202 (269 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9543 (535 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19744 67 7e-13 >Vv19744 Length = 229 Score = 67.0 bits (162), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 57/207 (27%), Positives = 103/207 (49%), Gaps = 10/207 (4%) Query: 289 RHILICAVGIHFF--QQASGIDAVVLYSPRIFEKAGITNSDKKLLCTVAVGFVKTVFILV 346 RH + +G F QQ SGI+AV +S +F+ AG+ + L V VG + Sbjct: 25 RHFRVVFIGSTLFALQQLSGINAVFYFSSTVFKSAGVPSD----LANVFVGIANLSGSIT 80 Query: 347 ATFFVDKVGRRPLLLASVAGMXXXXXXXXXXXXXXDQNHERILWAAVLCLTMVLLYVAFF 406 A +DK+GR+ LL+ S GM A L ++ +LL+V F Sbjct: 81 AMILMDKLGRKALLVWSFFGMAVAMSVQVAGASSFISGSG----AVFLSVSGMLLFVLTF 136 Query: 407 SIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLSMTFISLYEAITIGGAFFLYA 466 ++G GP+ + EIFP ++RA+ ++ ++++ V++ + + F+ L E + + ++ Sbjct: 137 ALGAGPVPGLLLPEIFPNRIRAKAMAVCMSVHWVINFFVGLLFLRLLEQLGPQLLYSMFC 196 Query: 467 AIASVAWVFFFTMLPETHGRTLEDMEV 493 +A VF + ET GR+L+++E+ Sbjct: 197 TFCLMAVVFVKRNVVETKGRSLQEIEI 223 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48275353 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32502 (233 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9661 (397 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5117 222 1e-59 >Vv5117 Length = 304 Score = 222 bits (565), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 111/271 (40%), Positives = 159/271 (58%), Gaps = 2/271 (0%) Query: 92 LGDVIVEIQVGMGPCGELRYPAYPESNGTWRFPGIGEFQCYDKYMRASLEASAEAMGKRD 151 +G I I +G+GP GELRYP++ + + PG+GEFQCYDK M + L+ AEA G Sbjct: 1 MGSTITGISMGLGPDGELRYPSHHRVSKRGKVPGVGEFQCYDKNMLSLLKQHAEATGNPY 60 Query: 152 WGRSGPHDSGQYNQFPEDTGFFKRDG-TWNTEYGQFFLEWYSGKLLRHGDRILSAAKGVF 210 WG GPHD+ QY+ P FF+ G +W T YG FFL WYS +L+ HG +LS A VF Sbjct: 61 WGLGGPHDAPQYDGMPNSNNFFREHGGSWETPYGDFFLSWYSNQLISHGSSLLSLASTVF 120 Query: 211 QGSGAKLSGKIAGIHWHYGSRSHAAELTAGYYNTRHRDGYVPTARMFSKNMVVLNFTCME 270 S +SGK+ +H Y +RSH +ELTAG+YNT +DGY A +F+KN + M+ Sbjct: 121 CNSPVAISGKVPVVHSWYKTRSHPSELTAGFYNTVDKDGYERIAEIFAKNSCKMILPGMD 180 Query: 271 MKDREQPEHANCSPEGLVRQVKMATKSAGIDLAGENALERYDTGAFAQVLATSRSDSGNA 330 + D QP+ + SPE L+ Q+K A + G+ ++G+N+ G F QV + G Sbjct: 181 LSDDHQPQESLSSPELLLAQIKSACRKRGVQISGQNSSVSGAPGGFEQVKKNLLGEDG-V 239 Query: 331 LSAFTYLRMNKRLFEADNWRNMVEFVRSMAE 361 + FTY RM F +++ + E VRS+++ Sbjct: 240 VDLFTYQRMGAYFFSPEHFPSFTELVRSLSQ 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779444 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029865 (66 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17724 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10799 (252 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22966256 381 e-108 >Vv22966256 Length = 306 Score = 381 bits (979), Expect = e-108, Method: Compositional matrix adjust. Identities = 186/252 (73%), Positives = 216/252 (85%), Gaps = 1/252 (0%) Query: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 MP IA+G+P++TYHPDAL+ ALAEF TLIFVFAGEGSGMAF+KLTDD +TTP+GL+A Sbjct: 56 MPFLRIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA 115 Query: 61 AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL 120 AL H GLFVAV+ + NISGGH+NPAVTFGAF+GGNI+LLRG+LYWIAQLLG+ VAC L Sbjct: 116 EALGHGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL 175 Query: 121 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 180 LK T+G TT+AF++S G VWNAFV EIVMTFGLVYTVYATAIDP+ G+VG IAP+AIG Sbjct: 176 LKFCTHGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIG 235 Query: 181 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLIGAGIAGVIYEFVFIG 240 IV ANILAGGAFDGASMNPA+SFGPALVSW W NHWVYWAGPLIG GIAG +YE +FI Sbjct: 236 LIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFID 295 Query: 241 NSGHEQLPSTDY 252 + HE LP +++ Sbjct: 296 RT-HEPLPGSEF 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13441 (361 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25555 (267 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32102 (494 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15700 357 e-100 >Vv15700 Length = 307 Score = 357 bits (916), Expect = e-100, Method: Compositional matrix adjust. Identities = 170/310 (54%), Positives = 221/310 (71%), Gaps = 8/310 (2%) Query: 189 PYIYANDLIEVLKKKHAAGTYKSLVFYLEACESGSIFEGLLPEGLNIFATTASNAEESSW 248 P++YA D I+VLK KHA+G+YK +V Y+EACESGSIFEGL+P+ LNI+ TTAS +E SW Sbjct: 2 PFLYAKDFIDVLKMKHASGSYKEMVLYVEACESGSIFEGLMPDDLNIYVTTASGPDEESW 61 Query: 249 GTYCPGEYPSPPPEYDTCLGDLYSVAWMEDSDVHNLRSETLHQQYELVKMRTANDNS-GF 307 GTYCPG P+PPPEY TCLGDL+SVAW+EDS+ HNL+ +T+ QY+ VK+RT+N N+ Sbjct: 62 GTYCPGMEPAPPPEYITCLGDLFSVAWLEDSETHNLKKQTIEDQYQRVKVRTSNHNTYSV 121 Query: 308 GSHVMQYGDVGLSKNNLFVYMGTNPANDNYTFLGENS--LRPSSKAVNQRDADLLHFWHK 365 GSHVM YG+ + L++Y G +PA D L +N L +NQRDADLL W + Sbjct: 122 GSHVMVYGNESIKTELLYLYQGFDPATDK---LPQNKFDLDIRMDVINQRDADLLFLWQR 178 Query: 366 YRKAPEGSARKIQAQKDFVEAMSHRMHIDQTMKLIGKLLFGIEKGPQVLNAVRPAGQPLV 425 Y+++ S +K + K + M HR+H+DQ+++LIG LL G E GP +LNAVRP G P+V Sbjct: 179 YKRSKADSEKK-EILKQLTQTMQHRVHLDQSIELIGMLLLGPENGPPLLNAVRPRGLPVV 237 Query: 426 DDWDCLKTMVRSFETHCGSLSQYGMKHMRSLANICNAGMTQEQMAEASAQACVS-APSGR 484 DDW+CLK+MV FET CGSL+QYGMKHMR+ ANICN G++ M EA AC S + Sbjct: 238 DDWECLKSMVVVFETRCGSLTQYGMKHMRAFANICNNGISLTAMEEACRTACSSHTILDQ 297 Query: 485 WSSLHRGFSA 494 WS RG+SA Sbjct: 298 WSPTIRGYSA 307 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226797160 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26338 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1760 (107 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2684 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14168 (129 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48735581 (115 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269198 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 61752123 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2536 (365 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2353 649 0.0 >Vv2353 Length = 368 Score = 649 bits (1673), Expect = 0.0, Method: Compositional matrix adjust. Identities = 307/365 (84%), Positives = 337/365 (92%), Gaps = 1/365 (0%) Query: 1 MRGVAVLLSVLLFATCHSAFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGF 60 MR VA LL +LL ATCH A S DG L NGNFEL PKPSD+KG+EVIG +AIP+WE SGF Sbjct: 1 MRAVAFLL-LLLCATCHIALSFTDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGF 59 Query: 61 VEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERL 120 +EYIK+GQKQGDMLLVVPEGA+AVRLGNEASIKQ +KV KG+YYSITFSAARTCAQEERL Sbjct: 60 IEYIKAGQKQGDMLLVVPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERL 119 Query: 121 NVSVAPDSGVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPACGPLIDSVAI 180 N+SVAPD GVLP+QT+YSSNGWDSYAWAFQADY+ +E+V+HNPGVEEDPACGPLIDSVA Sbjct: 120 NISVAPDWGVLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGVEEDPACGPLIDSVAF 179 Query: 181 RTLYPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI 240 R LYPPR ++KNLLKN GFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI Sbjct: 180 RALYPPRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI 239 Query: 241 DSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFAD 300 DSDHFSVP+ KRAVELVAGKESAIAQV RTIPGKTY LSFSVGDASNSCEGSM+VEAFA Sbjct: 240 DSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAG 299 Query: 301 KNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLL 360 ++T+KVPYESKGKGGFKRAVL+FVA S RTR+MFLST+YTMRSDD++SLCGPV+DDVKLL Sbjct: 300 RDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLL 359 Query: 361 SLRKP 365 SLR P Sbjct: 360 SLRTP 364 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23103 (258 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6183 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48382362 (218 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10579 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3516 74 2e-15 >Vv3516 Length = 219 Score = 73.9 bits (180), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 4/116 (3%) Query: 80 VGNVAPDFEAEAVFDQEFVNVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFA 139 +G+ P+ E E + KL +YIG ++ I+F +P DFT VC TE+ + EFA Sbjct: 6 LGDTIPNLEVETTHGR----TKLHDYIGDRWTIIFSHPGDFTPVCTTELGKMAAYTEEFA 61 Query: 140 ELNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSYGVLIPDQ 195 ++LG+S D V SH W++ + YP+ +D + I K ++ PD+ Sbjct: 62 RREVKLLGLSCDDVQSHKEWIKDIEAYTPGSKVTYPIAADPKREIIKQLNMVDPDE 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23352 (437 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3106 420 e-119 >Vv3106 Length = 251 Score = 420 bits (1080), Expect = e-119, Method: Compositional matrix adjust. Identities = 201/216 (93%), Positives = 206/216 (95%) Query: 222 MCALFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 281 MC LFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII Sbjct: 1 MCCLFINDLDAGAGRLGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENPRVPII 60 Query: 282 VTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQS 341 VTGNDFSTLYAPLIRDGRMEKFYWAP REDRIGVC GIFRSDNV +DIVK+VDTFPGQS Sbjct: 61 VTGNDFSTLYAPLIRDGRMEKFYWAPNREDRIGVCKGIFRSDNVPDDDIVKIVDTFPGQS 120 Query: 342 IDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 401 IDFFGALRARVYDDEVRKWI+GVGVD IGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV Sbjct: 121 IDFFGALRARVYDDEVRKWISGVGVDFIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLV 180 Query: 402 QEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437 EQENVKRVQLADKYLSEAALGDAN D++ GTFYG Sbjct: 181 MEQENVKRVQLADKYLSEAALGDANVDSIERGTFYG 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7985 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210147361 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283069 (144 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12672 (318 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15466256 240 2e-65 >Vv15466256 Length = 322 Score = 240 bits (613), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 133/318 (41%), Positives = 204/318 (64%), Gaps = 14/318 (4%) Query: 6 GRYCVTGAGGFLASWVVKLLLSKDSIIHGTLRDPSNDKHA-HLKKLDKASENLKLFKADL 64 G CVTGA G++ASW+VKLLL + + ++RDP++ K HL LD A E L LFKA+L Sbjct: 4 GVVCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFKANL 63 Query: 65 LDYESLHTAIQGCDGVFHVASPVPYDPVPNPEVELIEPAVKGTLNVLKACLEAK-VKRVV 123 L+ S + ++GC GVFH ASP + V +P+ ELI+PAVKGTLNVL +C +A VKRVV Sbjct: 64 LEEGSFDSIVEGCVGVFHTASPF-FHAVTDPQAELIDPAVKGTLNVLGSCAKASSVKRVV 122 Query: 124 FVSSAASLVMN--PKWSQGQVLNETCWSDKEYCRSTKNWYCLSKTEAEYEALEYARINGL 181 SS A++ N P+ + V++ET ++D ++C+ + WY +SKT AE A ++A+ G+ Sbjct: 123 VTSSIAAVAYNRNPR-TPDVVVDETWFTDPDFCKGLQLWYVVSKTLAEDAAWKFAKEKGI 181 Query: 182 DLVTVCPTLIMGPILQSTVNASTLVLIKLLKEGYESLENKPRMIVDVRDVAEAVIMVYEK 241 D+VT+ P +++GP+LQ T+N S ++ L+ G ++ N V+V+DVAEA I +E Sbjct: 182 DMVTINPAMVIGPLLQPTLNTSAAAILNLINGG-QTFPNASFGWVNVKDVAEAHIQAFEV 240 Query: 242 PEAEGRYICTAHNIKTTDLVEELKSIYPNYSYPKNFVEVEEQP-----RLSSEKLQRLGL 296 P A GRY + ++LV+ LK ++P++ P+ +++P ++S EK + LG+ Sbjct: 241 PSASGRYCLVERVVHYSELVKILKELFPDFQLPEKC--ADDKPFVPTFQVSKEKAKSLGI 298 Query: 297 SFRPLKETLTGSVESYKE 314 F PL+ +L +VES KE Sbjct: 299 EFIPLEVSLKETVESLKE 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54682321 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27484 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10209 (443 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24958 (229 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30274 (59 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14289 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13327 63 2e-12 >Vv13327 Length = 259 Score = 62.8 bits (151), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 35/98 (35%), Positives = 47/98 (47%), Gaps = 12/98 (12%) Query: 15 VLLFLALLPKATSVKP-----CPRP---SLPQSDSNF----CLSWRLAVETNNMRRWRTV 62 + L AL + S +P PRP PQ S C SWR VE NN+ W+T+ Sbjct: 6 IFLLFALFSISLSHEPFNSHLLPRPLILEYPQESSEEIQLECTSWRFGVEANNLGPWKTI 65 Query: 63 PIQCFRYVETYMIGGQYERDINFIVGQILSYAIGITLS 100 P+ C YV+ YM G YE D+ + + YA + LS Sbjct: 66 PVACAEYVKDYMTGRAYEIDLGRVANEAAIYARSVELS 103 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26728 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60386 143 6e-37 >Vv60386 Length = 206 Score = 143 bits (361), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 81/96 (84%), Positives = 82/96 (85%) Query: 1 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE 60 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE Sbjct: 111 MDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPE 170 Query: 61 RVIDDTWMQELNIXXXXXXXXXXXXXDLDRNSLAYI 96 R +DDTWMQELNI DLDRNSLAYI Sbjct: 171 RTVDDTWMQELNIQRPPTPTRGRPQPDLDRNSLAYI 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265854 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9627 (473 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19744 90 9e-20 >Vv19744 Length = 229 Score = 89.7 bits (221), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 68/227 (29%), Positives = 119/227 (52%), Gaps = 22/227 (9%) Query: 255 DSLPKAKLLDLFQRRYWSSLVIGVGLMFCQQLGGINGVCFYVSDIFEQAGFSSSIGTITY 314 D + KL +L R++ + IG L QQL GIN V ++ S +F+ AG S + + Sbjct: 11 DEIDAVKLSELLYGRHFRVVFIGSTLFALQQLSGINAVFYFSSTVFKSAGVPSDLANVFV 70 Query: 315 AILQVIVTAIAAGVMDKAGRKPLILVSAAGLVLG---SLLTAVSFFLKVHEWALNAVPIL 371 I + + A +MDK GRK L++ S G+ + + A SF + + L Sbjct: 71 GIANLSGSITAMILMDKLGRKALLVWSFFGMAVAMSVQVAGASSFI------SGSGAVFL 124 Query: 372 AVTGILVYIGAFSIGMGAVPWVVMSEIFPINIKGQAGSLATLVNWLCAWLCSYTFNYL-- 429 +V+G+L+++ F++G G VP +++ EIFP I+ +A ++ V+W+ + F L Sbjct: 125 SVSGMLLFVLTFALGAGPVPGLLLPEIFPNRIRAKAMAVCMSVHWVINFFVGLLFLRLLE 184 Query: 430 -----MIWSSYGTFILYAGINALAILFVVALVPETKGKTLEHIQAAI 471 +++S + TF L +A++FV V ETKG++L+ I+ A+ Sbjct: 185 QLGPQLLYSMFCTFCL------MAVVFVKRNVVETKGRSLQEIEIAL 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4847 (293 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27856 (545 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32864 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25908 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26640 86 2e-19 >Vv26640 Length = 292 Score = 86.3 bits (212), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 5/88 (5%) Query: 1 VKRFVYISAADFGLANYLL-RGYYEGKRAAETELLTKFPYGGVILKPGFIYGTRSVGSVK 59 V +F+ IS D+ L +LL GY+ GKR AE+E+L+K+P GV+L+PGFIYG R V + Sbjct: 159 VPKFILISVHDYNLPQFLLDSGYFTGKRKAESEVLSKYPNSGVVLRPGFIYGKRRVDGFE 218 Query: 60 LPLGVIGYPLEMLFQ----YTRPLSQLP 83 +PL +IG PLE + + TRPLS LP Sbjct: 219 IPLDLIGEPLEKILRATENLTRPLSALP 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13779 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9935 (521 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13235 685 0.0 >Vv13235 Length = 522 Score = 685 bits (1767), Expect = 0.0, Method: Compositional matrix adjust. Identities = 353/526 (67%), Positives = 391/526 (74%), Gaps = 10/526 (1%) Query: 1 MGSIPDPGELT-ELTPPSFDEFQRQTSLMTSCTLLWKELSDHFSSLEQNLLKKSEAIKLK 59 MGSIPDPG+++ EL PPSFD+FQ+QTSLMTSCTLLWKELSDHF+SLEQNL KKSEA+K K Sbjct: 1 MGSIPDPGDISGELNPPSFDDFQKQTSLMTSCTLLWKELSDHFTSLEQNLQKKSEALKNK 60 Query: 60 IQTLEQDTKASLDELEQREVTIRDSFEIALGKVEKSKEAALKVLKRGRSXXXXXXXXXXX 119 QTL+ TK SL L++REVTI S EIALGKVE+S+EAAL L +G Sbjct: 61 FQTLDHHTKESLGVLKKREVTIDGSVEIALGKVEESREAALIALLKG---AQDGEVDDSE 117 Query: 120 XLLMNLKSLCLKMDSGGFWRFVTARKKELEGLRSQMPVALGDCVDPGKFVLEAISEVFPV 179 LL+ LKS CLKMDS FWRF+TARKKEL+ LR+Q P AL +CVDP KFVLEAISEVFPV Sbjct: 118 GLLLKLKSFCLKMDSKEFWRFITARKKELDVLRAQTPEALAECVDPAKFVLEAISEVFPV 177 Query: 180 DKRLERSDRGNDLGWACVLLLESLIPVVVDPKIGRKRLLVTRSVKQRATEMAETWKASLE 239 DKR+E+S+R NDLGWACVL+LESLIPVVVDP +G+ RLLVT SVK+RA ++AETWKASL+ Sbjct: 178 DKRVEKSERSNDLGWACVLVLESLIPVVVDPVLGKSRLLVTPSVKERAKDIAETWKASLD 237 Query: 240 ERGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVVSSAWRKQMPKLAVSLGLAKQM 299 +RGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVV SAWRKQMPKLAVSLGL +M Sbjct: 238 QRGGIENVKTPDVHTFLQHLVTFGIVKEEDVDLYRKLVVGSAWRKQMPKLAVSLGLGDKM 297 Query: 300 PDMIEELISRGQQLDAVHFTYEVGLVHKFPPVPXXXXXXXXXXXXXXSILEDPXXXXXXX 359 DMIEEL++RGQQ+DAVHFTYEVGLV KFPPVP SILEDP Sbjct: 298 ADMIEELVNRGQQVDAVHFTYEVGLVDKFPPVPLLKAFLRDSKKAATSILEDPNNSGRAV 357 Query: 360 XXXXXKELSALRAVVKCIEDYNLETEFPPENLKKRLEQLXXXXXXXXXXXXXXANKRTRA 419 KE SALRAV+KCIE+Y LE EFPPENLKKRLEQL ANKRTRA Sbjct: 358 NLAGRKEQSALRAVIKCIEEYKLEAEFPPENLKKRLEQLEKAKTDKKRPAAVPANKRTRA 417 Query: 420 NNGGPMPPAKAGRLTNAYVSSFPTTPPTFVMSPSHGQYPAGFS--PYHSP--PTMYGSRX 475 +NGGPMPPAKAGRLTNAYVSSFP PTF+ SPSH QYPA PY P P MYGSR Sbjct: 418 SNGGPMPPAKAGRLTNAYVSSFPAA-PTFIRSPSHTQYPAAVPAYPYDRPAAPAMYGSRS 476 Query: 476 -XXXXXXXXXXXXXXXXXXXXXXXMNYPAYAAYGNGMVPAYQQAYY 520 +NYPAY YGNGM PAYQQAYY Sbjct: 477 PPANPYAYSPEAAPPLAGSYPGAPINYPAYGGYGNGMAPAYQQAYY 522 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2751 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46601835 (113 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19101 (400 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23856 301 1e-83 >Vv23856 Length = 418 Score = 301 bits (772), Expect = 1e-83, Method: Compositional matrix adjust. Identities = 148/351 (42%), Positives = 228/351 (64%) Query: 29 LDSRVRAVRENLRTSRKEFGKTEDDLKSLQSVGQIIGEVLRPLDNERLIVKASSGPRYVV 88 +D + V++ + ++E + ++++K +QSV +IG+ + +D IV +++G Y V Sbjct: 54 IDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYV 113 Query: 89 GCRSKVDKEKLVTGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQ 148 S +++E L V L + ++ LP E D + + + +V+Y+ +GG Q Sbjct: 114 RILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQ 173 Query: 149 IRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSS 208 +E+RE++ELPL + EL+ ++GI PP+GVLLYGPPGTGKT+LA+A+A++ A F++VV S Sbjct: 174 KQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGS 233 Query: 209 AIIDKYIGESARLIREMFGYARDHQPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELL 268 + KY+GE R++R++F A+++ P IIF+DEVDAI RF T ADRE+QR LMELL Sbjct: 234 EFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELL 293 Query: 269 NQLDGFEQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHAAGIA 328 NQ+DGF+Q VK+IMATNR D LDPALLRPGRLDRKIE PLP+ + + + ++ A + Sbjct: 294 NQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMN 353 Query: 329 KHGEIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVR 379 E+D E V + + A++ +C EAGM A+R R ++ +DF K R Sbjct: 354 LSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR 404 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226777607 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48391514 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2584 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25533 106 2e-25 >Vv25533 Length = 159 Score = 106 bits (265), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 66/136 (48%), Positives = 80/136 (58%), Gaps = 7/136 (5%) Query: 24 SSASPGIFGAIFAPPSKDLVLGRESVHSEFTGKKL--SDEPLHFTPGDQPDGAXXXXXXX 81 S +S GIF +IF+ SK VLGRES+ + T KK +E + PG + Sbjct: 29 SPSSTGIFASIFSTSSK--VLGRESLRPDLTKKKQDSGNEVWNAKPGTTENALQQSEGES 86 Query: 82 XXXXXXXXXXXXXYRDQRVQQPCHLSSSIYYGGQDIYSYSQSNQSPEYNSTYKKDGTEDD 141 Y++QRVQ PCHLSSSIYYGGQDIY + Q++QS S KKD EDD Sbjct: 87 QSISNRDTGSF--YQEQRVQ-PCHLSSSIYYGGQDIYFHPQNSQSSGMPSMLKKDSGEDD 143 Query: 142 SGSACRGNWWQGSLYY 157 +GSA RGNWWQGSLYY Sbjct: 144 TGSASRGNWWQGSLYY 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31992 (566 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15940 262 1e-71 >Vv15940 Length = 287 Score = 262 bits (669), Expect = 1e-71, Method: Compositional matrix adjust. Identities = 131/260 (50%), Positives = 169/260 (65%), Gaps = 12/260 (4%) Query: 115 ITGQEGTLWWHAHISWLRATVHGALIIHPKAGQSFPFPKPAKEVPIILGDWYSGNVVDIE 174 I GQEGTLWWHAH SWLRATV+GALIIHPK G S+PF KP +E PI+LG+W+ N +D+ Sbjct: 25 IQGQEGTLWWHAHSSWLRATVYGALIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVV 84 Query: 175 QEGLSKGIAPNLSNAYTINGLPGDLYDCSQNQTYQLSVVRGKTYLLRLINAALNTQLFFK 234 ++ G APN+S+AYTING PGDLY+CS T + + G+T LLR+IN+ LN +LFF Sbjct: 85 RQATRTGAAPNVSDAYTINGQPGDLYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFT 144 Query: 235 IANHNMTVVAIDASYTTPYDTDVVVIAPGQTTDILVKFNQLNGSYYMAATPYASADDTVG 294 +ANH TVV+ DASYT P+ T V+++ PGQTTD+L+ +Q YYMAA Y SA Sbjct: 145 VANHKFTVVSADASYTKPFTTSVIMLGPGQTTDVLITGDQPPARYYMAARAYQSAQG-AP 203 Query: 295 FDNSTTRGIIVYKGY-------TSSTPIMPPMPNPHDTPLAHKFFTNLTGLPGGPHWVPV 347 FDN+TT I+ YK S+TP+ P +P +DT F + P V V Sbjct: 204 FDNTTTTAILEYKSAPCPAKKGVSTTPVFPSLPAFNDTATVTAFSKSFR----SPAKVEV 259 Query: 348 PRKVDEHMFVTVGVNLAMCP 367 P +DE +F TVG+ L CP Sbjct: 260 PTDIDESLFFTVGLGLNRCP 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13962 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8306 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27166265 216 3e-58 >Vv27166265 Length = 169 Score = 216 bits (549), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 101/127 (79%), Positives = 116/127 (91%) Query: 17 NAAVQDFCVADLTAPDGPAGYSCKSPANVKVDDFVFSGLGVAGNTTNIIKAAVTPAFAAQ 76 +AAVQDFCV DL AP+GPAGYSCK PA V VDDFVFSGLG+AGNT+N+IKAAVTPAFA Q Sbjct: 16 HAAVQDFCVGDLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVTPAFAPQ 75 Query: 77 FPGVNGLGISLARLDLAVGGVIPFHTHPGGSEVLIVIEGTICAGFVSSANTVYLQTLEKG 136 FPG+NGLG+S+ARLDLAVGGV+P HT PGGSEVL+V +G ICAGF+SSANTVY +TL+KG Sbjct: 76 FPGLNGLGLSIARLDLAVGGVVPMHTPPGGSEVLLVTQGAICAGFISSANTVYFKTLKKG 135 Query: 137 DIMVFPQ 143 DIM+FPQ Sbjct: 136 DIMIFPQ 142 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6579 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14001 277 7e-77 >Vv14001 Length = 152 Score = 277 bits (709), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 136/152 (89%), Positives = 137/152 (90%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 Query: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 AAEL+ LM IVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH Sbjct: 61 AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6779 (198 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32493 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46991714 (56 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5463 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65578 119 1e-29 >Vv65578 Length = 265 Score = 119 bits (299), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 57/90 (63%), Positives = 65/90 (72%) Query: 1 MEDYVHRIGRTGRAGSMGQSTSFYTDRDMFLVANIKKAISDAGSGNAVAFATGKTXXXXX 60 ME+YVHRIGRTGRAGS GQ+TSFYTDRD+FLVA+I+KAI+D GSGN VAFATGK Sbjct: 175 MENYVHRIGRTGRAGSTGQATSFYTDRDVFLVAHIRKAIADVGSGNTVAFATGKVARRKE 234 Query: 61 XXXXXXXXXXXVALSNSSTAGPASVNIEDK 90 +ALSN S GP S+NIE K Sbjct: 235 REAAAAQKEARIALSNLSLMGPTSLNIERK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 15184581 (68 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27776 (419 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16325 167 3e-43 >Vv16325 Length = 243 Score = 167 bits (423), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 82/107 (76%), Positives = 86/107 (80%) Query: 55 VENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEA 114 VENPGNNLYVTGLS RVTKRELEKHFA+EG V DVHLV DPWTRESRGFGFVTM V+EA Sbjct: 44 VENPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEEA 103 Query: 115 ERCIKYLDGSVLEGRVITVEKAXXXXXXXXXXXXYLGLRTVHVRQRT 161 RCIKYLD SVLEGRVITVEKA YLGLRTV VR+R+ Sbjct: 104 NRCIKYLDRSVLEGRVITVEKARRRRGRTPTPGKYLGLRTVRVRRRS 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13992 (108 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25533 95 3e-22 >Vv25533 Length = 159 Score = 95.1 bits (235), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 8/100 (8%) Query: 12 NHALNTKQGT---AAISSEGARYSVPNKDRSSVLQEERSEPCYLSSSIYYGGQEVYSQSP 68 N N K GT A SEG S+ N+D S QE+R +PC+LSSSIYYGGQ++Y Sbjct: 65 NEVWNAKPGTTENALQQSEGESQSISNRDTGSFYQEQRVQPCHLSSSIYYGGQDIYFHPQ 124 Query: 69 RTHASGSYPIFKKDAGEDDPNGTNSNSAARGNWWQGSLYY 108 + +SG + KKD+GEDD + SA+RGNWWQGSLYY Sbjct: 125 NSQSSGMPSMLKKDSGEDD-----TGSASRGNWWQGSLYY 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25110 (205 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32822 (197 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7248 (582 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2090 (90 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7350 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784615 (123 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796879 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239938 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6224 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28069 (447 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2810 350 3e-98 >Vv2810 Length = 235 Score = 350 bits (897), Expect = 3e-98, Method: Compositional matrix adjust. Identities = 170/235 (72%), Positives = 197/235 (83%), Gaps = 4/235 (1%) Query: 217 MAAEAGSPYFRLGYNSLGAFATINHLHFQAYYLAVTFPIEKAPTKKISTLNAEVKVSELL 276 MA EAG+PYFRLGYNSLGAFATINHLHFQAYYLA FPIEKAPT+KI+T VK+ ELL Sbjct: 1 MAVEAGNPYFRLGYNSLGAFATINHLHFQAYYLATPFPIEKAPTRKITTAGNGVKIFELL 60 Query: 277 NYPVRGLVFEGGNTLEDLSYTVSDACICLQENNVPYNVLISDCGKRIFLLPQCYAEKQAL 336 YPVRGLVFEGG+TL+DL+ TV+D+CICLQ+NN+P+NVLI+D GKRIFL QCYAEKQAL Sbjct: 61 KYPVRGLVFEGGDTLQDLANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYAEKQAL 120 Query: 337 GEVSAEVLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLSEERFQEVNALI 396 GEV+ E+LDTQVNPAVWE+SGH+VLKRK+DY+ AS++NAW+LLAEVSLSEERFQEVNALI Sbjct: 121 GEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEQNAWRLLAEVSLSEERFQEVNALI 180 Query: 397 FERIASGNNGNENLPED----PEVKPRSHEEVDATINKSSRAAMVGETQECIVLQ 447 FE IA G++ NL ED P+V P SHE+ A N S AAMV QEC+V Q Sbjct: 181 FEAIACGDDEKGNLTEDMIEEPDVTPPSHEDAGAINNSSYPAAMVAGKQECLVQQ 235 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21954 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3278 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25533 137 1e-34 >Vv25533 Length = 159 Score = 137 bits (344), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 82/167 (49%), Positives = 105/167 (62%), Gaps = 14/167 (8%) Query: 1 MESNNKYQGNSGSSLTADLFGAKDKESPPKSSTGIFASIFPPPSQVVGRNSSSSELTEYW 60 ME + +S SS DLFG+K+ P SSTGIFASIF S+V+GR S +LT+ Sbjct: 1 MEGKKRAGSSSSSSFATDLFGSKESSYPSPSSTGIFASIFSTSSKVLGRESLRPDLTK-- 58 Query: 61 QKQSSLGNHAWNSKQAIS------GEGAHYSLPNKDRSSVLQEERAEPCHLSSSIYYGGQ 114 +KQ S GN WN+K + EG S+ N+D S QE+R +PCHLSSSIYYGGQ Sbjct: 59 KKQDS-GNEVWNAKPGTTENALQQSEGESQSISNRDTGSFYQEQRVQPCHLSSSIYYGGQ 117 Query: 115 EVYSQSPSTRSSGSYPIFKKDGGEDDPNGTNSNSAARGNWWQGSLYY 161 ++Y +++SSG + KKD GEDD + SA+RGNWWQGSLYY Sbjct: 118 DIYFHPQNSQSSGMPSMLKKDSGEDD-----TGSASRGNWWQGSLYY 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24131 (311 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32276 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34026 70 2e-14 >Vv34026 Length = 193 Score = 70.5 bits (171), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 3/86 (3%) Query: 29 FFIDSNANYAVLKEDFASMTPLLAISIIVDSVQSVFSSVARGCGWQHLVVYVNLATFYFV 88 F SN ++E +++ LL +++++S+Q V S VA G GWQ LV Y+NL +Y + Sbjct: 97 FIFTSNKE---MQEAVSNLAYLLGATMLLNSMQPVLSXVAVGSGWQALVAYINLGCYYII 153 Query: 89 GMTIAVLLGFKFKLYAKGLWIGIICG 114 G+ + LLG+ K KGLW G+ICG Sbjct: 154 GVPLGCLLGYLAKFGVKGLWGGMICG 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698874 (159 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8357 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2866265 82 5e-18 >Vv2866265 Length = 276 Score = 82.4 bits (202), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 44/107 (41%), Positives = 65/107 (60%), Gaps = 2/107 (1%) Query: 1 MAPEYAMRGYLTDKADVYSFGIVALEIVSGKS--NTGYKPKEEFVYLLDGAYVLQEQGNM 58 +APEY G ++K DV+ +GI+ LE+++G+ + ++ V LLD L ++ + Sbjct: 123 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKL 182 Query: 59 LELVDPDLGSNYSKTEAMTMLNLALLCTNPSPTLRPTMSSVVSMLEG 105 LVDPDL +NY + E ++ +ALLCT SP RP MS VV MLEG Sbjct: 183 EMLVDPDLQTNYVEAEVEQLIQVALLCTQGSPMERPKMSEVVRMLEG 229 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5807 113 3e-27 >Vv5807 Length = 404 Score = 113 bits (283), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 59/129 (45%), Positives = 77/129 (59%), Gaps = 23/129 (17%) Query: 164 GSGSGCVSE--RSEMELSEDYTCVISRGPKPRTTHIFDNCIVESY------HTLSDQSSS 215 GSG G + SE+ELSEDYTCVIS GP P+TTHI+ +CI+E + H +++ Sbjct: 262 GSGQGLIGSLSASEIELSEDYTCVISHGPNPKTTHIYGDCILECHSNDLANHNKNEEHKI 321 Query: 216 GS---------------ENFLSFCYTCRKNLEQKIDIYIYRGEKAFCSQECRYQEMLLDE 260 GS +FLS CY+C+K LE+ DIY+YRGEKAFCS CR QE+L+D Sbjct: 322 GSPLIVECSDNSTPYPSNDFLSICYSCKKKLEEGKDIYMYRGEKAFCSLNCRSQEILIDX 381 Query: 261 VGNTQLDDT 269 DD+ Sbjct: 382 XMEKTTDDS 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31382 (274 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5807 113 3e-27 >Vv5807 Length = 404 Score = 113 bits (283), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 59/129 (45%), Positives = 77/129 (59%), Gaps = 23/129 (17%) Query: 164 GSGSGCVSE--RSEMELSEDYTCVISRGPKPRTTHIFDNCIVESY------HTLSDQSSS 215 GSG G + SE+ELSEDYTCVIS GP P+TTHI+ +CI+E + H +++ Sbjct: 262 GSGQGLIGSLSASEIELSEDYTCVISHGPNPKTTHIYGDCILECHSNDLANHNKNEEHKI 321 Query: 216 GS---------------ENFLSFCYTCRKNLEQKIDIYIYRGEKAFCSQECRYQEMLLDE 260 GS +FLS CY+C+K LE+ DIY+YRGEKAFCS CR QE+L+D Sbjct: 322 GSPLIVECSDNSTPYPSNDFLSICYSCKKKLEEGKDIYMYRGEKAFCSLNCRSQEILIDX 381 Query: 261 VGNTQLDDT 269 DD+ Sbjct: 382 XMEKTTDDS 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8447 (236 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14766260 430 e-122 >Vv14766260 Length = 236 Score = 430 bits (1106), Expect = e-122, Method: Compositional matrix adjust. Identities = 207/236 (87%), Positives = 222/236 (94%) Query: 1 MLGVFSSAIVSPPEELVAAGSRTPSPKITATSLVNRFVQTNDAAVSVQVGDDAQLAYSHS 60 MLGVFSS+I+SPP+ELVAAG RTPSPKITA +L+NRF+Q N +AVSV VGD QLAY+H Sbjct: 1 MLGVFSSSIMSPPDELVAAGCRTPSPKITAEALMNRFIQGNPSAVSVHVGDHVQLAYTHH 60 Query: 61 NESALQPRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYP 120 NES L PRSFAVKDEIF LFEGALDNLGSLRQQYGLAKSANEV+LVIEAYKALRDRAPYP Sbjct: 61 NESPLLPRSFAVKDEIFSLFEGALDNLGSLRQQYGLAKSANEVVLVIEAYKALRDRAPYP 120 Query: 121 PNHVVGHLSGNFAFIVFDKSTSTVFVASDQFGKIPLSWGITADGYVAFADDAELLKGACG 180 PNHVVGHLSG+FAFIVFDKSTST+FVASDQFGK+PLSWGITADGYVAFADDAELLKGACG Sbjct: 121 PNHVVGHLSGSFAFIVFDKSTSTLFVASDQFGKVPLSWGITADGYVAFADDAELLKGACG 180 Query: 181 KSLASFPQGCFYSTSVGGLRSYENPKNKITAVPATDEEIWGATFKVEGPAVLAATK 236 KSLASFPQGCF+ST+VG LRS+ENPKNKITAVPA DEEIWGATFKVEGPAV AATK Sbjct: 181 KSLASFPQGCFFSTAVGELRSFENPKNKITAVPAPDEEIWGATFKVEGPAVFAATK 236 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812304 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13975 (237 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31917 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23765 65 8e-13 >Vv23765 Length = 328 Score = 65.5 bits (158), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 31/78 (39%), Positives = 50/78 (64%) Query: 95 LPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTMRSWNHTEENKRRTLQKNDIA 154 P ARIKKIM+ADEDV I+ PV+ ++A E+F+ +L R+++ T + +T+ + Sbjct: 9 FPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYDITLQRGAKTMSSLHLK 68 Query: 155 AAITRTDIFDFLVDIVPR 172 + R ++FDFL DIV + Sbjct: 69 HCVQRHNVFDFLRDIVSK 86 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48487994 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10594 (408 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32044 337 2e-94 >Vv32044 Length = 601 Score = 337 bits (864), Expect = 2e-94, Method: Compositional matrix adjust. Identities = 171/331 (51%), Positives = 223/331 (67%), Gaps = 8/331 (2%) Query: 69 MWGIPLLGNDEKADVVLLKFLRARDFRVPDSFAMITKCLAWRKEFGADGVVEEDLGFKEL 128 +WGI L +D++ DVVLLKFLRARDF+ ++ M+ + WRK FG + ++ +DLG L Sbjct: 265 IWGIKLF-DDDRTDVVLLKFLRARDFKPKEALTMLKNTVLWRKSFGIETLLGDDLG-THL 322 Query: 129 EGVVAYMHGYDKQGHPVCYNAYGVFKDKEMYERIFGDDEKLKKFLRWRVQVLERGINALH 188 E VV +M G K+GHPVCYNAYG F +KE+Y+ F D+EK + FLRWR+Q LE+ I L Sbjct: 323 ESVV-FMEGSGKEGHPVCYNAYGKFLNKELYQNTFSDEEKRQNFLRWRIQFLEKSIRKLD 381 Query: 189 FKAGGINSIIQVTDLKDMP---KRELRVASNQILSLFQDNYPEMVARKIFINVPWYFSVL 245 F GIN+IIQV DLK+ P KRELR ++NQ L L QDNYPE VA++IFINVPW++ Sbjct: 382 FSPNGINTIIQVNDLKNSPGPFKRELRQSTNQALHLLQDNYPEFVAKQIFINVPWWYLAF 441 Query: 246 YSMFSPFLTQRTKSKFVIAKEGNVAETLYKFIRPEDVPVQYGGLSRLSDAQNGPPKPASE 305 M SPFLTQRTKSKFV A AETL+K+I PE VPVQYGGL R D + P + Sbjct: 442 NRMISPFLTQRTKSKFVFAGPSKSAETLFKYIAPEQVPVQYGGLKRDGDTEFSICDPVTL 501 Query: 306 FTVKGGEKVNIQIEGIEADATITWDIVVGGWDLEYTAEFVPNAEGSYTIQVEKPRKVMPS 365 T+K G K I+ E + W++ V GWD+ Y AEFVP EG YT+ V+K RK+ P+ Sbjct: 502 VTIKPGCKHVIEFPYSEP-CQLIWELRVIGWDVTYGAEFVPTVEGGYTVIVQKARKIAPT 560 Query: 366 EE-AIHNSFTPREAGKMVFSVDNSASRRKKV 395 +E I NSF E GK++ ++DN S++KK+ Sbjct: 561 DEPVISNSFKIGEPGKVILTIDNQTSKKKKL 591 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27400 (266 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2678 175 1e-45 >Vv2678 Length = 232 Score = 175 bits (443), Expect = 1e-45, Method: Compositional matrix adjust. Identities = 78/107 (72%), Positives = 85/107 (79%) Query: 121 MLKEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHASLPRACVSYSDN 180 MLKEYLEG+EPT FMYPSAVD FKKQF YLEEHYGNG T PER HASLPR CV YSDN Sbjct: 1 MLKEYLEGTEPTSFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHASLPRPCVLYSDN 60 Query: 181 PVQHSTDVTDDLSRCCIKEVEKPQTDRSSGIPTTRLPIQVPHTIQGA 227 + +S +V DDLS+CCIKEVEKP DRS GIP RLP+QVP + QG Sbjct: 61 SLHNSAEVADDLSKCCIKEVEKPHMDRSCGIPMARLPLQVPQSTQGG 107 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91022484 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5239 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7028 (239 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53234 254 7e-70 >Vv53234 Length = 261 Score = 254 bits (650), Expect = 7e-70, Method: Compositional matrix adjust. Identities = 136/251 (54%), Positives = 156/251 (62%), Gaps = 20/251 (7%) Query: 8 QTVEEIFKDNSARRTAVVRALTYDVDEFYGLCDPEKENLCLYGHPNETWXXXXXXXXXXX 67 +TVEE+F+D RR +++ALT DVDEFY CDPEKENLCLYG PNE W Sbjct: 10 RTVEEVFRDFKGRRAGMIKALTTDVDEFYQQCDPEKENLCLYGFPNELWEVNLPAEEVPP 69 Query: 68 XXXXXXXGINFARDGMNRKDWLSLVAVHSDSWLLSVAFYFGAR--LNRNERKRLFSLIND 125 GINFARDGM KDWLSLVAVHSD+WLL+VAFYFGAR ++ +RKRLF++IND Sbjct: 70 ELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADRKRLFNMIND 129 Query: 126 LPTVFEVV--TERKPVKEKPSVXXXXXXXXXXX--------------XXXXXLVKSTPK- 168 LPT+FEVV T +K VKEK SV TP+ Sbjct: 130 LPTIFEVVTGTAKKQVKEKSSVSNHSSNKSKSNSKVVPQQQQPQQRGSESQGKYSKTPQK 189 Query: 169 -LPXXXXXXXXXXXXXTLCGSCGGNYNADEFWIGCDICEKWFHGKCVKITPAKAENIKQY 227 TLCG+CG NY +DEFWI CDICEKWFHGKCVKITPA+AE+IKQY Sbjct: 190 DEDEGLEEEEEDEHGETLCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQY 249 Query: 228 KCPSCSLKRGR 238 KCPSCS KR R Sbjct: 250 KCPSCSNKRSR 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17486 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15366264 110 2e-26 >Vv15366264 Length = 387 Score = 110 bits (275), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 1/75 (1%) Query: 1 MLRRMYENVQEPFMNATTMAGDAGSD-GSNPFAALLGAEGGNQTRAQSTNQSTVSSDTAT 59 MLRRMYE VQEPF+NATTM+GD+GSD GSNPFAALLG +GG Q +S N T SDT Sbjct: 258 MLRRMYETVQEPFLNATTMSGDSGSDLGSNPFAALLGTQGGVQAHDRSANPPTAGSDTTN 317 Query: 60 GSPAPNTNPLPNPWS 74 SPAPNTNPLPNPW+ Sbjct: 318 NSPAPNTNPLPNPWT 332 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91034490 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25966261 231 1e-62 >Vv25966261 Length = 250 Score = 231 bits (588), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 111/134 (82%), Positives = 126/134 (94%) Query: 71 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 130 MGK YPTVSEEYK A++KA++KLRGLIAEKNCAP+MLRIAWHSAGT+D KT+TGGPFGTM Sbjct: 1 MGKSYPTVSEEYKKAVEKAKKKLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM 60 Query: 131 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADLYQLAGVVAVEITGGPDVPFHPGRK 190 + P E +HGANNGLDIAVRLLEPIK+QFPI+SYAD YQLAGVVAVE+TGGP++PFHPGR+ Sbjct: 61 KKPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE 120 Query: 191 DAPEPPPEGRLPDA 204 D PEPPPEGRLPDA Sbjct: 121 DKPEPPPEGRLPDA 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10810 (250 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25966261 399 e-113 >Vv25966261 Length = 250 Score = 399 bits (1025), Expect = e-113, Method: Compositional matrix adjust. Identities = 196/250 (78%), Positives = 216/250 (86%) Query: 1 MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM 60 MGK YPTVSEEYK A++KA++KLRGLIAEKNCAP+MLRIAWHSAGT+D KT+TGGPFGTM Sbjct: 1 MGKSYPTVSEEYKKAVEKAKKKLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM 60 Query: 61 RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK 120 + P E +HGANNGLDIAVRLLEPIK+QFPI+SYADFYQLAGVVAVE+TGGP++PFHPGR+ Sbjct: 61 KKPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE 120 Query: 121 DAPEPPPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT 180 D PEPPPEGRLPDATKGCDHLR VF MGLSDKDIVALSG HTLGRCHKERSGFEGPWT Sbjct: 121 DKPEPPPEGRLPDATKGCDHLRQVFVTQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT 180 Query: 181 PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHM 240 NPLIFDNSYF LL G++EGLL LPSDKALL DP FRPLVEK H+ Sbjct: 181 SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPLVEKYAADEDAFFEDYKEAHL 240 Query: 241 RLSELGFAEA 250 +LSELGFA+A Sbjct: 241 KLSELGFADA 250 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24129 (370 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv59489 686 0.0 >Vv59489 Length = 375 Score = 686 bits (1769), Expect = 0.0, Method: Compositional matrix adjust. Identities = 323/362 (89%), Positives = 342/362 (94%) Query: 9 GDFPAVPSHGGQYIQYNIFGNLFEITNKYRPPIMPIGRGAYGIVCSVLNSETKEMVAIKK 68 DFPAVP+HGG + Q+NIFGNLFEIT KYRPPIMPIGRGAYGIVCSVLNSET EMVAIKK Sbjct: 14 SDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSVLNSETNEMVAIKK 73 Query: 69 IANAFDNHMDAKRTLREIKLLRHLDHENVIAIRDVIPPPLRREFSDVYIATELMDTDLHQ 128 IANAFDNHMDAKRTLREIKLLRHLDHENVI IRDV+PPPLRREFSDVYIATELMDTDLHQ Sbjct: 74 IANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVVPPPLRREFSDVYIATELMDTDLHQ 133 Query: 129 IIRSNQGLSEEHCQYFMYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP 188 IIRSNQGLSEEHCQYF+YQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP Sbjct: 134 IIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARP 193 Query: 189 TAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFPGKDHVHQM 248 TAENE +TEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR+PLF GKDHVHQM Sbjct: 194 TAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPLFAGKDHVHQM 253 Query: 249 RLLTELLGTPTESDLGFVRNEDARRYIRQLAQHPRQPLERLFPHVNPMAIDLVDRMLTFD 308 RLLTELLGTPTESDLGFVRN+DARRYI QL QHPRQPL +FPH++P+AIDL+DRMLTFD Sbjct: 254 RLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHPLAIDLIDRMLTFD 313 Query: 309 PTRRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLGEEQMKDMIYREAIALNPE 368 PT+RITVE+ALAHPYL RLHD ADEP+C EPFSF+FEQQ L EEQMKDMIY+EA+ NP Sbjct: 314 PTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMKDMIYQEALFFNPG 373 Query: 369 YA 370 YA Sbjct: 374 YA 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2264 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25706 157 6e-41 >Vv25706 Length = 156 Score = 157 bits (398), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 75/96 (78%), Positives = 86/96 (89%) Query: 30 DPNKPKRPASAFFVFMEDFRVKFKKDHPNNKSVAAVGKAGGDKWKSLSEAEKAPYIAKAE 89 DPNKPKRPASAFFVFME+FR ++K+ HP NKSV+ VGKAGGDKWKSLSEAEKAPY+AKAE Sbjct: 43 DPNKPKRPASAFFVFMEEFRKQYKEKHPANKSVSVVGKAGGDKWKSLSEAEKAPYVAKAE 102 Query: 90 KRKAEYTKTMNAYNKRIAEGGNGADDEESDKSKSEV 125 KRK EY K+M AYNKR+AEG A++EESDKS+SEV Sbjct: 103 KRKTEYNKSMQAYNKRMAEGPTAAEEEESDKSRSEV 138 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31892 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21945 (282 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv24066257 139 7e-35 >Vv24066257 Length = 235 Score = 139 bits (349), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 90/210 (42%), Positives = 110/210 (52%), Gaps = 45/210 (21%) Query: 115 FHGQFP-EMATQ-QLRRPKTVPDMASFRNAVGTTASSMELRPKLTKLLLNVTIQGSVGAI 172 FH P MA Q +LRRPKT+PD+ S R +V + S E P+LTKLLLNVT+Q S+G + Sbjct: 27 FHSGIPMTMAPQAELRRPKTLPDLLSGRRSV--SGLSPEGGPRLTKLLLNVTVQRSLGPV 84 Query: 173 QVVMSPELTVGDLVAAAVRQYGKEGRRPILPSVEPSLFDLHYSQFSLES----------- 221 QVVMSP+ TVGDL+AA +RQY KEGRR +LP+ +P+ FDLHYSQFSLES Sbjct: 85 QVVMSPDSTVGDLIAAVLRQYAKEGRRLVLPTTDPAGFDLHYSQFSLESKPSLPISSSLN 144 Query: 222 ---------------------------LAREEKLMELGSRNFFLC---PNAKAVXXXXXX 251 L R EKLM LGSRNFFLC Sbjct: 145 LSRKKKLLLNSTRVVVVINTVFEWTAGLDRNEKLMTLGSRNFFLCCKKSEPDVGESAVEA 204 Query: 252 XXXXXXXXXXXXXXXVSRNGFAWLKFMNFM 281 VS+ WLKF++F+ Sbjct: 205 SETTSSSTCSTEADKVSKISVPWLKFIDFL 234 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6378 (299 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2986 219 7e-59 >Vv2986 Length = 300 Score = 219 bits (557), Expect = 7e-59, Method: Compositional matrix adjust. Identities = 144/305 (47%), Positives = 165/305 (54%), Gaps = 19/305 (6%) Query: 5 LGFWVVEVKAGEPLKVVPEESSVIHLSQATLGELKK--GGDQCVIHVKVGNQKLVLANLS 62 + FW VEVKAGE KV E+ ++HLSQA LGE KK G + + +K+ QKLVL L Sbjct: 1 MEFWGVEVKAGESFKVKSEDDKILHLSQAALGESKKEKGNESVPLFLKIDQQKLVLGTLL 60 Query: 63 SDKIPQIPFDLVFDKEFELSHNLKSGSVHFCGYQTCL--AXXXXXXXXXXXXXXLPLNFT 120 IPQ+ FDLVFDKEFELSHN K+GSV F GY++ L LP+N Sbjct: 61 PANIPQLSFDLVFDKEFELSHNWKNGSVFFMGYKSVLPDEEEFSEFDDSDSEEDLPVNAI 120 Query: 121 DNGK----VVAAKPAPPKTNAVKPESSGKQKVNIVEPIKXXXXXXXXXXXXXXXXXXXXX 176 +NGK V AK P NA GK KV + EP K Sbjct: 121 ENGKPEPKVEQAKAVPTNANA------GKAKVKVEEPPKDAKDEEDDDDDSDEDMVDEDS 174 Query: 177 XXXXXMLGAXXXXXXXXXXXXXXXTPTPKKN---SKKRPNESTPKTPVSAKKAKQVTPQK 233 TPKK KKRP ES KTPV AKKAK V+PQK Sbjct: 175 DEDSDEDIMSDAEDGSDEGSESEDEETPKKKVEPGKKRPTESATKTPVPAKKAKLVSPQK 234 Query: 234 TDGKKG-AHTATPHPAKKGGKTPATSDKSKPQTPKSAGGDHSCKPCNKSFNSDGALSSHK 292 TDGKKG AHTATPHP KK GKTPA+ DK K Q+PKS GG SCK C+K+FNS+ AL SH Sbjct: 235 TDGKKGGAHTATPHPNKKAGKTPASGDKGKGQSPKS-GGQVSCKSCSKTFNSENALQSHS 293 Query: 293 KAKHG 297 KAKHG Sbjct: 294 KAKHG 298 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27175 (545 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig168 (522 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv37379 172 2e-44 >Vv37379 Length = 504 Score = 172 bits (435), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 127/413 (30%), Positives = 205/413 (49%), Gaps = 25/413 (6%) Query: 105 LGHHAGYYRLPRSNAASMFYLFFESRTNKNNPVVI-WLTGGPGCSS-ELALFYENGPFRI 162 + GY + S +++Y F E+ +K + ++ WL GGPGCSS E GPFR+ Sbjct: 93 FSQYGGYVTIDESKGKALYYYFAEAPLSKKSLPLLLWLNGGPGCSSLAYGAMQELGPFRV 152 Query: 163 Q-KNLSLTWNDYGWDKASNILFVDQPVGTGFSYTTNSADIRHD-EEGVSNDLYDFLQEFF 220 + +L N Y W+K +N+LF++ P G GFSY+ ++D R+ + + D Y FL + Sbjct: 153 HSEGKTLYRNQYAWNKVANVLFLESPAGVGFSYSNTTSDYRNGGDRKTAKDNYAFLVNWL 212 Query: 221 TQHPQFAKNDFYITGESYAGHYVPALASRVHKGNKAKEGTHINLKGFAIGNGLTNPEIQY 280 + P++ K DFYI+GESYAGHYVP LA + NK +G INLKG IGN + N E Sbjct: 213 ERFPEYKKRDFYISGESYAGHYVPQLAHTILHHNKKADGPIINLKGIIIGNAVINDETDE 272 Query: 281 KAYSDYALEMKLITKPDYDSISQIIPDCEESAKACAAS----TSGDACENSLSICNSIVN 336 Y L+++ +I Q+ C S A + S + D ++++ + + I N Sbjct: 273 LGMYQYFGSHALVSE---KTIRQMEKHCNFSPGAASQSKECTKASDEVDDNIDVID-IYN 328 Query: 337 QIMQIISDTNHYDIRKKC--EGSLCYDFSNMETFLNKQPVRDALGVGDIEFVSCSTTVYD 394 + +TN KK E C D+ + +LN+ V+ AL + D Sbjct: 329 IYAPLCFNTNLTVKPKKVTPEFDPCSDYY-VYAYLNRADVQKALHANVTKLKYDWEPCSD 387 Query: 395 AMQNDWMRNLEVGIPAL---LEDGIKLLVYAGEYDFICNWLGNSKWVHAMEWSGQKAFGA 451 +QN W + IP L +E+G+++ V++G+ D + M+ S + + Sbjct: 388 VIQN-WTDSPSTIIPLLHEFMENGLRVWVFSGDTDGRVPVTSTMASIDTMKLSVKTPWH- 445 Query: 452 AQTVPFKVAGAEAGLLKSH-GPLAFLKVHDAGHMVPMDQPEAALQMLTNWMQG 503 P+ VAG G + + G L F V AGH VP +P+ AL ++++++ G Sbjct: 446 ----PWFVAGEVGGYTEVYKGDLTFATVRGAGHQVPSFRPKRALSLISHFLSG 494 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21943 (420 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26272 62 2e-11 >Vv26272 Length = 357 Score = 62.4 bits (150), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Query: 14 YYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDP---EKFKELAQAYEVLSDPEKREIY 70 YYE+LG+ KS + +D++KAY+K ++K HPDK P E FK +++A++ LS+ E R+ Y Sbjct: 114 YYEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNEESRKKY 173 Query: 71 DQYGED 76 D G D Sbjct: 174 DLVGSD 179 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13021 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4163 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2565 (144 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv51469 137 6e-35 >Vv51469 Length = 240 Score = 137 bits (346), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 4/147 (2%) Query: 1 MIKYGLNLR---GQQKKQPTRPPVPKPLGFGXXXXXXXVEKEISRQASKNKSLKDIEEQQ 57 M KYGL LR QQKKQPTRPP+P PLGF +E+EISRQASKNK+LKDIEEQ Sbjct: 1 MKKYGLQLRVPPSQQKKQPTRPPLPPPLGFCDENEDD-IEREISRQASKNKTLKDIEEQH 59 Query: 58 RKALEQDPSVFDYDGVYDQMKQKAIQPRVQDRQERMARYIPGXXXXXXXXXXXXXXXYKR 117 +KALE+DP+ FDYD VY++MK+K I+P QDRQER +YI Y++ Sbjct: 60 KKALEEDPTAFDYDDVYEEMKEKTIRPLAQDRQERKPKYIQKLIEKAKQREREHEIIYEK 119 Query: 118 KLTKERNQEDHLHANKERFVHSAYQKK 144 KL KER+++D L+A+K++F+ AY+KK Sbjct: 120 KLVKERSKDDALYADKDKFITGAYKKK 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10760 (403 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10288 (79 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11716 (294 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31627 410 e-116 >Vv31627 Length = 419 Score = 410 bits (1053), Expect = e-116, Method: Compositional matrix adjust. Identities = 190/293 (64%), Positives = 236/293 (80%) Query: 1 MLARPGANILLPKPCFPIYELCSAFRHLEIRHFDLLQENAWEVDLDAVEALADHNTVAMV 60 +LARPGANILLP+P FP YE +A +LE+RHFDLL E WEVDL+AV+ALAD NTVAMV Sbjct: 126 VLARPGANILLPRPGFPYYEARAAADNLEVRHFDLLPEQGWEVDLEAVKALADENTVAMV 185 Query: 61 IINPGNPCGNVYSYQHLEKIAETAKKLRIPVIADEVYGHLAFGDKPFVPMGVFGSTVPVL 120 I+NPGNP G+V++Y+HL+K+AETA+ L I VI+DEVYGHLAFG KPFVPMGVFGS VP++ Sbjct: 186 IVNPGNPSGSVFTYEHLKKVAETARNLGIMVISDEVYGHLAFGSKPFVPMGVFGSIVPIV 245 Query: 121 TLGSLSKRWIVPGWRLGWFVTTDPCGMFRIPKVIERIKKYFDILGGPATFIQAAVPRILQ 180 T+GS+SKRW+VPGWRLGW VT D G+ V+E I +I PATFIQ A+P IL+ Sbjct: 246 TVGSISKRWVVPGWRLGWLVTNDLNGILHKSGVVESIISCLNISSDPATFIQGAIPEILE 305 Query: 181 QTEEAFFKKTLYLLKQSSDICWDRINEIPCLTCPSKPEGSMAVMVKLDLSLLEDINDDIE 240 +T+E FF T+ +L++ +DI DRI IPC+TCP KPEGSM VMVKL+L LLEDI+DD+E Sbjct: 306 KTKEDFFSNTISILRECADIIHDRIKGIPCITCPQKPEGSMFVMVKLNLFLLEDIDDDVE 365 Query: 241 FCFKLVKEENVIFLPGTAVGLTSWIRVTFAADPSSIEEALRRTKSFYQRHARK 293 FC KL KEE+VI LPG +VG+ +W+RVTFA DP S+E+ L R K+FYQRHA+K Sbjct: 366 FCMKLSKEESVIVLPGVSVGMKNWLRVTFAIDPPSLEDGLGRIKAFYQRHAKK 418 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig491 (109 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12174 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11104 (287 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2422 553 e-159 >Vv2422 Length = 289 Score = 553 bits (1425), Expect = e-159, Method: Compositional matrix adjust. Identities = 260/285 (91%), Positives = 274/285 (96%) Query: 1 MFMATYEAITKGNPMWNQLSVPSGTLYAWDPKSTYIHEPPYFKDMTMSPPGAHGVKNAYC 60 MF ATYEAIT+GNPMWNQLSVPS TLY WDPKSTYIH+PPYFK MTMSPPG HGVK+AYC Sbjct: 1 MFKATYEAITQGNPMWNQLSVPSSTLYTWDPKSTYIHDPPYFKSMTMSPPGPHGVKDAYC 60 Query: 61 LLNFGDSITTDHISPAGSIHKDSPAAKYLLERGVDRRDFNSYGSRRGNDEVMARGTFANI 120 LLNFGDSITTDHISPAGSIHKDSPAA+YL+ERGVDRRDFNSYGSRRGNDE+MARGTFANI Sbjct: 61 LLNFGDSITTDHISPAGSIHKDSPAARYLMERGVDRRDFNSYGSRRGNDEIMARGTFANI 120 Query: 121 RLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKG 180 R+VNK LKGEVGPKT+HIP+GEKLSVFDAAMRYKSEG DTIILAGAEYGSGSSRDWAAKG Sbjct: 121 RIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKG 180 Query: 181 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEI 240 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK G+DA++LGLTG ERYTIDLPSSVSEI Sbjct: 181 PMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEI 240 Query: 241 RPGQDITVVTDNGKSFICTLRFDTEVELAYFDHGGILQYVIRNLI 285 +PGQDITVVTDNGKSF CT+RFDTEVELAYFDHGGILQY IRNLI Sbjct: 241 KPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNLI 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226784313 (64 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig120 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10854 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv161 107 2e-25 >Vv161 Length = 95 Score = 107 bits (267), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 49/94 (52%), Positives = 70/94 (74%) Query: 109 MKEVSSAEDLVESLSNAGDKLVIVDFFSPGCGGCKALHPKICQLAEMNPDVQFLQVNYEE 168 M ++ S ++ + +LS AGDKLVIV+F+ C C+AL PK+C+ A+ P++ FL+VN++E Sbjct: 1 MIDIHSMQEFLSALSQAGDKLVIVEFYGTWCASCRALFPKLCKTAQDYPNIIFLKVNFDE 60 Query: 169 HKSMCYSLNVHVLPFFRFYRGAHGRLCSFSCTNA 202 +KSMC SLNV +LP F FYRG+ G L SFSC+ A Sbjct: 61 NKSMCKSLNVKMLPCFHFYRGSDGLLESFSCSLA 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20988 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12973 (141 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18043 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430564 (131 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11290 (316 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8600 117 3e-28 >Vv8600 Length = 128 Score = 117 bits (292), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 57/119 (47%), Positives = 76/119 (63%), Gaps = 2/119 (1%) Query: 198 APVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVG 257 P LP W+TEE+L KF +SGFTGGLNYYRA++L+WEL PW G +I +P K I G Sbjct: 9 TPSLLPTWITEEELGVYADKFQESGFTGGLNYYRAMDLSWELLAPWQGSKITIPSKLIFG 68 Query: 258 ELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEKPDEVSQHVYDFIKKF 316 + D+ + G + YI FK VP EVV+++G HFI +EKP +VS + F+ KF Sbjct: 69 DKDIGFKDGGTKEYIEGNTFKTLVP-DHEVVILDG-HHFIQEEKPQQVSAEILSFLAKF 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48289683 (134 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14109 59 3e-11 >Vv14109 Length = 388 Score = 58.9 bits (141), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 23/119 (19%) Query: 8 LRKEPMTVYGDGKQTRSFQYVSDLVEGLMRLMEGE-----HVGPFNLGNPG-EFTMLELA 61 LR EP+ + G+ R+F Y+ D +E ++ +++ H+ FN+GNP E T+ +LA Sbjct: 244 LRHEPLKLVDGGQSQRTFVYIKDAIEAVLLMIDNPARANGHI--FNVGNPNNEVTVRQLA 301 Query: 62 KVVQE--------------TIDPEAKIEYRPNTEDDPHKRKPDITKAKDLLGWQPKVSL 106 +++ E T+D +K E+ DD KR PD+T LGW PK SL Sbjct: 302 EMMTEVYAKVSGEPSLEVPTVDVSSK-EFYGEGYDDSDKRIPDMTIINKQLGWNPKTSL 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9025 (213 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv52321 298 5e-83 >Vv52321 Length = 214 Score = 298 bits (763), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 142/213 (66%), Positives = 168/213 (78%) Query: 1 MAPVKVHGNVLSVCTRRVIAALYEKDIKFELVPIDLGTGEHKKEPFISLNPFGEVPAFED 60 MA +KVHG+ S T RV+AALYEK ++FE V ID+ G+HK E F++LNPFG+VPAFED Sbjct: 1 MAVLKVHGSPFSTATMRVVAALYEKGLEFEFVTIDMKAGQHKSEAFLALNPFGQVPAFED 60 Query: 61 GDLKLFESRAITQYIVHEYADKGTPLVFQDSKKMAMIAVGCEVEGQKFDPAASKLTFEQV 120 GDLKLFESRAI QYI HEYA GT L+ DSKKMA+++V EVE ++DP A+KL FE Sbjct: 61 GDLKLFESRAIAQYIAHEYASNGTQLICPDSKKMAIMSVWMEVEAHQYDPHAAKLCFELC 120 Query: 121 IKPMLKMPTDAAVVEEYEAKLAVVLDVYEIRLAQSKYLAGERFTLADLHHIPTIHYLMGT 180 IKPML + TD A VE+ EAKL VLDVYE RL QSKYL G+ LADLHH+PT+HYL+G+ Sbjct: 121 IKPMLGLTTDPAAVEDLEAKLGKVLDVYEARLTQSKYLGGDCLGLADLHHLPTLHYLLGS 180 Query: 181 QSKKLFVSRPHVSAWVADITARPAWKKVIALQK 213 +KKLF SRPHV AWVADITARPAW KVIA+QK Sbjct: 181 SAKKLFDSRPHVCAWVADITARPAWAKVIAMQK 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48486593 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33207 146 9e-38 >Vv33207 Length = 185 Score = 146 bits (368), Expect = 9e-38, Method: Compositional matrix adjust. Identities = 68/77 (88%), Positives = 75/77 (97%) Query: 1 CARNEYCESAIDFIARRSRLAFLDTDAASRALPRVIEILATEHNWDDSRQKYELEKAKEF 60 CARNEYCESAIDFIARRSRLAFLDTDAASRALPR+IEILATEHNWD +R+K EL+KAKEF Sbjct: 108 CARNEYCESAIDFIARRSRLAFLDTDAASRALPRIIEILATEHNWDRTRKKKELQKAKEF 167 Query: 61 LKTFKSSKNAQFHDGKH 77 L+TFKSS+NAQF+DGKH Sbjct: 168 LETFKSSRNAQFYDGKH 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7482 (223 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3410 105 6e-25 >Vv3410 Length = 180 Score = 105 bits (262), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 57/138 (41%), Positives = 87/138 (63%), Gaps = 2/138 (1%) Query: 77 NELKRVFQMFDRNGDGRITKQELNDSLENLGIYIPDKELFNMIEKIDVNGDGCVDIDEFG 136 +E K F +FD++GDG IT +EL + +LG + EL +MI ++D +G+G +D EF Sbjct: 11 SEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70 Query: 137 ELYQSIMXXXXXXXXMKEAFNVFDQNGDGFITVDELRSVLSSLGLKQGRTIEDCKRMIMK 196 L M +KEAF VFD++ +GFI+ ELR V+++LG K T E+ MI + Sbjct: 71 NLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEK--LTDEEVDEMIRE 128 Query: 197 VDVDGDGRVNFKEFRQMM 214 DVDGDG++N++EF ++M Sbjct: 129 ADVDGDGQINYEEFVKVM 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23598 (52 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24142 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27809 (198 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16472 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25307 115 5e-28 >Vv25307 Length = 113 Score = 115 bits (287), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Query: 1 SLKRDVLPYLVRRQLNSEVS-NGAPQPEENGNEKASSQSNQLVISRILANSSTPSFHELY 59 SL++DVLPYLVR QL SE+S NGAP EENG++K NQ+++S++LA +STPSFHELY Sbjct: 32 SLQQDVLPYLVRSQLRSELSLNGAPHTEENGHDKVVPGINQVMLSQLLAKTSTPSFHELY 91 Query: 60 ALGCNGSTPAQRTHKCCVYIA 80 A+G NGS P +RTHKCCVYIA Sbjct: 92 AMGPNGSAPVRRTHKCCVYIA 112 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 221848062 (107 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22837 (259 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32625 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51293454 (68 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27725 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812619 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4947 116 1e-28 >Vv4947 Length = 441 Score = 116 bits (290), Expect = 1e-28, Method: Composition-based stats. Identities = 52/101 (51%), Positives = 74/101 (73%), Gaps = 1/101 (0%) Query: 3 TPPMIITENGMDDPNKRFIPLEKALNDEKRITFHRDYLSNLSAAIRQDNCDVRGYFVWSL 62 +PP+ +TENGMDD + PL + L+D+ R+ + + YL++++ AI+ D DVRGYF WSL Sbjct: 332 SPPIYVTENGMDDEDNDTSPLHEMLDDKLRVFYFKGYLASVAQAIK-DGVDVRGYFAWSL 390 Query: 63 LDNWEWNMGYTVRFGLYYVDYKKNLTRIPKTSVQWFRTLLQ 103 LDN+EW+ GYT RFGL YVDY+ +L+R PK+S WF L+ Sbjct: 391 LDNFEWSQGYTKRFGLVYVDYRNDLSRHPKSSALWFLRFLR 431 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51239599 (64 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7788 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 333 2e-93 >Vv12866259 Length = 264 Score = 333 bits (855), Expect = 2e-93, Method: Compositional matrix adjust. Identities = 172/219 (78%), Positives = 182/219 (83%), Gaps = 4/219 (1%) Query: 46 WYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLG 105 WYGPDRV YLGP S PSYL GEFPGDYGWDTAGLSADPE FAKNR LEVIH RWAMLG Sbjct: 48 WYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG 107 Query: 106 ALGCITPEVLEKWVRVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVIL 165 ALGC+ PE+L + V F E VWFKAGAQIFSEGGLDYLGNP+L+HAQSILA+ QVIL Sbjct: 108 ALGCVFPELLSR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL 166 Query: 166 MGLVEGFRINGLDGVGEGNN-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMF 224 MG VEG+RI G +GE + LYPGG FDPLGLADDP FAELKVKEIKNGRLAMFSMF Sbjct: 167 MGAVEGYRIAG-GPLGEVTDPLYPGGS-FDPLGLADDPEAFAELKVKEIKNGRLAMFSMF 224 Query: 225 GFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPG 263 GFFVQAIVTGKGPLENL DHL +PV NNAW YAT FVPG Sbjct: 225 GFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098750 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5249 (345 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9610 (418 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51561065 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763001 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18983 (177 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6600 (197 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20959 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21511 (225 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19272 155 7e-40 >Vv19272 Length = 242 Score = 155 bits (391), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 80/207 (38%), Positives = 121/207 (58%), Gaps = 15/207 (7%) Query: 12 TVRVDAKKLKYLEFVQVAAIYVVVCFSSLYEYAKENSGPLKPGVQTVEGTVRTVIGPVYE 71 + ++ ++LK+L FV++AAI +VC S+LY YAK+NSGPL+ V VE V VI PVY+ Sbjct: 3 SCEMEKRELKHLGFVRIAAIQALVCVSNLYYYAKQNSGPLRSTVGAVEDAVTAVISPVYD 62 Query: 72 KLHGLPFQFLKFVDRKVDESLSEVDRHVP-----------VLVKQASSQALSVAREVEQG 120 K G+P L F+D+KVDE ++ D+H P LV +AS A ++ E + G Sbjct: 63 KFKGVPDHLLVFMDKKVDEVSAKFDKHAPPVAKEVVGQAQCLVLKASKTAQTLVSEAKAG 122 Query: 121 GLVSTAKNITVSVYYKYEPVAEQYAVSAWRALNRLPLFPLVAQIIVPTVSYWSGKYNRAV 180 G + ++ + Y+ V W LN++PLF VA + VPT ++WS KYN V Sbjct: 123 GPSAALQHAATA----YKLFMLTQLVKLWFILNKVPLFHTVADMAVPTAAHWSDKYNHVV 178 Query: 181 GYTANRGYSVAAYLPLIPTERIAKVFE 207 + +GY++ Y PL+P ++IAK F+ Sbjct: 179 TDMSVKGYTIFGYFPLVPIDKIAKTFK 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2618 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv45791 239 2e-65 >Vv45791 Length = 161 Score = 239 bits (609), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 116/157 (73%), Positives = 129/157 (82%), Gaps = 1/157 (0%) Query: 5 KQVMVIGADDSEEGHYALEWTLDHLFKPLGGDTAPFKLIIVHAKPXXXXXXGFVGPAGAE 64 K VMV+G DDSE YAL+WTLDH F P G TAPFKL+IVHAKP G GP A+ Sbjct: 6 KSVMVVGVDDSEHSFYALQWTLDHFFAPFPG-TAPFKLVIVHAKPSPTTAIGLAGPGAAD 64 Query: 65 VLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASILVVG 124 VLP V+ADLKK+A RV +A E CASKSVTDV++EV+EGDARNV+CEAVE+HHASILVVG Sbjct: 65 VLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASILVVG 124 Query: 125 SHGYGAIKRALLGSVSDYCAHHVHCTVMIVKKPKTKH 161 SHGYGAIKRA+LGSVSDYCAHH HCTVMIVKKPK KH Sbjct: 125 SHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIKH 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7125 (102 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240999 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28471 (397 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18742 (277 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46602678 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48940805 (139 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26077 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9979 (342 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14109 114 4e-27 >Vv14109 Length = 388 Score = 114 bits (284), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 98/347 (28%), Positives = 155/347 (44%), Gaps = 50/347 (14%) Query: 30 MRILVTGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKDNLK----KWIGHPRFEL--I 83 M I + G GFIGSHL +KLM ++V+ D Y K L+ W +F I Sbjct: 17 MTICMIGAGGFIGSHLCEKLMAETMHKVLAVDVYSDKIKHLLEPSTHPWSDRIQFHRINI 76 Query: 84 RHDV-TEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLT 142 +HD E L+ D +LA +P Y P+ TI +N I L ++ R++ Sbjct: 77 KHDSRLEGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSENNKRLIHF 136 Query: 143 STSEVYGDPL--IHPQTENYWGN--------------VNPI-GVRSCYDEGKRVAETLMF 185 ST EVYG + P+ W + PI R Y K++ E L++ Sbjct: 137 STCEVYGKTIGSFLPKDSPLWQDPTYYVLKEDASPCIFGPIEKQRWSYACAKQLIERLIY 196 Query: 186 DYHRQHGIEIRIARIFNTYGPRMNIDDG---------RVVSNFIAQAIRNDPLTVQAPGT 236 ++ +E I R FN GPRM+ G RV++ F +R++PL + G Sbjct: 197 AEGAENDLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRHEPLKLVDGGQ 256 Query: 237 QTRSFCYVSDMVDGLIRLMQG---DNTGPINIGNP-GEFTMLELAENVKELI-----NPK 287 R+F Y+ D ++ ++ ++ N N+GNP E T+ +LAE + E+ P Sbjct: 257 SQRTFVYIKDAIEAVLLMIDNPARANGHIFNVGNPNNEVTVRQLAEMMTEVYAKVSGEPS 316 Query: 288 VEIIMVENTP--------DDPRQRKPNISKAKELLGWEPKVKLREGL 326 +E+ V+ + DD +R P+++ + LGW PK L + L Sbjct: 317 LEVPTVDVSSKEFYGEGYDDSDKRIPDMTIINKQLGWNPKTSLWDLL 363 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56433206 (151 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26683 290 7e-81 >Vv26683 Length = 361 Score = 290 bits (743), Expect = 7e-81, Method: Compositional matrix adjust. Identities = 138/150 (92%), Positives = 144/150 (96%) Query: 1 MVFPGFWMDIGQPRDYITGLRLYLDSLRKNSSSKLARGAHIVGNVLVDETAKIGEGCLIG 60 MV PGFWMDIGQPRDYITGLRLYLDSLRK SSSKLA GAHIVGNVLVDE+AKIGEGCLIG Sbjct: 211 MVLPGFWMDIGQPRDYITGLRLYLDSLRKKSSSKLASGAHIVGNVLVDESAKIGEGCLIG 270 Query: 61 PDVAIGPGCIIESGVRLSRCTVMRGVRIKNHACISSSIIGWHSTVGQWARVENMTILGED 120 PDVAIGPGC++E+GVRLSRCTVMRGVRIK HACISSSIIGWHSTVGQWARVENMTILG+D Sbjct: 271 PDVAIGPGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGKD 330 Query: 121 VHVSDEIYSNGGVVLPHKEIKSSILKPEIV 150 VHV DEIYSNG VVLPHK+IKSSILKPEIV Sbjct: 331 VHVCDEIYSNGSVVLPHKKIKSSILKPEIV 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51240017 (71 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9527 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3309 127 1e-31 >Vv3309 Length = 273 Score = 127 bits (320), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 73/192 (38%), Positives = 100/192 (52%), Gaps = 12/192 (6%) Query: 58 PPYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILVPEALGL----- 112 P YL G PGD+G+DP L + PE+ +++ ELIH RWAML G ++PEA Sbjct: 75 PAYLTGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAAGFIIPEAFNKFGANC 134 Query: 113 ---GNWVKAQEWAAVPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQRSMEK-DPEKK 168 W K + G Y G +P + + V E + + E+ R + D E K Sbjct: 135 GPEAVWFKTGAL-LLDGNTLNYFGKNIPINLIFAV-VAEVVLVGGAEYYRIINGLDLEDK 192 Query: 169 KYPGGAFDPLGYSKDPXXXXXXXXXXXXNGRLALLAFVGFVVQQSAYPGTGPLENLATHL 228 +PGG FDPLG + DP NGRLA+ A +GF + Q+ G GP+ENLA HL Sbjct: 193 LHPGGPFDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFI-QAYVTGEGPVENLAAHL 251 Query: 229 ADPWHNNIGDVI 240 +DP+ NN+ VI Sbjct: 252 SDPFGNNLLTVI 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812892 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26368 (216 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2678 91 2e-20 >Vv2678 Length = 232 Score = 90.5 bits (223), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 66/187 (35%), Positives = 98/187 (52%), Gaps = 14/187 (7%) Query: 30 LLKDYMNGTEGTSFMYPSAIGQFRKQFAYLEENGGKSGPVIPPERKHVSLPRSTVHSSTV 89 +LK+Y+ GTE TSFMYPSA+ QF+KQFAYLEE+ G V PPER+H SLPR V S Sbjct: 1 MLKEYLEGTEPTSFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHASLPRPCVLYSD- 59 Query: 90 PPNAQSNLVSYENRQTQEASSSFRVTDTISGNAPKVSRPPPRVP------TAKPGRVVGP 143 N+ N + ++ ++R P +VP A+PG+VVG Sbjct: 60 --NSLHNSAEVADDLSKCCIKEVEKPHMDRSCGIPMARLPLQVPQSTQGGAARPGKVVGS 117 Query: 144 ILPYEN--GRNVKEMYDPRMLYRN-AVPPQSVSPHCFF-RIHTANQDKAGVEVQRYESHA 199 +L Y N E+ + R + RN V Q + C + R +++ +++ G + + E Sbjct: 118 VLRYNNCGAAAAAEVLEQRRMVRNPPVASQYNASSCSYPRRNSSCKNERG-DNEGVEGSN 176 Query: 200 KLQPQPE 206 LQP+P+ Sbjct: 177 GLQPKPQ 183 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11002 (231 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18726 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14855 (300 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10804 (576 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41033 384 e-108 >Vv41033 Length = 703 Score = 384 bits (986), Expect = e-108, Method: Compositional matrix adjust. Identities = 252/614 (41%), Positives = 328/614 (53%), Gaps = 73/614 (11%) Query: 27 LVELSASDNLDAFRTEVEEKGFHVDEAGFWYGRRIGSKQMGFEERTPLMIAAMFGSTKVL 86 L+EL+A++++ F+ +E + VDE G WYGR+ GSKQM E RTPLM+AA +GS V+ Sbjct: 15 LLELAANNDVGRFKQSIEREPSGVDEIGQWYGRQKGSKQMVLEYRTPLMVAATYGSIDVM 74 Query: 87 KYIIESGMVDVNRSCGSDRVTALHCAAAGGSTASLEVVKLLLDASADANCVNAYGNSPVD 146 K I+ DVNR CG D+ TALHCAA+GGS +++VVKLLL AD N ++A G+ PVD Sbjct: 75 KLILSLSDSDVNRFCGLDKSTALHCAASGGSVNAVDVVKLLLLVGADPNSLDANGHRPVD 134 Query: 147 LIA--PALKSPCSSRRKAMEMLFRGDKSVMESD-------------------------QI 179 ++ P L+ + +E L + S +E + Sbjct: 135 VLVVPPKLQD----VKATLEELLATNGSSVERNLSISTVTSNSNSSPLSSSPENGSSSSD 190 Query: 180 AIEEGDQRKVSSPQMPKE-GSDKKEYPIDISLPDINNGIYGTDEFRMFTFKVKPCSRAYS 238 + V +P S+KKEYP+D SLPDI N IY TDEFRMF+FKV+PCSRAYS Sbjct: 191 SDSPPSPMNVKLNDLPISCASEKKEYPVDPSLPDIKNSIYATDEFRMFSFKVRPCSRAYS 250 Query: 239 HDWTECPFVHPGENARRRDPKKYPYSCVPCPEFRKGSCQKGDACEYAHGVFESWLHPAQY 298 HDWTECPFVHPGENARRRDP+K+ YSCVPCP+FRKG+C++GD CEYAHGVFE WLHPAQY Sbjct: 251 HDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQY 310 Query: 299 RTRLCKDETGCTRKVCFFAHRPEELRPVYASTGSAMPSPR--SMSVSAADMAT---LSPL 353 RTRLCKD T C R+VCFFAH EELRP+Y STGSA+PSPR S + +A D AT L P Sbjct: 311 RTRLCKDGTNCNRRVCFFAHTTEELRPLYMSTGSAVPSPRPSSSTATAMDFATAMNLIPG 370 Query: 354 ALGXXXXXXXXXXXXXXXXXXXXXXXKNGGLWQNKVSLTPPTLQLPG-----SRLKSACS 408 + + G Q V PTL LPG SRL+S+ + Sbjct: 371 SPSSVSVMSPSPFTPPLSPSANGVSHSSMGWAQPNV----PTLHLPGSNLQSSRLRSSLN 426 Query: 409 ARDXXXXXXXXXXDXXXXXXXXXXXXXXLWDEIXXXXXXXXXXXXGELKPTNLEDAFGSF 468 ARD D L L P+NL++ F + Sbjct: 427 ARDIPAEDINLMLDFDIQQHQLLNELSCLSQPCVNSNSLNRSGRSKTLTPSNLDELFSAE 486 Query: 469 DPSLLSQLQAHSQKPSTPTHR-------QNMNQLRSSYPTNLSSSPVRKP------SSFG 515 S QA + +PTH+ Q + S TN S V P +S G Sbjct: 487 SSSPRYSDQALASAVYSPTHKSAVLNQFQQQQSMLSPINTNFSPKNVDHPLLQASFASSG 546 Query: 516 LDSPSALA-AAVMNSRSAAFAQQ--------RSQSFIDRGAMNHLSGLNAPVNSSTMRQS 566 SP ++ + M+SR++ FAQ+ RS S D G+ N + + +P+NS + S Sbjct: 547 RMSPRSMEPISPMSSRASMFAQREKQQQQQFRSLSSRDLGS-NSSAIVGSPINSWSKWGS 605 Query: 567 S----DWSSPGGKL 576 S DW+ +L Sbjct: 606 SNVKPDWAMNANEL 619 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15399 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28902 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33350 361 e-102 >Vv33350 Length = 189 Score = 361 bits (926), Expect = e-102, Method: Compositional matrix adjust. Identities = 171/185 (92%), Positives = 177/185 (95%) Query: 20 MVNGSLKQFLQKKDRTIDRRKRLIIAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQR 79 MVNGSLKQFLQKKDRTIDRRKR IIAMDA+FGMEYLHGKNIVHFDLKCENLLVNMRDP R Sbjct: 1 MVNGSLKQFLQKKDRTIDRRKRRIIAMDASFGMEYLHGKNIVHFDLKCENLLVNMRDPHR 60 Query: 80 PVCKIGDLGLSKVKQQTLVSGGVRGTLPWMAPELLSGKSNMVTEKIDVYSFGIVMWELLT 139 PVCKIGDLGLSKVKQ TLVSGGVRGTLPWMAPELLSGK+NMVTEKIDVYSFGIVMWELLT Sbjct: 61 PVCKIGDLGLSKVKQHTLVSGGVRGTLPWMAPELLSGKTNMVTEKIDVYSFGIVMWELLT 120 Query: 140 GDEPYRDMHCASIIGGIVNNTLRPQIPPWCDPEWKSLMESCWAPEPSQRPSFSEISQKLR 199 GDEPY DMHCASIIGGIVNNTLRPQIP WC+PEWK LMESCWA +P++RPSFSEISQKLR Sbjct: 121 GDEPYADMHCASIIGGIVNNTLRPQIPRWCEPEWKYLMESCWASDPAERPSFSEISQKLR 180 Query: 200 NMAAA 204 NMA A Sbjct: 181 NMADA 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5567 (69 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9875 (275 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46022 328 5e-92 >Vv46022 Length = 288 Score = 328 bits (842), Expect = 5e-92, Method: Compositional matrix adjust. Identities = 172/273 (63%), Positives = 203/273 (74%), Gaps = 13/273 (4%) Query: 16 KTLALYTPKXXXXXXXXXXXXGCKPISISASFLNSGKGFQSVSSRFVRNVAVSSEFEQDE 75 KTLA+ P K S S S +GF ++SSRFVRNVAVSS++EQDE Sbjct: 16 KTLAISKPTSLSFFSLPFSCSSLKLHSNKISLSPSSRGFLTLSSRFVRNVAVSSDYEQDE 75 Query: 76 EVLSDDGEAS--PEPKLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGF 133 +VLSD+GE S P+ KLFVGNLPF+VDSA LAG+FE AGNVEMVEVIYDK TGRSRGFGF Sbjct: 76 DVLSDEGEPSFSPDLKLFVGNLPFNVDSAGLAGLFEQAGNVEMVEVIYDKITGRSRGFGF 135 Query: 134 VTMSNVQEAESAARQLNGYELDGRALRVNYGPPPPRTEDSSFXXXXXX-----------X 182 VTMS V+E E+AA+Q NGYEL+GR LRVN GPPP R E+S+F Sbjct: 136 VTMSTVEEVEAAAQQFNGYELEGRQLRVNSGPPPARRENSNFRGENTNFRGENTNFRGPR 195 Query: 183 XXXXYDSNNRLYVGNLAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTA 242 +S NR+YVGNL+WGVD+LALE LFSEQGKV EA+V++DR++GRSRGFGFVTY++A Sbjct: 196 GGANLNSTNRIYVGNLSWGVDDLALETLFSEQGKVTEARVIYDRETGRSRGFGFVTYNSA 255 Query: 243 DEMNSAIESLDGVDLNGRSIRVSAAEPRPRRQF 275 +E+N AIESLDGVDLNGRSIRV+ AE RPRRQF Sbjct: 256 EEVNRAIESLDGVDLNGRSIRVTMAEARPRRQF 288 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30141 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825009 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23931 158 5e-41 >Vv23931 Length = 251 Score = 158 bits (400), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 72/125 (57%), Positives = 96/125 (76%), Gaps = 1/125 (0%) Query: 1 MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKYGTGGNWIALPQKAGLRRCGKSCRLRWLN 60 MGR+PCC+KA+ KG W+ EED +L YI +G G W +LP+ AGL RCGKSCRLRW+N Sbjct: 1 MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGC-WRSLPKAAGLLRCGKSCRLRWIN 59 Query: 61 YLRPNIKHGEFSDEEDRIICNLFTNIGSRWSIIAAQLPGRTDNDIKNYWNTKQKKKLMGI 120 YLRP++K G F++EED +I L + +G++WS+IA +LPGRTDN+IKNYWNT ++KL+ Sbjct: 60 YLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNR 119 Query: 121 SILPS 125 I PS Sbjct: 120 GIDPS 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15951 (84 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15346 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18366261 143 2e-36 >Vv18366261 Length = 172 Score = 143 bits (360), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 75/187 (40%), Positives = 100/187 (53%), Gaps = 19/187 (10%) Query: 3 EEHRCEAPEGHHLCANNCGFFGSPATMNLCSKCYRDFCLKEQQQASIKSTVEXXXXXXXX 62 +E C+APEG LC NNCGFFGS ATMN+CSKC++D LK++Q S++ Sbjct: 5 DETGCQAPEGPILCINNCGFFGSAATMNMCSKCHKDLALKQEQAKLAASSI--------- 55 Query: 63 XXXXXXXXXXXXXXXXXXXXXXXXIETLCQPPPPALTLPEVAGDIIGEPAEVVRAPEVAT 122 ++ P E + D +++ + Sbjct: 56 ----GSIVNGSSSGNGKEPIVAGTVDVQAGPVEVKAISTEASND--SSSNQIIESK---- 105 Query: 123 VVSQPNRCTVCRKRVGLTGFKCRCGTTFCGVHRYPEKHACSFDFKTLGREEIARSNPLVI 182 V PNRCT CRKRVGLTGF C+CG FC VHRY +KH C FD++T R+ IA++NP+V Sbjct: 106 VKEGPNRCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYRTAARDAIAKANPVVK 165 Query: 183 AEKLEKI 189 AEKL+KI Sbjct: 166 AEKLDKI 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48418420 (167 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31648 (296 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26640 395 e-112 >Vv26640 Length = 292 Score = 395 bits (1015), Expect = e-112, Method: Compositional matrix adjust. Identities = 204/298 (68%), Positives = 223/298 (74%), Gaps = 11/298 (3%) Query: 4 FLHFPAVSTLPSSFPGAFFPARPKPTSLFHHR-----VKCRYGEVNVKTDFNSATIDVVA 58 L ++S L +S FP P+ HHR V+ Y E VK D SATIDV A Sbjct: 1 MLSLSSISPLKTSPCRTHFPL---PS---HHRFCRFGVRSSYAEAGVKGDSKSATIDVEA 54 Query: 59 DVKPERVVVLGGTGFVGSAICKAAVSRGIEVVGVSRSGRPTYSGAWIDQVNWVPGDVFYV 118 DVK ERVVVLGG GFVGSAICKAAVS+GIEV +SRSGRP+ S +W+DQVNWV GDVFYV Sbjct: 55 DVKSERVVVLGGNGFVGSAICKAAVSKGIEVTSLSRSGRPSQSSSWVDQVNWVTGDVFYV 114 Query: 119 NWDEVLIGATAVVSTIGGFGSEEQMQRINGEXXXXXXXXXKDYGVPKFILISVHDYNLPP 178 NWDEVL+GATAVVST+GGFGSEEQM+RINGE KDYGVPKFILISVHDYNLP Sbjct: 115 NWDEVLVGATAVVSTLGGFGSEEQMKRINGEANVLAVGAAKDYGVPKFILISVHDYNLPQ 174 Query: 179 FLLSSGYFTGKRKAESEVLSKYPNSGIVLRPGFIYGKRRVDGFEIPLDFIGEPLERFIKA 238 FLL SGYFTGKRKAESEVLSKYPNSG+VLRPGFIYGKRRVDGFEIPLD IGEPLE+ ++A Sbjct: 175 FLLDSGYFTGKRKAESEVLSKYPNSGVVLRPGFIYGKRRVDGFEIPLDLIGEPLEKILRA 234 Query: 239 TENFTKXXXXXXXXXXXXXXXXXVDDVALAAINGIRDDDFFGIFTIAQIKEAAEKVRV 296 TEN T+ VDDVALAA+N I DDDFFGIFTI QIKEAA KV V Sbjct: 235 TENLTRPLSALPASDLILAPPVSVDDVALAAVNAITDDDFFGIFTIEQIKEAAAKVSV 292 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26608 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31562 122 1e-30 >Vv31562 Length = 105 Score = 122 bits (306), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 57/105 (54%), Positives = 71/105 (67%) Query: 1 MQSDGSETLSPTTLRLQSLSAADTRGKHRIHAELKXXXXXXXXXXXXXXXXXKMDKASSA 60 MQS S+ + +L+AADTRGKHRI AELK K ++AS+A Sbjct: 1 MQSGNSQAAPSINHQDSALAAADTRGKHRITAELKRLEQEARFLEEELEQLEKTERASAA 60 Query: 61 CKEILNSAETRPDPLLPITHGPLNPFWDRWFEGPQDSKGCRCWIL 105 C+E+L+ E+RPDPLLP+T+GP NP WDRWFEGPQDS+GCRCWIL Sbjct: 61 CRELLSIVESRPDPLLPVTYGPANPIWDRWFEGPQDSQGCRCWIL 105 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26019 (320 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36576 611 e-177 >Vv36576 Length = 514 Score = 611 bits (1576), Expect = e-177, Method: Compositional matrix adjust. Identities = 287/320 (89%), Positives = 302/320 (94%) Query: 1 MGIGFLGIGFQPKWGLKDIPIMPKGRYDIMRNYMPTVGTLGLDMMFRTCTVQVNLDFSSE 60 MGIGFLGIGFQPKW +KDIPIMPKGRY+IMRNYMP VG+LGLDMMFRTCTVQVNLDFSSE Sbjct: 195 MGIGFLGIGFQPKWAIKDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSE 254 Query: 61 ADMIRKFRAGLALQPIATALFANSPFTEGKPNGFLSMRSQIWTDTDNNRTGMLPFVFDDS 120 DMIRKFR GLALQPIATALFANSPF EGKP+G+LSMRSQIWTDTDNNRTGMLPFVFD S Sbjct: 255 TDMIRKFRVGLALQPIATALFANSPFVEGKPSGYLSMRSQIWTDTDNNRTGMLPFVFDGS 314 Query: 121 FGFEQYVDYALDVPMYFVYRNKKYIDCTGMTFRDFLVGKLPCIPGELPTLNDWENHLTTI 180 FGFEQYVDYALDVPMYFVYR KKYIDCTGM+FRDF+ GKLP +PGELP NDWENHLTTI Sbjct: 315 FGFEQYVDYALDVPMYFVYRKKKYIDCTGMSFRDFIAGKLPSLPGELPNFNDWENHLTTI 374 Query: 181 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQMLRN 240 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQN LD+ ADWT EERQMLRN Sbjct: 375 FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDIIADWTLEERQMLRN 434 Query: 241 KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL 300 KVP TGLKTPFRDGLLKHVA+DV+KLA+DGLERRGFKETGFLN VAEVVRTGVTPAEKLL Sbjct: 435 KVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKETGFLNAVAEVVRTGVTPAEKLL 494 Query: 301 ELYNGKWGQQIDPVFEELLY 320 E+Y+G WGQ +DPVFEELLY Sbjct: 495 EMYHGPWGQCVDPVFEELLY 514 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10738 (362 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49087 552 e-159 >Vv49087 Length = 362 Score = 552 bits (1422), Expect = e-159, Method: Compositional matrix adjust. Identities = 263/361 (72%), Positives = 300/361 (83%) Query: 1 MAKAPEQEHPVKAFGWAARDTSGHLSPFNFSRRSTGDEDVRFKVLYCGICHTDLHNIKNE 60 MAK+PE+EHPVKAFGWAARD SGHLSPFNFSRR+TG+EDVRFKVLYCGICH+DLH+IKNE Sbjct: 1 MAKSPEEEHPVKAFGWAARDHSGHLSPFNFSRRATGEEDVRFKVLYCGICHSDLHSIKNE 60 Query: 61 WGISLYPMVPGHEIVGEVTEVGSKVSKVKEGDKVGVGCMVGACHACESCNSNLENYCPKM 120 WG + YPMVPGHEIVG VTEVGSKV K K GDKVGVGC+VGACH+CESC+ +LENYC K+ Sbjct: 61 WGNAAYPMVPGHEIVGVVTEVGSKVEKFKVGDKVGVGCLVGACHSCESCSDDLENYCSKL 120 Query: 121 ILTYGSIYADRTVTYGGYSDTMVANERYIVRFPENLPLDAGAPLLCAGITVYSPLKYFGL 180 ILTY Y D T TYGGYSDTMVA ERY+VR P+N+PL AGAPLLCAGITVYSPLKYFG Sbjct: 121 ILTYNMPYHDGTRTYGGYSDTMVAPERYVVRIPDNMPLAAGAPLLCAGITVYSPLKYFGF 180 Query: 181 AEPXXXXXXXXXXXXXXXXXXFAKAFGAKVTVISTSPSKKDEALKQLGADSFVVSRDPQQ 240 +P FAKAFG KVT+ISTSPSKK EA++ LGADSF+VSRDP+Q Sbjct: 181 TQPGMHIGIVGLGGLGHVAAKFAKAFGVKVTLISTSPSKKKEAIEHLGADSFLVSRDPEQ 240 Query: 241 MQAAIGTLDGIIDTVSAAHPIVXXXXXXXXXXXXXXVGVPEKPLDLHVFPLIMGRKSVAG 300 MQAA+GT+DGI+DTVSA HP++ +GVPEKPL+L F LIMGRK+VAG Sbjct: 241 MQAAMGTMDGILDTVSATHPLLPLLGLLKNNGKLILLGVPEKPLELPAFSLIMGRKTVAG 300 Query: 301 SGIGGMKETQEMIDFAAKHNITADVEVISMDYVNTAMERLAKNDVRYRFVIDVGNTLAAS 360 SGIGGMKETQEM+DFAAKHN+TAD+EV+ MDYVNTAMERLAK DVRYRFVID+GN+L+A+ Sbjct: 301 SGIGGMKETQEMLDFAAKHNVTADIEVVPMDYVNTAMERLAKADVRYRFVIDIGNSLSAT 360 Query: 361 K 361 K Sbjct: 361 K 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939202 (75 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13757 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11706 (247 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3252 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32030 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23881 167 1e-43 >Vv23881 Length = 84 Score = 167 bits (422), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 75/84 (89%), Positives = 84/84 (100%) Query: 86 MKKGQIVRVEKDKYLNSVNYLSVGHPPYYKGLDYIYEDRGEILDLRIFETGEYALVAWVG 145 MKKGQIVRV+K+KYLNS+NYLSVGHPPYYKGLDYIYEDRGE+LDLRIFETGEYAL+AWVG Sbjct: 1 MKKGQIVRVDKEKYLNSINYLSVGHPPYYKGLDYIYEDRGEVLDLRIFETGEYALIAWVG 60 Query: 146 VPTAPAWLPTDMLIRSDKLDYERL 169 +PTAPAWLPTDMLI+SDKL+YER+ Sbjct: 61 IPTAPAWLPTDMLIKSDKLNYERM 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046338 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17483 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10998 (258 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53234 347 1e-97 >Vv53234 Length = 261 Score = 347 bits (890), Expect = 1e-97, Method: Compositional matrix adjust. Identities = 178/267 (66%), Positives = 190/267 (71%), Gaps = 17/267 (6%) Query: 1 MDGGAPYNPRTVEEVFRDFKGRRAGMIKALTTEVEDFFQQCDPEKENLCLYGFPSEQWXX 60 MDGGA YNPRTVEEVFRDFKGRRAGMIKALTT+V++F+QQCDPEKENLCLYGFP+E W Sbjct: 1 MDGGANYNPRTVEEVFRDFKGRRAGMIKALTTDVDEFYQQCDPEKENLCLYGFPNELWEV 60 Query: 61 XXXXXXXXXXXXXXXXGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR 120 GINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR Sbjct: 61 NLPAEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDAWLLAVAFYFGARFGFDKADR 120 Query: 121 KRLFNMINELPTIFEVVTGTAKKQVKEXXXXXXXXXXXXXXXXXXX----------XEPQ 170 KRLFNMIN+LPTIFEVVTGTAKKQVKE E Q Sbjct: 121 KRLFNMINDLPTIFEVVTGTAKKQVKEKSSVSNHSSNKSKSNSKVVPQQQQPQQRGSESQ 180 Query: 171 PRHSKALQSKDAXXXXXXXXXXXXXXXXXXXXTLCGACGENYAADEFWICCDICEKWFHG 230 ++SK Q + TLCGACGENYA+DEFWICCDICEKWFHG Sbjct: 181 GKYSKTPQKDEDEGLEEEEEDEHGE-------TLCGACGENYASDEFWICCDICEKWFHG 233 Query: 231 KCVKITPARAEHIKQYKCPSCSNKRAK 257 KCVKITPARAEHIKQYKCPSCSNKR++ Sbjct: 234 KCVKITPARAEHIKQYKCPSCSNKRSR 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7431 (376 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22383 (371 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65578 157 3e-40 >Vv65578 Length = 265 Score = 157 bits (397), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 86/215 (40%), Positives = 124/215 (57%), Gaps = 11/215 (5%) Query: 20 MLDMGFEPQIRKIVKEIPARRQTLMYTATWPKEVRKIAADLLVKPVQVNIGNVDELVANK 79 MLDMGFEPQIR++++ +P + QTL+++AT P E+ +A + L PVQV +G V AN Sbjct: 1 MLDMGFEPQIREVMQNLPQKHQTLLFSATMPMEIETLAQEYLNNPVQVKVGKVSCPTAN- 59 Query: 80 SITQYVEVLTSMEKHRRLEQLL--------RSQEPGSKIIIFCSTKKMCDQLSRNLTRQ- 130 ++Q +E ++ EK L LL R P I+F K CD+++ L Q Sbjct: 60 -VSQILEKVSESEKIDGLLALLVEEASQAERCGRPFPLTIVFVERKTRCDEVTEALVAQG 118 Query: 131 FGAAAIHGDKSQSERDYVLNQFRSGRTPILVATDVAARGLDIKDIRVVINYDFPTGVEDY 190 A A+HG +SQ+ER+ L FR+G T ILVATDVA+RGLD+ + VIN D P +E+Y Sbjct: 119 LRAVALHGGRSQAEREAALRDFRNGATNILVATDVASRGLDVTGVAHVINLDLPKAMENY 178 Query: 191 VHRIXXXXXXXXXXLAYTFFGDQDAKYASDLIKVL 225 VHRI A +F+ D+D + + K + Sbjct: 179 VHRIGRTGRAGSTGQATSFYTDRDVFLVAHIRKAI 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762459 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv318 86 2e-19 >Vv318 Length = 316 Score = 85.9 bits (211), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/67 (59%), Positives = 49/67 (73%) Query: 26 PGSLDEKKTEGSVIRFRRGASSATFDPTRVSQLTWRPRAFLFKGFLSEEECDHLIEIVND 85 PG + EKKT GSV+ + ++ FDPTRV+QL+WRPRAFL+KGFLSEEECDHLI + D Sbjct: 25 PGWVGEKKTGGSVLGLKPRGFASGFDPTRVTQLSWRPRAFLYKGFLSEEECDHLITLAKD 84 Query: 86 FLPYIFV 92 L V Sbjct: 85 KLEKSMV 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8707 (249 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60295 255 6e-70 >Vv60295 Length = 246 Score = 255 bits (651), Expect = 6e-70, Method: Compositional matrix adjust. Identities = 142/256 (55%), Positives = 171/256 (66%), Gaps = 18/256 (7%) Query: 1 MYPGGYTAEVTSLSPKATEEDVYNFFGHCGAVEHVEIIRSG-EYASTAYVTFRDAFALQT 59 M G+T EVTSLSPK TE+DVY+FF GA+E VE++RS E A TAYVTF+DA+A++T Sbjct: 1 MSTSGHTIEVTSLSPKVTEKDVYDFFAFSGAIERVEMVRSADECACTAYVTFKDAYAVET 60 Query: 60 AILLSGARIVDQCVCITSWGSYIDESDAWNGSTYPEGNTSSTTYHSSQFVSTP--GEAVT 117 A+LLSGA IVDQ VCIT WG Y DE D WN T+ + +S+T+ S P GEAVT Sbjct: 61 AVLLSGATIVDQRVCITRWGHYEDEFDLWNRPTWKLEDETSSTHAPETNRSYPDAGEAVT 120 Query: 118 ----VVKTLASKGYVLGKDALTKAKAFDESHQLSATAAAKVCELSDRIGLTEKIHAGREV 173 VVKT+ +KGY+LGKDAL+KAK FDESHQLSATA A V ELS RIGLT+K AG E Sbjct: 121 MAQEVVKTMLAKGYILGKDALSKAKTFDESHQLSATAVATVAELSQRIGLTDKFCAGVEA 180 Query: 174 VKTVDEKFHVSDITKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFAKGALWFSDVL 233 K+VD+++HVS+ITKS YF+KGALW SD L Sbjct: 181 AKSVDQRYHVSEITKS-----------AVSATGRTAAAAATTVVNSSYFSKGALWVSDAL 229 Query: 234 TRASKAAADLGSHGGN 249 +RA+KAA DLGSHG N Sbjct: 230 SRAAKAAGDLGSHGVN 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20751 (177 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25548 (443 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23825 218 2e-58 >Vv23825 Length = 355 Score = 218 bits (554), Expect = 2e-58, Method: Compositional matrix adjust. Identities = 139/242 (57%), Positives = 166/242 (68%), Gaps = 16/242 (6%) Query: 4 YTHAGDEATDFDEYDPTPYGGGYDIYLTFGRPLDPSDETCYPNSSPSDDFDYERPQFSSY 63 Y D + +FDEYDPTPYGGGYDI +T+GRPL+PS+ETCYP SS S D DY+RP ++S Sbjct: 3 YNRNEDVSDEFDEYDPTPYGGGYDITVTYGRPLEPSEETCYPISSKSGDIDYDRPSYTSC 62 Query: 64 SEPSAYADEALEDEYTHYARPAHRPGPAVGFNXXXXXXXXXXXXXXQPAYGFQP------ 117 SEPSAY DEALE+EY YARP +P P +G+ YG+QP Sbjct: 63 SEPSAYGDEALENEYKSYARP--KPRPVLGYAGPPPGQGGFGGSGDGGEYGYQPKPPSSF 120 Query: 118 GGEERPEFGSERPESGYGRKPXXXXXXXXXXXXXXRRPEADEPSSEY-TGYGRKPEHEEP 176 GGE E+GS G+GRKP R+PE ++PSSEY +GYGRKPE+E+P Sbjct: 121 GGE--GEYGS-----GHGRKPDYEEPSSEYGSGYGRKPECEQPSSEYGSGYGRKPEYEQP 173 Query: 177 ESEYGSGHGRKPEYKAPEPEYGSGYGRKPEYEAPESEYGSGYGRKPEFEAPPAEFGSGYG 236 SEYGSG+GRKPEY+ P EYGSGYGRKPEYE P SEYGSGYGRKPEFE P +E+GSGYG Sbjct: 174 SSEYGSGYGRKPEYEQPSTEYGSGYGRKPEYEQPSSEYGSGYGRKPEFEQPSSEYGSGYG 233 Query: 237 RK 238 R+ Sbjct: 234 RR 235 Score = 80.5 bits (197), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 57/105 (54%), Positives = 68/105 (64%), Gaps = 7/105 (6%) Query: 132 SGYGRKPXXXXXXXXXXXXXXRRPEADEPSSEY-TGYGRKPEHEEPESEYGSGHGRKPEY 190 SGYGRKP R+PE ++PSSEY +GYGRKPE E+P SEYGSG+GR+PEY Sbjct: 179 SGYGRKPEYEQPSTEYGSGYGRKPEYEQPSSEYGSGYGRKPEFEQPSSEYGSGYGRRPEY 238 Query: 191 KAPEPEYGSGYGRKPEYEAPESEYGSGYG-----RKPEFEAPPAE 230 +AP EYGSGYGRKP + E G GYG RKP++ P E Sbjct: 239 EAPSSEYGSGYGRKPSF-GEEQSGGYGYGGERSPRKPQYGRPSYE 282 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17706 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7548 (182 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2475 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv1885 68 4e-14 >Vv1885 Length = 65 Score = 67.8 bits (164), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/64 (57%), Positives = 46/64 (71%) Query: 32 NTQKMSYNAGVAKGQAQEKTSTMMDKANSAAQSAMGTMQGAGQTVQAKAVGAVDAVKNAT 91 ++ K SY AG AKG+ Q KT MMDKA A +SA + Q AGQ ++AKA GAV+A K+AT Sbjct: 2 DSSKTSYKAGEAKGEVQAKTEKMMDKAGDACKSAKESCQDAGQQMKAKAEGAVEAAKDAT 61 Query: 92 GMNK 95 GMNK Sbjct: 62 GMNK 65 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig94 (796 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15448 (464 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5117 174 3e-45 >Vv5117 Length = 304 Score = 174 bits (441), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 92/272 (33%), Positives = 154/272 (56%), Gaps = 12/272 (4%) Query: 122 VIDIEVGLGPAGELRYPSYPE-SQGWAFPGIGEFQCFDKYLQAEFKEAATAAGHPEWAL- 179 + I +GLGP GELRYPS+ S+ PG+GEFQC+DK + + K+ A A G+P W L Sbjct: 5 ITGISMGLGPDGELRYPSHHRVSKRGKVPGVGEFQCYDKNMLSLLKQHAEATGNPYWGLG 64 Query: 180 -PDNAGEYNDTPESSEFFRSNG-TYVTEKGKFFLTWYSNKLMIHGDQILDEANKVFVGCK 237 P +A +Y+ P S+ FFR +G ++ T G FFL+WYSN+L+ HG +L A+ VF Sbjct: 65 GPHDAPQYDGMPNSNNFFREHGGSWETPYGDFFLSWYSNQLISHGSSLLSLASTVFCNSP 124 Query: 238 LKLAAKVSGIHWWYEVDNHAAELTAGYYNLKDRDGYRPIARMLSRHHAILNFTCLEMRNS 297 + ++ KV +H WY+ +H +ELTAG+YN D+DGY IA + +++ + +++ + Sbjct: 125 VAISGKVPVVHSWYKTRSHPSELTAGFYNTVDKDGYERIAEIFAKNSCKMILPGMDLSDD 184 Query: 298 EQSADAKSAPEELVQQVLSGGWRENIEVAGENALSRYDSVAYDQILLNARPNGINKDGQP 357 Q ++ S+PE L+ Q+ S + ++++G+N+ ++Q+ + N + +DG Sbjct: 185 HQPQESLSSPELLLAQIKSACRKRGVQISGQNSSVSGAPGGFEQV----KKNLLGEDGVV 240 Query: 358 KLRMYGVTYLRLSDELLQKTNLDIFKIFVKKM 389 L TY R+ + F V+ + Sbjct: 241 DL----FTYQRMGAYFFSPEHFPSFTELVRSL 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48389300 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226779431 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21759 (271 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1132 (265 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 389 e-110 >Vv12866259 Length = 264 Score = 389 bits (998), Expect = e-110, Method: Compositional matrix adjust. Identities = 200/270 (74%), Positives = 216/270 (80%), Gaps = 11/270 (4%) Query: 1 MATS--AIQQSAFAGQTAL--KQSSELVRKIGGLGGGRFSMRRTVKSAPQ-SIWYGPDRP 55 MA S A+ +FAG T +S++ LGGGR SMR+T AP S WYGPDR Sbjct: 1 MAASIMALSSPSFAGTTVKLGPNASDI------LGGGRVSMRKTGFKAPSGSPWYGPDRV 54 Query: 56 KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP 115 YLGP S PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFP Sbjct: 55 LYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP 114 Query: 116 EILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYR 175 E+LSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG +EGYR Sbjct: 115 ELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYR 174 Query: 176 VXXXXXXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKNGRLAMTSMFGFFVQAIVTG 235 + +FDPLGLADDPEAFAELKVKE+KNGRLAM SMFGFFVQAIVTG Sbjct: 175 IAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTG 234 Query: 236 KGPVENLFDHIADPVANNAWAYATNFVPGK 265 KGP+ENL DH+ADPV NNAWAYATNFVPGK Sbjct: 235 KGPLENLADHLADPVNNNAWAYATNFVPGK 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7338 (61 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790703 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30575 (332 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793466 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14959 (537 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747176 (216 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24186 (249 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20266261 157 2e-40 >Vv20266261 Length = 185 Score = 157 bits (396), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 76/110 (69%), Positives = 89/110 (80%) Query: 8 EPLKLLCSYGGKILPRHSDGTLRYVGGHNRVLSVDSSITYTELMVKLAELCGYSVELRCP 67 + +K LCSYGGKILPR+ DG LRY GG RVL+VD SI++ EL+VKL ELCG SV LRC Sbjct: 6 QTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDRSISFAELLVKLGELCGKSVCLRCQ 65 Query: 68 LPNGDLETLISVKSDEDLANIIEEYGRASSPPHSLKIRAILSPPKSLKQI 117 LP DL+ L+SV SDEDLAN+IEEY R +SPP SLKIRA LSPPKS+K+I Sbjct: 66 LPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRAFLSPPKSIKKI 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13327 (496 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27867 (626 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5104 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48485736 (99 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825476 (185 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46147 215 4e-58 >Vv46147 Length = 284 Score = 215 bits (548), Expect = 4e-58, Method: Compositional matrix adjust. Identities = 98/114 (85%), Positives = 109/114 (95%) Query: 72 MNPFCIPFSTTNMGSAMLAMDLGWMGPNYSISTACATSNFCMLNAAYHISRGETDLMLCG 131 MNPFC+PF+TTNMGSAMLAMDLGWMGPNYSISTACATSNFC+LNA+ HI RGE D+MLCG Sbjct: 1 MNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNASNHIIRGEADMMLCG 60 Query: 132 GSEAAIIPIGLGGFLACKALSQRNSEPTKASCPWDINRDGFVIGEGAGVLLLEE 185 GS+AAIIPIGLGGF+AC+ALSQRN++PTKAS PWD NRDGFV+GEGAGVLLLEE Sbjct: 61 GSDAAIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEE 114 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8734 (260 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2047 212 7e-57 >Vv2047 Length = 147 Score = 212 bits (539), Expect = 7e-57, Method: Compositional matrix adjust. Identities = 98/146 (67%), Positives = 115/146 (78%) Query: 114 MAQKGLDQHILRRGILDVEYKRVPCEYKNQNLSLRVEESSQKPHYLAVKILYQGGQTEIV 173 MA KG+ Q IL+ G++DVEYKRV C Y QNL++RVEE SQKPHYLA+K+LYQGGQTEIV Sbjct: 1 MANKGMGQQILKLGLVDVEYKRVLCNYNKQNLAIRVEEMSQKPHYLAIKVLYQGGQTEIV 60 Query: 174 AMDVAQVGSSNWSFLSRNNGAIWKTSRVPAGALQFRFVVTSGYDGKTVWAPNVLPVNWKS 233 MDVAQV SS W++++RN GAIW TS VP+G LQ RFVVT GYDGK VWA VLP +WK Sbjct: 61 GMDVAQVDSSRWTYMTRNYGAIWDTSNVPSGPLQLRFVVTGGYDGKWVWAKKVLPADWKV 120 Query: 234 GMIYDTRVQITDIAQEGCPHCDDGSW 259 G YD VQI+DIAQE C CD+ +W Sbjct: 121 GETYDAGVQISDIAQEPCYPCDNENW 146 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22044 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14960 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3685 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91019281 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2468 (203 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6539 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33277 241 4e-66 >Vv33277 Length = 254 Score = 241 bits (616), Expect = 4e-66, Method: Compositional matrix adjust. Identities = 115/162 (70%), Positives = 130/162 (80%) Query: 1 MLKSPTNSHAKEAAVRIXXXXXXXXXXXXXXXXXXXXQGGKVAAIMVARVTAITCQWLMG 60 M+KS +NS KEAAVRI GGKVAA+MVARVTA++CQWLMG Sbjct: 86 MMKSKSNSKVKEAAVRILISLFPPFLLDLYRMLVAPIGGGKVAAMMVARVTALSCQWLMG 145 Query: 61 PCTVNSVDLPDGTSWNSGVFVEKCKYLEESKCVGICLNTCKLPTQAFIKDYMGVPLVMEP 120 PCTVNSV+LPDG+S +SGVFVE+CKYLEESKCVGIC+NTCKLPTQ F KDYMGVPL MEP Sbjct: 146 PCTVNSVNLPDGSSCSSGVFVERCKYLEESKCVGICINTCKLPTQTFFKDYMGVPLAMEP 205 Query: 121 NFVDYSCQFKFGVLPPLPEDDATLKEPCLEICPNATRRREIA 162 +F +YSCQF FGVLPP PE+D+TLKEPCLEICPNATRR+EI Sbjct: 206 DFTNYSCQFSFGVLPPRPEEDSTLKEPCLEICPNATRRKEIT 247 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14670 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7487 (238 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91039667 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226781173 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10909 (570 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48282335 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25141 (352 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41423 315 6e-88 >Vv41423 Length = 360 Score = 315 bits (808), Expect = 6e-88, Method: Compositional matrix adjust. Identities = 170/357 (47%), Positives = 229/357 (64%), Gaps = 17/357 (4%) Query: 9 KDVLPFTAMVTVECTNVGLNVLFKAATLKGLSYYVFIVYSNXXXXXXXXXXXXXXXNPRT 68 +DV+ F+AMV +ECTNVGLN L+KAATL+GL+Y+VF+VY+ + R Sbjct: 8 RDVVSFSAMVALECTNVGLNTLYKAATLRGLNYHVFVVYA-YGIAALVLLPSPFITHRRG 66 Query: 69 GLPSFNXXXXXXXXXXXXXXXXADLCGYIGINYSSPTLDSAMSNLTPAFTFILAVFFRME 128 LP + + GY GIN SSPTL SA+SNL PAFTFILAV FRME Sbjct: 67 VLPPLSFPVLCKIFVLGLIGCASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRME 126 Query: 129 SLALRSYSTQAKIMGTLVSISGALVVVLYKGPTILSTPSDPNPSPMLGTPP-------TN 181 LALRS S+QAKI+GT+VSISGA VV LYKGP I+ TPS PS L PP ++ Sbjct: 127 KLALRSSSSQAKIIGTIVSISGAFVVTLYKGPPIILTPS---PSISLHQPPHPLRSSESS 183 Query: 182 WVIGGLLCALQFLLNSTWYILQTHVMKAYPAEIVLVFLYNLCGTIISAPVCFIAETNLSA 241 W+IG L ++++ L WYI+Q H++K YP+E +VF YNL ++++A V + E N S Sbjct: 184 WIIGALFLSVEYFLTPVWYIVQAHIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTEPNSSV 243 Query: 242 WRLRPDIALVAIIYSGCLGSSFGSLVHTWALHLKGPVYISIFKPXXXXXXXXXXVIFLGD 301 W +RP IAL +I+ SG GS G+ +HTWA+ +KGPVY+++FKP V LGD Sbjct: 244 WIVRPRIALASIVCSGIFGSFLGNTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGVALLGD 303 Query: 302 ALSLGSVVGAIILSLGFYAVIWGKSKEEQMKPLPIG------MGKAPLLESYKVENM 352 +L LGSV+GA I+++GFY V+WGK++E+ ++ IG KAPLL++YK E + Sbjct: 304 SLYLGSVIGATIITMGFYTVMWGKAQEDMVEDCTIGSLESPSAQKAPLLQNYKTEEI 360 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25777 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6191 112 4e-27 >Vv6191 Length = 244 Score = 112 bits (279), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 58/131 (44%), Positives = 82/131 (62%), Gaps = 20/131 (15%) Query: 39 MSPVQKLYETCKEVFSSGGAGVIPPADD-IQRLSSVLGAIKPADVGLTPDLPY------- 90 M VQKLY CKE S G P +++ + ++ S+L +KP++VGL + Sbjct: 1 MPVVQKLYNACKESSSVDG----PLSEEALGKVRSILDDMKPSNVGLEQEAQLARGWKGS 56 Query: 91 --------FRMTVARRTPAITYLHLYECEKYSMGIFCLPPSGVLPLHNHPGMTVFSKLLF 142 R + P I YLHL+EC+++S+GIFC+PPS ++PLHNHPGMTV SKLL+ Sbjct: 57 MHGANGKKVRNGSHQYPPPIKYLHLHECDRFSIGIFCMPPSSIIPLHNHPGMTVVSKLLY 116 Query: 143 GTMHIKSYDWV 153 GT+H+KSYDW+ Sbjct: 117 GTLHVKSYDWL 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16126 (234 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8538 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14424 (111 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27473 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3581 185 6e-49 >Vv3581 Length = 277 Score = 185 bits (469), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 2/120 (1%) Query: 77 MKKLMRGEEISQLECVVVAKMGDLNSLCDAFRGCHAIFHTSSFIDPHGISGYSEKMAFLE 136 M +L+R EE++QLE VVVAKMGDL+SLCDAFRGCHA+FHTSSFID HG+SGYSE MAFLE Sbjct: 1 MNELLRDEEMNQLESVVVAKMGDLDSLCDAFRGCHAVFHTSSFIDIHGVSGYSEWMAFLE 60 Query: 137 TEGARNVIEACGRAAYAKRCIFTSSLLAAIWTGENYEEKKIIDEYSWTNVDFCRENKLWL 196 TE ARNVIEAC RAAY KRCIFTSSLLA+IWT ++ IIDE W++ +FCR+ KLWL Sbjct: 61 TEAARNVIEACCRAAYVKRCIFTSSLLASIWTDDD--RTGIIDESCWSDEEFCRDRKLWL 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25217 (225 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10895 (272 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12709 (244 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226771428 (71 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21491 (268 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv63082 249 3e-68 >Vv63082 Length = 193 Score = 249 bits (636), Expect = 3e-68, Method: Compositional matrix adjust. Identities = 127/177 (71%), Positives = 140/177 (79%), Gaps = 8/177 (4%) Query: 1 MASTACFXXXXXXXXXXXXXXXXXXXXXVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 MASTACF + +Q+V CRAQKQAA E+ GA VSR Sbjct: 1 MASTACFLHHHALSTPTRVSSQRQLPSL-----RPSQLV-CRAQKQAAN--EDDGAAVSR 52 Query: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGEGFKLSIPAKWNPSK 120 RLALTVLIGAAA+G+KV+PADAAYGE+ANVFGKPK+NTDFLPY GEGFKLSIP+KWNPSK Sbjct: 53 RLALTVLIGAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSK 112 Query: 121 EVEFPGQVLRYEDNFDSNSNVSVTITPTDKKSIADYGSPEEFLAKVDYLLGKQAYFG 177 E EFPGQVLRYEDNFDSNSNVSV ITPTDKKSI DYGSPEEFL+KVD+LLGKQA+FG Sbjct: 113 EREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFG 169 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9606 (242 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10179 (434 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4064 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27821 129 6e-32 >Vv27821 Length = 418 Score = 129 bits (323), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 7/139 (5%) Query: 1 MRWTPELHERFIEAVNRLDGAEKATPKGVLKAMNVEGLTIYHVKSHLQKYRLARYMPEKK 60 ++WTP+LHERFIEAVN+L GA+KATPK V+K M + GLT+YH+KSHLQKYRL++ + + Sbjct: 49 LKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLHGQA 108 Query: 61 EDKKASN------SEEKKATSTINESDGRRKGSIPITEALRLQMEVQKQLHEQLEVQRAL 114 + E A + + S+ ++E L++ +E Q++LHEQLEVQR L Sbjct: 109 NSATSKTVVGERMPEANGALMSSPNIGNQTNKSLHLSETLQM-IEAQRRLHEQLEVQRHL 167 Query: 115 QLRIEDHAKYLQKILENQQ 133 QLRIE KYLQ +LE Q Sbjct: 168 QLRIEAQGKYLQAVLEKAQ 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31570 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10220 (356 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv24025 174 2e-45 >Vv24025 Length = 152 Score = 174 bits (441), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 84/104 (80%), Positives = 94/104 (90%), Gaps = 3/104 (2%) Query: 252 AQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGY 311 AQLRIYNLGNTSPVPVG+LV ILEGLL+ KAKKHVIKMPRNGDVPYTHANV+LAY+DFGY Sbjct: 51 AQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGY 110 Query: 312 KPTTDLASGLRKFVKWYVSYYGIESRVKKEMDSGKKGSQQTDES 355 KP+TDLA+GLR+FVKWYVSYYGI++RVKKE K S Q +ES Sbjct: 111 KPSTDLATGLRRFVKWYVSYYGIQTRVKKET---LKRSDQLEES 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31347 (459 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv1185 392 e-111 >Vv1185 Length = 275 Score = 392 bits (1008), Expect = e-111, Method: Compositional matrix adjust. Identities = 191/274 (69%), Positives = 226/274 (82%), Gaps = 1/274 (0%) Query: 165 MTANPMAWEGSVNPKVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKXXX 224 MT + +A +VNPKV +F QA++CLLPMG+TSENVA R+GV+R+EQDQAAV+SHR+ Sbjct: 1 MTTDNIAGVTTVNPKVDIFAQARDCLLPMGLTSENVAKRYGVTRQEQDQAAVESHRRAAA 60 Query: 225 XXXXGKFKDEIIPVATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTT 283 GKFK+EIIPV+TKIVDPK+GE KPV ISVDDGIR +T + LAKLKP F KDGSTT Sbjct: 61 ASAAGKFKEEIIPVSTKIVDPKTGEVKPVIISVDDGIRPDTNMKSLAKLKPAFAKDGSTT 120 Query: 284 AGNSSQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMXXXXXXXXXXXXXX 343 AGN+SQVSDGAG LLMKRS+A ++GLPILG+FRS++AVGV+P +M Sbjct: 121 AGNASQVSDGAGGALLMKRSLAMKRGLPILGLFRSYAAVGVEPGVMGVGPAVAIPIAAKN 180 Query: 344 XXLELDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLL 403 LE+ DIDLFEINEAFASQY+YC KL LDP+K+NVNGGALA+GHPLGATGAR V+TLL Sbjct: 181 AGLEVADIDLFEINEAFASQYVYCCKKLDLDPKKVNVNGGALALGHPLGATGARCVSTLL 240 Query: 404 HEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDS 437 +EMKRRGKDCR+GVISMCIG+GMGAAAVFERGDS Sbjct: 241 YEMKRRGKDCRYGVISMCIGSGMGAAAVFERGDS 274 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7726 (297 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 225 6e-61 >Vv31003 Length = 427 Score = 225 bits (574), Expect = 6e-61, Method: Compositional matrix adjust. Identities = 119/265 (44%), Positives = 167/265 (63%), Gaps = 5/265 (1%) Query: 14 KVLAVKKLDSSVLPSELSEEFTEIVSSISQLHHPNVTELVGYCSEHGQHLLVYEFHKNGS 73 +V+A+K+LD + L + E F E+++ +S + HPN+ +L+GYC+E Q LLVYE+ GS Sbjct: 135 QVVAIKQLDRNGLQG-IREFFVEVLT-LSSVDHPNLVKLIGYCAEGDQRLLVYEYMPLGS 192 Query: 74 LHDFLHLSDEYNKPLTWNSRVKIALGTARALEYLHEVCSPSIIHKNIKSTNILLDVELNP 133 L + LH KPL WNSR+KIA G A+ LEYLH+ P +I++++K +NILL +P Sbjct: 193 LENHLHDLPPGTKPLDWNSRMKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHP 252 Query: 134 HLSDAGLASSIPNADQ---ALDHNAGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLSGR 190 LSD GLA P D+ + GY AP+ AM+GQ T KSD+Y F VV+LEL++GR Sbjct: 253 KLSDFGLAKVGPTGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGR 312 Query: 191 KAFDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEP 250 KA DN K EQ+LV WA P D S+M DP L G YPV+ L + + A+CVQ +P Sbjct: 313 KAIDNSKGAREQNLVAWARPLFKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQP 372 Query: 251 EFRPPMSEVVQALVRLVQRANMSRR 275 RP +++VV AL L + ++ R Sbjct: 373 NMRPLIADVVTALNYLASQTTLTYR 397 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9034 (386 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16926 425 e-121 >Vv16926 Length = 379 Score = 425 bits (1093), Expect = e-121, Method: Compositional matrix adjust. Identities = 233/388 (60%), Positives = 271/388 (69%), Gaps = 11/388 (2%) Query: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLKKPSSGKRLSKPLKSEIVDLDDDFEADFQEFK 60 MCGGAIISDFI R RR+ DY P LKK +SG SK L SE V+ DDD + + Sbjct: 1 MCGGAIISDFIPASRCRRVDEDYF-PALKKRTSGNHCSKSLWSEAVEDDDDDDFEADFL- 58 Query: 61 XXXXXXXXXXXXXXKPSAFSAGNPSFARGSTAVKSVEFDGQAEKSAKRKRKNQYRGIRQR 120 KPSAFSA P G T +KSVEF+GQAEKSAKRKRKNQYRGIRQR Sbjct: 59 -GFKDDSDDEEDDIKPSAFSAAKP---HGYTGIKSVEFNGQAEKSAKRKRKNQYRGIRQR 114 Query: 121 PWGKWAAEIRDPRKGVRVWLGTFNTXXXXXXXXXXXXXXIRGKKAKVNFPEETPCASAKR 180 PWGKWAAEIRDPRKGVRVWLGTFNT IRGKKAKVNFP+ETP + KR Sbjct: 115 PWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGKKAKVNFPDETPLTAPKR 174 Query: 181 SIKENPQKLIAKTNLNGTQSNPNQNFNFVNDSSEDYYSALGFLDEKPTMNNFRYMSTFPA 240 +IK N QKLI K + N + SN NQ+FNF+N+S ++YYS+L +DEKP+ N + Y +FPA Sbjct: 175 TIKANAQKLIPKGSPNSSHSNLNQSFNFMNNSDQEYYSSL--MDEKPSTNQYGYPDSFPA 232 Query: 241 NEDVALKSSVPSENAPFYFSSDQGSNSFDCSDFGWGEQGSKTPXXXXXXXXXXXXXDNSP 300 N +V LKS PSEN YF+SDQGSNSFDCSD GWGEQG+KTP D S Sbjct: 233 NGEVGLKSLAPSENGRMYFNSDQGSNSFDCSDLGWGEQGAKTP-EISSVLSATLEGDESQ 291 Query: 301 FLEDSNPTKKMKPNSQDLEPPEDNSGKTLSDELSAFE--MKYFQTPYLDESWDASVDAFL 358 F+ED+NP KK+K NSQ+ P E+N+ LS++LSAFE MKYFQ PYLD +W+AS+DA L Sbjct: 292 FIEDANPKKKLKSNSQNAVPVEENTPNGLSEDLSAFESQMKYFQIPYLDGNWEASMDALL 351 Query: 359 NGDATQDGGNPMDLWSFDDLPAIVGGVF 386 +GDA QDGGNPMDLWSFDDLP +VGGVF Sbjct: 352 SGDAAQDGGNPMDLWSFDDLPTVVGGVF 379 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226747027 (190 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9179 229 3e-62 >Vv9179 Length = 371 Score = 229 bits (583), Expect = 3e-62, Method: Compositional matrix adjust. Identities = 109/185 (58%), Positives = 136/185 (73%), Gaps = 3/185 (1%) Query: 4 EPVNVNEYQELARQALPKMYYDFHTGGAEDQHTLKENVEAFRRITLRPRILVDVSRIDMS 63 E NV EY+ +A+Q LPKM +D++ GAEDQ TL +N AF +I RPRIL+DVS+IDM+ Sbjct: 2 EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61 Query: 64 TTVLGYKISAPIMLAPTSMHQLAHPEGEVXXXXXXXXCNTIMILSSISSCTVEEVASSCN 123 TTVLG+KIS PIM+APT+M ++AHPEGE TIM LSS ++ +VEEVAS+ Sbjct: 62 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121 Query: 124 SVRFFQLYVFKRRDISAQIVRRAEENGYKAIVLTVDAPRPGRREADIKNKMVAP---QLR 180 +RFFQLYV+K R + AQ+VRRAE G+KAI LTVD PR GRREADIKN+ P L+ Sbjct: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181 Query: 181 NFEGL 185 NFEGL Sbjct: 182 NFEGL 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30418 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28229 (502 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25763 (139 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16124 (144 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43469 168 4e-44 >Vv43469 Length = 144 Score = 168 bits (426), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 95/124 (76%), Positives = 103/124 (83%) Query: 1 MASLATLAAVQPAAINXXXXXXXXXXKLVVKPTRQSIRTKNIRNGAVVAKYGDKSIYFDL 60 MASLATLAAVQP I KL VKP R+S+R N R GAVVAKYGDKS+YFDL Sbjct: 1 MASLATLAAVQPINIKGLAGSSISGTKLSVKPARRSLRVGNSRAGAVVAKYGDKSVYFDL 60 Query: 61 EDLGNTTGKWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLILGGASTIAYLSAT 120 EDLGNTTG+WD+YGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFL+LGG S +AY+SAT Sbjct: 61 EDLGNTTGQWDVYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGGGSVLAYVSAT 120 Query: 121 ASDD 124 ASDD Sbjct: 121 ASDD 124 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31969 (223 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27622 (223 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5118 (193 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 52024425 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv63497 258 4e-71 >Vv63497 Length = 180 Score = 258 bits (660), Expect = 4e-71, Method: Compositional matrix adjust. Identities = 124/182 (68%), Positives = 147/182 (80%), Gaps = 3/182 (1%) Query: 1 MASSMISSATVSTVYTDRAAPAQASMVAPFTGLKSSSAFPVTRKSN-DITSIASNGGRVQ 59 MASSM+SSATV+T+ +R P QA+MVAP TGLKS S FP TRK+N DITS+ASNGGRV+ Sbjct: 1 MASSMLSSATVATI--NRXTPDQANMVAPSTGLKSLSTFPGTRKANTDITSVASNGGRVR 58 Query: 60 CMQVWPPLGLKKFETXXXXXXXXXXXXAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSP 119 CM+VWP G+ KFET KEVDYLLR NWVPCLEF + + +RE+++SP Sbjct: 59 CMKVWPTEGVMKFETLSYLPPLNDEQLCKEVDYLLRMNWVPCLEFTKLYPYPHREHNRSP 118 Query: 120 GYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYK 179 GYYDGRYWTMWKLPMFGCTDS+QV+KE++EA+ AYPNA IRIIGFDN RQVQCI+FIAYK Sbjct: 119 GYYDGRYWTMWKLPMFGCTDSAQVIKEVQEARTAYPNAHIRIIGFDNTRQVQCIAFIAYK 178 Query: 180 PA 181 P+ Sbjct: 179 PS 180 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13954 (239 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36906 280 2e-77 >Vv36906 Length = 225 Score = 280 bits (716), Expect = 2e-77, Method: Compositional matrix adjust. Identities = 144/238 (60%), Positives = 172/238 (72%), Gaps = 14/238 (5%) Query: 1 MRKPCCEKEGTNKGAWSKQEDQKLIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 60 MRKPCC+K+ TNKGAWSKQEDQKLIDYI+ +GEGCWR+LP+AAGL RCGKSCRLRWINYL Sbjct: 1 MRKPCCDKQDTNKGAWSKQEDQKLIDYIRKNGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60 Query: 61 RPDIKRGNFEQDEEELIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHIRKKLIKMGI 120 RPD+KRGNF +DEE+LIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSH+R+KLI MGI Sbjct: 61 RPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNYWNSHLRRKLINMGI 120 Query: 121 DPNNHRLNQIIPRPNPQNDSVSPAATSSGSMSNINACTKTPLKSSDDQIDHRASEAASVL 180 DPNNHRL+ PRP P ++ + S +N P+KS D + + S+A S L Sbjct: 121 DPNNHRLSHNFPRPR------DPCTAATATSSGLNNHASPPVKSVGD--NDQTSDAGSCL 172 Query: 181 EDETSGPSSRDLNLDLTIAFPEPSLQVEEGMPKLIKGSNTTAREIETNLQHLPTLVLF 238 +D + DLNLD+ I P+PS+ E K +RE+E TL+LF Sbjct: 173 DDNRR--ALPDLNLDVAITIPQPSVDTTEEAKK--HNEPKVSRELEPGPSS--TLLLF 224 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17400 (139 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29641 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12349 (242 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26787 (444 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 467 e-133 >Vv47659 Length = 393 Score = 467 bits (1202), Expect = e-133, Method: Compositional matrix adjust. Identities = 238/381 (62%), Positives = 280/381 (73%), Gaps = 29/381 (7%) Query: 65 IADSYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHHVGNTPNPYEH 124 IAD++NSL++VT+AL +GLESSNLI+GIDFTKSNEWTG SFHRKSLH + NTPNPYE Sbjct: 40 IADNFNSLDQVTDALRESGLESSNLILGIDFTKSNEWTGRHSFHRKSLHAISNTPNPYEQ 99 Query: 125 AISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFY-DDRYCNGFEEVLTRYREIVPKL 183 AISIIG+TL+ FDEDNLIPCFGFGDASTHD+ VFSFY D RYC GFEEVL RY+EIVP L Sbjct: 100 AISIIGRTLSPFDEDNLIPCFGFGDASTHDKYVFSFYPDHRYCRGFEEVLARYKEIVPYL 159 Query: 184 RLAGPTSFAPVIEQAMTIVEESHGQYHVLLIIADGQVTRSVDTERGRLSPQEQNTVNAIV 243 +L+GPTSFAP+I+ A+ IVE S+GQYHVL+IIADGQV+ S+D GR SPQEQ TVN+IV Sbjct: 160 KLSGPTSFAPIIDAAIDIVEGSNGQYHVLVIIADGQVSGSLDGSSGRFSPQEQATVNSIV 219 Query: 244 AASKLPLSIILVGVGDGPWDMMKEFDDNIPTRAFDNFQFVNFTQIMSKNVPPSRKETEFA 303 AAS+ PLSIILVGVGDGPWD MK FDDNIP R+FDNFQFVNF++IMS+N+ S+KET FA Sbjct: 220 AASRYPLSIILVGVGDGPWDAMKLFDDNIPQRSFDNFQFVNFSKIMSENMEASKKETAFA 279 Query: 304 LAALMEIPSQYKATLELSLLGGRKGNIPERVPLPPPVYGASSFSSSKPSRGTGFSTPSFT 363 L+ALMEIP QY+ATL L + P PLPPP + + +T Sbjct: 280 LSALMEIPFQYRATLRLQSIDNNLVGGPRTRPLPPP---KEVLDHDREALQHMMAT---- 332 Query: 364 KPSQTTSYEPSVPPYYGDSSSVGTAPSAPSSTYDHQVCPICLTNSKDMAFGCGHQTCCDC 423 T S E + TAP QVCPICLTN K+MAFGCGH TC +C Sbjct: 333 ----TLSVE----------AVEQTAPV-------DQVCPICLTNPKNMAFGCGHLTCKEC 371 Query: 424 GQDLHSCPICRTTIQTRIKLY 444 G+ + CP+CR I TR+KLY Sbjct: 372 GESISLCPLCREPINTRLKLY 392 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19762 (385 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv28701 600 e-174 >Vv28701 Length = 382 Score = 600 bits (1548), Expect = e-174, Method: Compositional matrix adjust. Identities = 288/384 (75%), Positives = 339/384 (88%), Gaps = 3/384 (0%) Query: 1 MALKAVHVSDVPNLDQVPENASMALYSSRFAKGAEMNRAAPRIPRFLVIGHRGNGMNALQ 60 MALKAVHVSDVP LDQVPENAS+ LYS+RF+ G ++ R++ RIP+FLVIGHRG+GMN LQ Sbjct: 1 MALKAVHVSDVPCLDQVPENASLGLYSTRFSAGVDVGRSSFRIPKFLVIGHRGSGMNMLQ 60 Query: 61 SSDRRMRAIKENSIMSFNAAARFPIDFVEFDVQVTKDDCPVIFHDDFILSEENGTVFQRR 120 SSDRRM+AIKENSI+SFN AA F +DFVEFDVQVTKDD PVIFHD+FI SE+NG V+++R Sbjct: 61 SSDRRMKAIKENSILSFNTAAEFSVDFVEFDVQVTKDDIPVIFHDNFIFSEDNGVVYEKR 120 Query: 121 INELSLSEFLNYGPQREPGKEGKTLLRKTKDGKIVKWDVENDDPLCTLQEAFEQVDPSLG 180 + EL LS+FL YGPQREPGK GK++LRKTKDG+IV W+VE DD LCTL+EAFE+V+PSLG Sbjct: 121 VTELLLSDFLRYGPQREPGKVGKSMLRKTKDGRIVNWNVEADDCLCTLKEAFEKVEPSLG 180 Query: 181 FNIELKFDDNIVYQEDYLFRVLQSVFQVVFECGRDRPIIFSSFQPDAALLVKKLQNTYPV 240 FNIELKFDDNIVY+++YL VLQ++ +VVF+ +DRPIIFS+FQPDAA LV+KLQ++YPV Sbjct: 181 FNIELKFDDNIVYEQEYLTHVLQAIVEVVFQYAKDRPIIFSTFQPDAAQLVRKLQSSYPV 240 Query: 241 FFLTNGGTELYYDVRRNSLEEAIKLCSEGGLQGIVSEVKGVLRNPGAVTKIKEAKLSLLT 300 FFLTNGGTE+YYDVRRNSLEEA+KLC EGGLQGIVS+VK V RNP AVTKIKE+KLSLLT Sbjct: 241 FFLTNGGTEVYYDVRRNSLEEAVKLCLEGGLQGIVSQVKAVFRNPAAVTKIKESKLSLLT 300 Query: 301 YGKLNNVPEAVYMQYLMGVEGVIVDFVKEITEAVSDMIKPLGGAEEDGGKRLLEEDRPMQ 360 YG+LNNV EAVYMQ+LMGVEGVIVD VKEITEAVSD++KP ++E + L E MQ Sbjct: 301 YGQLNNVAEAVYMQHLMGVEGVIVDLVKEITEAVSDLMKP---SKEGDEESLPEGVGQMQ 357 Query: 361 VKSKPEFSERELSFLLKLIPELIQ 384 VKSKP+FS+RELSFLLKLIPELI Sbjct: 358 VKSKPQFSQRELSFLLKLIPELIH 381 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7384 (326 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53094 355 e-100 >Vv53094 Length = 331 Score = 355 bits (910), Expect = e-100, Method: Compositional matrix adjust. Identities = 175/307 (57%), Positives = 220/307 (71%), Gaps = 3/307 (0%) Query: 22 SEGQLVENFYSASCPNVESIVNQAVSRKRDQTIITLAATLRLFLHDCFVEGCDASIIIAS 81 + QL +N+Y+ CPNVE+IV V+ K QT +T+ ATLRLF HDCFV+GCDAS+II+S Sbjct: 25 ASAQLKQNYYANICPNVENIVRGVVNMKFKQTFVTVPATLRLFFHDCFVQGCDASVIISS 84 Query: 82 PNGD-AEKNFADNLSLAGDGFDTVIKAKQAVEAQ--CPGVVSCADILAVAARDCVVLAGG 138 + AEK+ DNLSLAGDGFDTVIKAK V+ C VSCADIL +A RD + L+GG Sbjct: 85 TGSNTAEKDHPDNLSLAGDGFDTVIKAKAEVDKNPTCRNKVSCADILTMATRDVIALSGG 144 Query: 139 PSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLTDVIALSGAHTLGFS 198 PS+ VELGR DGL S ++ V G LP+PTFNL++L ++FA + LS TD+IALS AHTLGFS Sbjct: 145 PSYAVELGRLDGLRSTSASVNGKLPQPTFNLDKLNSLFAANGLSQTDMIALSAAHTLGFS 204 Query: 199 HCNRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTLDPDTPFTFDNAYYR 258 HC++F++R+YNFS + VDP+L+ YA QL + CP VDP I + +DP TP FDN YY+ Sbjct: 205 HCSKFANRIYNFSRENPVDPTLDKTYAAQLQSMCPKNVDPRIAIDMDPTTPKKFDNVYYQ 264 Query: 259 NLVAGKGLLSSDQVLFSDSASRSTVLXXXXXXXXXXXXXVTAMRKLGRVGVKTGNQGEIR 318 NL GKGL +SD+VLF+DS S+ TV V A+ KLGRVGVKTG G IR Sbjct: 265 NLQQGKGLFTSDEVLFTDSRSKPTVNTWASSSTAFQTAFVQAITKLGRVGVKTGKNGNIR 324 Query: 319 RDCTTFN 325 RDC+ FN Sbjct: 325 RDCSVFN 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10692 (260 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57270 95 1e-21 >Vv57270 Length = 251 Score = 95.1 bits (235), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 60/194 (30%), Positives = 97/194 (50%), Gaps = 8/194 (4%) Query: 70 VGAVNPVLFKSGEGCGACYKIKCLDQSICSRRPVTIIVTDECPGCSKGPAQFDLSGAAFG 129 VGAV+ L+++G GCGACY+++C ++C+ + ++VTD G F LS F Sbjct: 63 VGAVSR-LYRNGTGCGACYQVRCKVPNLCADNGMKVVVTDHGEG---DYTDFILSPRGFS 118 Query: 130 RMAVAGEGGLLRNQGELSVLYRRTPCKYPGKQIAFHVNEGSTN-YWLSLLVEFEDGDGDV 188 +A L G + + YRR PC+YPG I F V+E S +L++++ ++ G D+ Sbjct: 119 MLARPNMAADLFAYGVVGIEYRRVPCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLSDI 178 Query: 189 GSMHIRPASSSEWIEMSHVWGANWCINGGPLKGPFSVK--ITTLSTAKTLSARDVIPGNW 246 ++ I EW M +GA W + P KGP ++ ++ K + +VIP +W Sbjct: 179 TAVDIWQEDCQEWKGMRKSYGAVWDM-ANPPKGPVGLRFQVSGRGGQKWVQLMNVIPSDW 237 Query: 247 SPKATYTSRLNFHY 260 Y S Y Sbjct: 238 KAGVAYDSAFQLDY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19230 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30239 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv7372 208 5e-56 >Vv7372 Length = 153 Score = 208 bits (530), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 97/141 (68%), Positives = 122/141 (86%) Query: 83 AIILYLEEKYPQHPLLPPDLQKKAINYQAANIVSSSIQPLQNMTVLKYIEEKVRPVEKLE 142 +++LYLE+KYPQHPLLPPDL+K+AINYQAA+ VSSSIQPLQN+ KYI E+V EKL Sbjct: 9 SLVLYLEDKYPQHPLLPPDLKKRAINYQAASFVSSSIQPLQNLVEQKYIAEEVGSDEKLS 68 Query: 143 WVQFHIGKGFLALEELLNNHAGKYATGDEVYMADLFLAPQLYAAITRFQLDMTQFPLLAR 202 WV+ H+ KGF ALE+LL +HA KYA+GDEV++ADLFLAPQ++ A+TRF +DMTQF LL R Sbjct: 69 WVKHHMEKGFAALEKLLKDHAAKYASGDEVFLADLFLAPQIHDALTRFNVDMTQFSLLLR 128 Query: 203 LHEAYNKIPAFLDALPEKQPD 223 L++AYN++PAF DA+PEKQPD Sbjct: 129 LNDAYNELPAFQDAMPEKQPD 149 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30538 (280 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8594 284 1e-78 >Vv8594 Length = 397 Score = 284 bits (726), Expect = 1e-78, Method: Compositional matrix adjust. Identities = 143/269 (53%), Positives = 180/269 (66%), Gaps = 12/269 (4%) Query: 16 ISQKWTLFLCLSCFCAGMFFTNRMWTIPESKGITRRTAMEEETLNLVSEGCNPKSLNQKE 75 S W LC+ F GM FTNRMW PES T E+ L ++SE C K K+ Sbjct: 10 FSPTWIFILCIFSFALGMLFTNRMWVAPESNRQMISTQRHEQELQIISEDCTSK----KK 65 Query: 76 VQRENKDIFGEVYKTHNAIQTLDKTISNLEMELAAARATQESIRSGS----PLSGDSKTD 131 V ++KD+ GEVYKTH AIQ+LDKTIS L++EL+A R + ++GS P + S D Sbjct: 66 VG-QDKDVMGEVYKTHEAIQSLDKTISTLQIELSATRTSH---KTGSLESLPDAMRSSHD 121 Query: 132 STGKRRYLMVVGINTAFSSRKRRDSVRATWMPQXXXXXXXXXXXXXXXXFVIGHSATSGG 191 S+ +++ MV+GINTAFSSRKRRDS+R TWMP+ F+IGHSATS Sbjct: 122 SSPRKKAFMVIGINTAFSSRKRRDSIRETWMPKGQKLLQLEREKGIVVRFMIGHSATSSS 181 Query: 192 ILDRAVEAEGRKHGDILRLDHVEGYLELSAKTKIYFATAVATWDADFYVKVDDDVHVNIA 251 ILDRA+++E +H D LRL+H+EGY EL+AKTK +F+ AVA WDA+FYVKVDDDVHVN+ Sbjct: 182 ILDRAIDSEESQHKDFLRLEHIEGYHELTAKTKTFFSMAVAQWDAEFYVKVDDDVHVNLG 241 Query: 252 TLGETLVRHRKKQHLYIGCMKSGPVLAQK 280 L TL RHR K +YIGCMKSGPVL+QK Sbjct: 242 MLASTLARHRSKPRVYIGCMKSGPVLSQK 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783864 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14379 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26880 (135 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47614 216 1e-58 >Vv47614 Length = 135 Score = 216 bits (550), Expect = 1e-58, Method: Compositional matrix adjust. Identities = 105/135 (77%), Positives = 116/135 (85%) Query: 1 MVKFLKPNKAVINLQGRYAGRKAVIVRAFDEGTRDRPYGHCLVAGIKKYPSKVIRKDSAK 60 MVKFLKPNKAV+ LQGR+AGRKAVIVR+FD+GTRDRPYGHCLVAGI KYP KVIRKDSAK Sbjct: 1 MVKFLKPNKAVVLLQGRFAGRKAVIVRSFDDGTRDRPYGHCLVAGIAKYPKKVIRKDSAK 60 Query: 61 KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDVVNVESLQTKDKKVTALXXXXXXXXXX 120 KTAKKSRVKAF+KLVNY H+MPTRYTLDVDLKDVV+ + LQ++DKKVTA Sbjct: 61 KTAKKSRVKAFIKLVNYNHIMPTRYTLDVDLKDVVSPDVLQSRDKKVTAAKETKKKLEER 120 Query: 121 XXTGKNRWFFTKLRF 135 TGKNRWFF+KLRF Sbjct: 121 FKTGKNRWFFSKLRF 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775327 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48158 80 6e-18 >Vv48158 Length = 245 Score = 80.5 bits (197), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 1/100 (1%) Query: 1 MKHCVDVNNSVRSVLEPVS-ANHGFIDVELVDPICSVAXXXXXXXXXXXXXVQTELDGTA 59 +KHCV VNNS+ SVL P + A HGF+D+E+ + + V+++ +G Sbjct: 119 LKHCVGVNNSITSVLGPNTLAIHGFLDIEVENHSNNTTKASKKKKAYKKRKVRSDSEGLT 178 Query: 60 IRLQDSCQQMELMKSRAHKLDNCYFPHQESERGQLNSISP 99 I +QDSCQQME + SR H LDNCY P Q+ + +L S P Sbjct: 179 IGMQDSCQQMEQLDSRMHTLDNCYVPQQDMQGMELGSREP 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3348 (268 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv63082 215 8e-58 >Vv63082 Length = 193 Score = 215 bits (547), Expect = 8e-58, Method: Compositional matrix adjust. Identities = 111/180 (61%), Positives = 128/180 (71%), Gaps = 8/180 (4%) Query: 1 MASTACFXXXXXXXXXXXXXXXXXXXXXVVNINKHNQVVICRAQKQAAGQEEESGANVSR 60 MASTACF + +Q+V CRAQKQAA E+ GA VSR Sbjct: 1 MASTACFLHHHALSTPTRVSSQRQLPSL-----RPSQLV-CRAQKQAAN--EDDGAAVSR 52 Query: 61 RLALTVLIGAAALGSKVSPADAAYGESANVFGKPKSNTDFLPYVGKGFKLSIPAKWNPSK 120 RLALTVLIGAAA+G+KV+PADAAYGE+ANVFGKPK+NTDFLPY G+GFKLSIP+KWNPSK Sbjct: 53 RLALTVLIGAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPSKWNPSK 112 Query: 121 EVEYPGQVLRYEDNFDXXXXXXXXXXXXDKKSIGDYGPPEGFLTQVDYLLGKQAYFGKTD 180 E E+PGQVLRYEDNFD DKKSI DYG PE FL++VD+LLGKQA+FG + Sbjct: 113 EREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDFLLGKQAFFGNAN 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53859229 (53 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3562 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990999 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22683 (265 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17959 147 2e-37 >Vv17959 Length = 231 Score = 147 bits (371), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 5/175 (2%) Query: 94 DDTEGFDVPFFDLESILVATDYFSNANKLGQGGFGPVYKGKLPGGQEIAVKRLSSC--SG 151 + +E F V F + + +ATD F +NK+G+GGFG VYKG+L G +AVK LS S Sbjct: 32 NTSENFQV--FSYKELKIATDSFHPSNKIGEGGFGSVYKGQLRDGTTVAVKVLSVEIESM 89 Query: 152 QGLEEFKNEVLLIAKLQHRNLVQLLGYCVEGEEKMLVYEYMANKSLDSFIFDRKLC-VSL 210 +G EF +E+ + ++H NLV L G CVEG + LVY+YM N SL + K + Sbjct: 90 RGEREFVSELSALTDIKHENLVTLQGCCVEGASRFLVYDYMENNSLAQTLLGAKQNRMEF 149 Query: 211 NWDMRFNIILGIARGLLYLHQDSRLRIIHRDLKTSNILLGEEMNPKISDFGLARI 265 W+ R +I LG+ RGL YLH++ + IIHRD+K +NILL + + PKISDFGL+++ Sbjct: 150 GWEARRDISLGVGRGLAYLHEEIQPHIIHRDIKAANILLDQNLAPKISDFGLSKL 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27941 (305 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49949 169 5e-44 >Vv49949 Length = 228 Score = 169 bits (428), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 73/104 (70%), Positives = 92/104 (88%) Query: 3 ISCNGCRILRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLR 62 +SCNGCR+LRKGCSE+C +RPCLQWI+S ESQ +ATVF+AKF+GRAGLM+ I+A PE+ R Sbjct: 1 MSCNGCRVLRKGCSESCILRPCLQWIESAESQGHATVFVAKFFGRAGLMSFISAVPENQR 60 Query: 63 PAIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQVAVEAVLKG 106 PA+FRSLLYEACGR VNP+ G+VGLL +G+W +CQ A+E VL+G Sbjct: 61 PALFRSLLYEACGRTVNPVNGAVGLLGTGNWHVCQAAMETVLRG 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19704 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23931 150 1e-38 >Vv23931 Length = 251 Score = 150 bits (379), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 76/149 (51%), Positives = 95/149 (63%), Gaps = 5/149 (3%) Query: 1 MDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRW 60 M + PC + KG WT EED LI YI HGEG W SL K+AGL R GKSCRLRW Sbjct: 1 MGRSPC---CEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRW 57 Query: 61 LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIK 120 +NYLRPD++RGN T EE LI++LH+ GN+WS IA LPGRTDNEIKNYW T I++ + Sbjct: 58 INYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLL 117 Query: 121 QAENITPGQSSEVNDQA-STSQVSISNTV 148 I P +N+ + + +S + V Sbjct: 118 N-RGIDPSTHRPINEPSPDVTTISFAAAV 145 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32163 (190 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41955 335 3e-94 >Vv41955 Length = 210 Score = 335 bits (860), Expect = 3e-94, Method: Compositional matrix adjust. Identities = 151/190 (79%), Positives = 172/190 (90%) Query: 1 MLFDLQSGATKCISDDIKSSSMTVGKYAVVNPKEGFPIPDSHKLTIRVTSPYGSNYHYGD 60 M FDL SG TKCIS+DIK+++M+VGKY+V+NP EGFP+PD+HK+T +V+SPYG+NYH GD Sbjct: 21 MRFDLTSGGTKCISEDIKTNAMSVGKYSVINPNEGFPLPDTHKITAQVSSPYGNNYHTGD 80 Query: 61 HVESGNFAFTAAETGDYSACFWVSDHKPSTTVTIDFDWKTGVAAKDWSKVAKKGQIETME 120 H+ESGNFAFTAAE GDY+ACFW HKP TVTIDFDW+TGVAAKDWSKVAKKGQ+E ME Sbjct: 81 HIESGNFAFTAAEEGDYTACFWAPQHKPPLTVTIDFDWRTGVAAKDWSKVAKKGQVEVME 140 Query: 121 LELKKLYDTVSSIHDEMFYLREREEGMQQLNRSTNSKMAVFSGLSLFVCLSVAGLQLWHL 180 LELKKLYDTV+SIH+EMFYLREREE MQ+LNR+TNSKMA FS LSL VCLSVAGLQLWHL Sbjct: 141 LELKKLYDTVTSIHEEMFYLREREEEMQELNRATNSKMATFSFLSLLVCLSVAGLQLWHL 200 Query: 181 KMFFERKKLL 190 K FFERKKLL Sbjct: 201 KTFFERKKLL 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20015 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv50138 244 8e-67 >Vv50138 Length = 302 Score = 244 bits (624), Expect = 8e-67, Method: Compositional matrix adjust. Identities = 114/129 (88%), Positives = 122/129 (94%) Query: 92 TRTEAVKGCIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQLLKELG 151 + AVK CIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQL+KELG Sbjct: 9 NKQTAVKDCIWLFEQEQALGFSSVSTNIRMTVIKLKSGGLWVHAPIAPTKECIQLVKELG 68 Query: 152 APVEYIVLPTFAYEHKIFVGPFSREFPRAQVWVAPRQWSWPLNLPLEFFGIFRAKTLKNK 211 APVEYI+LPTFAYEHKIFVGPFSR+FP+AQ+ VAPRQWSWPLNLPLEFFGIFRAKTLK++ Sbjct: 69 APVEYIILPTFAYEHKIFVGPFSRKFPQAQIRVAPRQWSWPLNLPLEFFGIFRAKTLKDE 128 Query: 212 DFSTPWAEE 220 D STPWA E Sbjct: 129 DMSTPWASE 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29831 (331 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 358 e-101 >Vv47659 Length = 393 Score = 358 bits (920), Expect = e-101, Method: Compositional matrix adjust. Identities = 175/246 (71%), Positives = 202/246 (82%), Gaps = 4/246 (1%) Query: 85 IADNYHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGPNPYEH 144 IADN++SL++VT+AL +GLESSNLI+GIDFTKSNEWTG SF+RKSLH I N PNPYE Sbjct: 40 IADNFNSLDQVTDALRESGLESSNLILGIDFTKSNEWTGRHSFHRKSLHAISNTPNPYEQ 99 Query: 145 AISIIGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFY-DDRYCNGFEEVLTRYKEIVPKL 203 AISIIG+TL+ FDEDNLIPCFGFGDA+THD+ VFSFY D RYC GFEEVL RYKEIVP L Sbjct: 100 AISIIGRTLSPFDEDNLIPCFGFGDASTHDKYVFSFYPDHRYCRGFEEVLARYKEIVPYL 159 Query: 204 RLAGPTSFAPVIEQAMTIVEESAGQYHVLLIIADGQVTRSVDTENGRLSPQEQNTVNAIV 263 +L+GPTSFAP+I+ A+ IVE S GQYHVL+IIADGQV+ S+D +GR SPQEQ TVN+IV Sbjct: 160 KLSGPTSFAPIIDAAIDIVEGSNGQYHVLVIIADGQVSGSLDGSSGRFSPQEQATVNSIV 219 Query: 264 AASKLPLSIILVGVGDGPWDMMKEFDDNIPARAFDNFQFVNLRKYVK---NVPRQEGTEL 320 AAS+ PLSIILVGVGDGPWD MK FDDNIP R+FDNFQFVN K + ++E Sbjct: 220 AASRYPLSIILVGVGDGPWDAMKLFDDNIPQRSFDNFQFVNFSKIMSENMEASKKETAFA 279 Query: 321 LXILME 326 L LME Sbjct: 280 LSALME 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20381 (69 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823766 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10840 (440 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20760 145 1e-36 >Vv20760 Length = 305 Score = 145 bits (366), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 60/91 (65%), Positives = 77/91 (84%) Query: 15 FLTKTYDLVDDPSSNHMVSWTESGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLNTYG 74 FLTKTY LVDDP+ + ++SW E GS+F+VW P EFA+++LP YFKHNNFSSFVRQLNTYG Sbjct: 25 FLTKTYQLVDDPAVDDLISWNEDGSTFIVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYG 84 Query: 75 FRKIDPEQWEFANEEFLRGGRHLLKNIHRRK 105 FRK+ P++WEFAN+ F +G + LL++I RRK Sbjct: 85 FRKVVPDRWEFANDYFRKGEKALLRDIQRRK 115 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783970 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16739 (215 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41955 157 1e-40 >Vv41955 Length = 210 Score = 157 bits (397), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 79/191 (41%), Positives = 110/191 (57%), Gaps = 13/191 (6%) Query: 33 LPASGTKCVSDEIQNNVVVLADYVVI--------PDDHSQTPTISAKVTSPYGNNLHQNA 84 L + GTKC+S++I+ N + + Y VI PD H I+A+V+SPYGNN H Sbjct: 25 LTSGGTKCISEDIKTNAMSVGKYSVINPNEGFPLPDTHK----ITAQVSSPYGNNYHTGD 80 Query: 85 NATNGQFAFTTHEAGNYLACFWXXXXXXXXXXXXXXLDWKTGIAAKDWESVAXXXXXXXX 144 + +G FAFT E G+Y ACFW DW+TG+AAKDW VA Sbjct: 81 HIESGNFAFTAAEEGDYTACFWAPQHKPPLTVTID-FDWRTGVAAKDWSKVAKKGQVEVM 139 Query: 145 XXXXXXXXXAVDAIHENLLYLKGRESEMRDVSERTNARVAWFSMISLAVCIIVSTLQLWH 204 V +IHE + YL+ RE EM++++ TN+++A FS +SL VC+ V+ LQLWH Sbjct: 140 ELELKKLYDTVTSIHEEMFYLREREEEMQELNRATNSKMATFSFLSLLVCLSVAGLQLWH 199 Query: 205 LKHFFQKKKLI 215 LK FF++KKL+ Sbjct: 200 LKTFFERKKLL 210 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8015 (256 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24483 (615 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32044 496 e-142 >Vv32044 Length = 601 Score = 496 bits (1278), Expect = e-142, Method: Compositional matrix adjust. Identities = 233/324 (71%), Positives = 270/324 (83%), Gaps = 4/324 (1%) Query: 274 IWGIPLLGDERSDVVLLKFLRARDFKVKEAFSMIKNTVRWRKEWGIEGLLEEDLGSHWDK 333 IWGI L D+R+DVVLLKFLRARDFK KEA +M+KNTV WRK +GIE LL +DLG+H + Sbjct: 265 IWGIKLFDDDRTDVVLLKFLRARDFKPKEALTMLKNTVLWRKSFGIETLLGDDLGTHLES 324 Query: 334 VVFTHGVDKEGHPVCYNVFGEFQNKELYQNTFTDEEKRSKFIKWRIQFLEKSIRKFDFNP 393 VVF G KEGHPVCYN +G+F NKELYQNTF+DEEKR F++WRIQFLEKSIRK DF+P Sbjct: 325 VVFMEGSGKEGHPVCYNAYGKFLNKELYQNTFSDEEKRQNFLRWRIQFLEKSIRKLDFSP 384 Query: 394 TGISTIVQVNDLKNFPGFFNREHNQVTNQALQLLQDNYPEFVAKQVFINVPWWYLAFNRM 453 GI+TI+QVNDLKN PG F RE Q TNQAL LLQDNYPEFVAKQ+FINVPWWYLAFNRM Sbjct: 385 NGINTIIQVNDLKNSPGPFKRELRQSTNQALHLLQDNYPEFVAKQIFINVPWWYLAFNRM 444 Query: 454 ISPFLTQRTKSKFVFAGPSKSAETLFKYIGPEHVPVKYGGLSKEGVEGEHEFTTSDPVTE 513 ISPFLTQRTKSKFVFAGPSKSAETLFKYI PE VPV+YGGL + +G+ EF+ DPVT Sbjct: 445 ISPFLTQRTKSKFVFAGPSKSAETLFKYIAPEQVPVQYGGLKR---DGDTEFSICDPVTL 501 Query: 514 VTVKPASKHTVEIPVSECGEVLVWEVRVVGWEVSYGAEFVPSAEDSYTIILQKTRKVGAA 573 VT+KP KH +E P SE + L+WE+RV+GW+V+YGAEFVP+ E YT+I+QK RK+ Sbjct: 502 VTIKPGCKHVIEFPYSEPCQ-LIWELRVIGWDVTYGAEFVPTVEGGYTVIVQKARKIAPT 560 Query: 574 DEPVISNTYKIGEAGKVVLTIDNQ 597 DEPVISN++KIGE GKV+LTIDNQ Sbjct: 561 DEPVISNSFKIGEPGKVILTIDNQ 584 Score = 61.6 bits (148), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 30/42 (71%), Positives = 37/42 (88%) Query: 76 IAQSVSFKEESYVVGELPEPQKKALDELKQLIQEALNKHEFT 117 + +SVSFKEES VVG+LPE Q+KAL+ELK L++EAL KHEFT Sbjct: 80 MTESVSFKEESNVVGDLPESQRKALEELKVLVREALEKHEFT 121 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10721 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46739 199 3e-53 >Vv46739 Length = 245 Score = 199 bits (505), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 6/158 (3%) Query: 8 PPDPVAVLRGHRASVMDLSFHPSQPLLFTGSSDGELRIWDTIQHRTVSSAGVHNAAHGIA 67 PPDPVAVLRGHRASV D+ FHPS +LFTGSSDGELRIWDT+QHRTVSSA VH+AAHG+ Sbjct: 2 PPDPVAVLRGHRASVTDVCFHPSNSILFTGSSDGELRIWDTVQHRTVSSAWVHSAAHGVV 61 Query: 68 SVSCTA----NRVISQGRDGTVKCWDIEGGGLPRTPSVTIKTNSYHFCKLSLVKRPQSCS 123 V+ + N+++SQGRDGTVK WDIE GGL R+PS+TIKTN+YHFCKLSL+K+P +C+ Sbjct: 62 CVAASPLIGDNKLVSQGRDGTVKYWDIEEGGLSRSPSLTIKTNAYHFCKLSLMKKPCACA 121 Query: 124 TRVDGVKCQDGEDRRVRGTTDEDTLDDSRDNVEGNLPE 161 + +G K + D V+ T D + L+DS + +L E Sbjct: 122 RQAEGPK--NYHDMDVKDTVDAEMLNDSSGKAQESLTE 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16424 (110 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24514 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23575 97 2e-22 >Vv23575 Length = 210 Score = 97.1 bits (240), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 4/100 (4%) Query: 1 MKIQCDVCNKDDASVFCTADEAALCDACDHRVHHANKLASKHHRFSLVHPSSKEFPVCDI 60 M+ CD C A +FC ADEAALC ACD +VH NKLAS+H R L PS + P CDI Sbjct: 1 MRTLCDACESAAAILFCAADEAALCRACDEKVHMCNKLASRHVRVGLADPS--DVPRCDI 58 Query: 61 CQERRAFLFCQQDRAILCRECDLPIHNANEHTRKHNRYLL 100 C+ AF +C+ D LC +CD+ +H + R H RYLL Sbjct: 59 CENAPAFFYCEVDGTSLCLQCDMIVHVGGK--RTHGRYLL 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26370 (406 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41423 138 2e-34 >Vv41423 Length = 360 Score = 138 bits (347), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 92/314 (29%), Positives = 154/314 (49%), Gaps = 24/314 (7%) Query: 25 AMLALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIAXXXXXPFAYFLEKKD-RPAITLN 83 AM+AL+ G + + +AA G++ VF VY IA P + ++ P ++ Sbjct: 15 AMVALECTNVGLNTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFITHRRGVLPPLSFP 74 Query: 84 FLIQFFLLALVGITANQGFYLLGLDNTSPTFASAIQNSVPAITFLMAAILRIEHVRLNRK 143 L + F+L L+G A+Q G++ +SPT ASAI N VPA TF++A I R+E + L Sbjct: 75 VLCKIFVLGLIG-CASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLALRSS 133 Query: 144 DGIAKVLGTVFCVAGASVITLYKG-PTIYSPTPPLQMMRLMXXXXXXXXXXXXXXXXXXX 202 AK++GT+ ++GA V+TLYKG P I +P+P + + + Sbjct: 134 SSQAKIIGTIVSISGAFVVTLYKGPPIILTPSPSISLHQ--------------------- 172 Query: 203 XXXXGDAKGKSWTLGCLYLIGHCLSWSGWLVLQAPVLKKYPARLSVTSYTCFFGLIQFII 262 + SW +G L+L W ++QA ++K+YP+ +V + F + I Sbjct: 173 PPHPLRSSESSWIIGALFLSVEYFLTPVWYIVQAHIIKEYPSEPTVVFFYNLFVSLLAAI 232 Query: 263 IAAVFERDGQAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLV 322 + V E + WI + SI+ +G+ S + + W I GPV+VA+++P+ ++ Sbjct: 233 VGLVTEPNSSVWIVRPRIALASIVCSGIFGSFLGNTIHTWAIRMKGPVYVAMFKPLAIII 292 Query: 323 VAIMASVALGEEFY 336 M LG+ Y Sbjct: 293 AVTMGVALLGDSLY 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27026 (203 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8513 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21069 460 e-131 >Vv21069 Length = 278 Score = 460 bits (1184), Expect = e-131, Method: Compositional matrix adjust. Identities = 218/237 (91%), Positives = 227/237 (95%) Query: 1 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ 60 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ Sbjct: 1 MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSAAIGLRSKTHVVLACVNKANSELSSHQ 60 Query: 61 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSEAINYNYTYESPLPVGRLVVQLADKAQVCT 120 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSE INY++TYESPLPVGRLVVQLADKAQVCT Sbjct: 61 KKIFKVDDHIGVAIAGLTADGRVLSRYMRSECINYSFTYESPLPVGRLVVQLADKAQVCT 120 Query: 121 QRSWKRPYGVGLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFENFT 180 QRSWKRPYGVGLLV GLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRF F Sbjct: 121 QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFGTFQ 180 Query: 181 GSTREDLIKDALIATRETLQGEKLRSSICTIAVVGVGEPFHILDQDTVQKLIDAFEI 237 S+REDLIKDAL A RETLQGEKL+SSICT+ V+GVGEPFHILDQ+TVQ LI+AFE+ Sbjct: 181 NSSREDLIKDALFAIRETLQGEKLKSSICTVTVLGVGEPFHILDQETVQGLINAFEM 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15287 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv52609 69 3e-14 >Vv52609 Length = 178 Score = 68.9 bits (167), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 34/105 (32%), Positives = 64/105 (60%), Gaps = 1/105 (0%) Query: 12 EDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIA 71 +D LP A +++I+K+ LP + ++A+DA+D + EC EFI+ I+SE+++ C +E+++TI Sbjct: 28 QDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTIN 87 Query: 72 PEHVLKALQVLGFXXXXXXXXXXXXQHKLETMHDLSKSVKWGNGA 116 + +L A+ LGF +++ E D S + G+G+ Sbjct: 88 GDDLLWAMATLGFEDYIEPLKVYLQRYR-ELEGDTRGSARGGDGS 131 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28799 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv62107 110 4e-27 >Vv62107 Length = 104 Score = 110 bits (276), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 58/102 (56%), Positives = 73/102 (71%), Gaps = 9/102 (8%) Query: 1 MNGGMRTCAKLLRASEAALSKSGTRGFHSTGVKRMG---------GHGHDEPAYMHAKHM 51 +N G+R+ ++L ++ + +SKS RGFHSTGVKRMG GHGHDEP Y+HAKHM Sbjct: 3 LNTGLRSASQLFKSCQQLVSKSVNRGFHSTGVKRMGEGHGHGHGHGHGHDEPFYLHAKHM 62 Query: 52 YNLDQMKNQKLQVSLGVLAAFSIGVGVPIWAVNFQQKKTSSG 93 YNLD+MK QK+QV L VL GVGVPI+AV +QQ KT+S Sbjct: 63 YNLDRMKYQKVQVPLAVLGVVCTGVGVPIFAVVYQQSKTTSA 104 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8834 (104 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8789 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4708 98 2e-22 >Vv4708 Length = 471 Score = 97.8 bits (242), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 45/86 (52%), Positives = 55/86 (63%), Gaps = 2/86 (2%) Query: 22 WCVCK-DGDPTALQRALDYACGAG-ADCNPIKPNGVCYNPNTIKAHCSYAVNSYFQKKGQ 79 WCV + LQ ALDYACG G ADC+PI+P CY+PNT++AH S+A NSY+QKKG+ Sbjct: 383 WCVANGETGKEKLQAALDYACGEGQADCHPIQPGATCYDPNTLEAHASFAFNSYYQKKGR 442 Query: 80 STGTCDFSGTATATASDPSSNGCTYP 105 GTCDF G A P C +P Sbjct: 443 VIGTCDFQGAAYVVTQAPRFGKCEFP 468 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11703 (308 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13463 530 e-153 >Vv13463 Length = 308 Score = 530 bits (1366), Expect = e-153, Method: Compositional matrix adjust. Identities = 253/308 (82%), Positives = 278/308 (90%) Query: 1 MAEKSKILIIGGTGYIGKFVVEASAKAGHPTFALVRESTVKDPAKANLIEKFKNLGVTLL 60 MAEKSKILIIGGTGYIGKFVV+ASAK+GHPTFALVREST+ DP K LI++FKN GVTLL Sbjct: 1 MAEKSKILIIGGTGYIGKFVVQASAKSGHPTFALVRESTIADPVKGKLIQEFKNSGVTLL 60 Query: 61 YGDLYDHESLVKAIKQVDVVISTVGFMQTADQTKIIAAIKEAGNIKRFFPSEFGNDVDRV 120 +GDLYDH+SLVKAIKQVDVVISTVGFMQ ADQ KIIAAIKEAGN+KRF PSEFGNDVDRV Sbjct: 61 HGDLYDHDSLVKAIKQVDVVISTVGFMQLADQVKIIAAIKEAGNVKRFLPSEFGNDVDRV 120 Query: 121 HAVEPAKSTFDLKVQIRRAIEAEGIPYTYVSSNCFAGYFLPSLAQPGATSPPRDKVTILG 180 +AVEPAKS F KVQ+RRAIEAEGIPYT+V +NCFAGYFLP+L QPG ++PPRDKV ILG Sbjct: 121 NAVEPAKSAFAAKVQMRRAIEAEGIPYTFVVANCFAGYFLPTLVQPGVSAPPRDKVIILG 180 Query: 181 DGNPKAVFNKEDDIGTYTIRAVDDPRTLNKILYLKPPQNIYSFNELVALWEKKIGKVLEK 240 DGNPKA FN+EDDIGTYTI+AVDDPRTLNKILY+KPP + SFNELV+LWE KIGK LEK Sbjct: 181 DGNPKACFNREDDIGTYTIKAVDDPRTLNKILYIKPPNSTLSFNELVSLWESKIGKTLEK 240 Query: 241 VYVPEDKILKDIAEAPIPINVILAINHSVFVKGDHTNFEIEPSFGVEAYELYPDVKYTTV 300 VYVPE+++LKDI EAP+PINV L+I HSVFV GD TNFEIEPSFGVEA ELYPDVKY TV Sbjct: 241 VYVPEEQVLKDIQEAPMPINVFLSIQHSVFVNGDQTNFEIEPSFGVEASELYPDVKYCTV 300 Query: 301 DEYLDQFV 308 DEYL FV Sbjct: 301 DEYLSAFV 308 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56431713 (110 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16659 (176 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15758 (278 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2078 169 5e-44 >Vv2078 Length = 199 Score = 169 bits (428), Expect = 5e-44, Method: Compositional matrix adjust. Identities = 113/196 (57%), Positives = 124/196 (63%), Gaps = 11/196 (5%) Query: 1 MAQTMLLMSSSVSSGHVVDLKSSDPLLQVQAQRLRPKSFSQLVFRALPXXXXXXXXXTRI 60 MAQTML+ + SVS V+DLK PLLQ RLRPK FS L+ L + Sbjct: 1 MAQTMLI-TPSVSGHSVLDLKR-QPLLQ----RLRPKPFSHLLLPPL---PTSSSTSSPA 51 Query: 61 STVVALFKSKTXXXXXXXXXXXX-XVEDXXXXXXXXXXXXKQNELFVGRVAMIGFAASLL 119 T +ALFKSKT VED K+NELFVGRVAM+GFAASLL Sbjct: 52 FTTLALFKSKTKAAPPKKVTKPKPQVEDGIFGTSGGIGFTKKNELFVGRVAMLGFAASLL 111 Query: 120 GEAITGKGILSQLNLETGIPIYEAEPXXXXXXXXXXXGAIGALGDRGRFV-DDPPAGIEG 178 GEAITGKGIL+QLNLETGIPIYEAEP GAI ALGDRGRFV DDPP GIEG Sbjct: 112 GEAITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIXALGDRGRFVDDDPPTGIEG 171 Query: 179 AVIPPGKGLKSALGLK 194 AVIPPGKGL+SAL L+ Sbjct: 172 AVIPPGKGLRSALXLR 187 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 38/49 (77%), Positives = 42/49 (85%) Query: 201 GFTKANELFVGRLAQLGFAFSLIGEIITGKGALAQLNIETGVPISEIEP 249 GFTK NELFVGR+A LGFA SL+GE ITGKG LAQLN+ETG+PI E EP Sbjct: 89 GFTKKNELFVGRVAMLGFAASLLGEAITGKGILAQLNLETGIPIYEAEP 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761363 (59 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5112 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25846 235 2e-64 >Vv25846 Length = 432 Score = 235 bits (599), Expect = 2e-64, Method: Compositional matrix adjust. Identities = 111/133 (83%), Positives = 117/133 (87%) Query: 1 MSXXXXXXXXXXANLFDEGMEGHDSMGFGPPIPTESERSLMERVRQELKHELKQGYKEKI 60 MS NLFD ++G DSMGFGP +PTE+ERSLMERVRQELKHELKQGYKEKI Sbjct: 277 MSDDEDDQADSETNLFDGSLDGPDSMGFGPLVPTETERSLMERVRQELKHELKQGYKEKI 336 Query: 61 VDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWF 120 VDIREEILRKRRAGKLPGDTTS+LKAWWQSHSKWPYPTEEDKARLVQETGL LKQINNWF Sbjct: 337 VDIREEILRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLHLKQINNWF 396 Query: 121 INQRKKNWHSNPS 133 INQRK+NWHSNPS Sbjct: 397 INQRKRNWHSNPS 409 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24064 (190 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9058 (494 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13809 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21228 250 1e-68 >Vv21228 Length = 503 Score = 250 bits (639), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 122/178 (68%), Positives = 140/178 (78%) Query: 2 VETLQHQIRSREKQLLPVYTQIATRFAELHDTSLRMAAKGVIREVLDWNSSRSFFYKRLR 61 VE+LQ QI++REKQLLPVYTQIATRFAELHDTSLRMAAKGVI+EV+DW +SRSFFY+RL Sbjct: 325 VESLQQQIKAREKQLLPVYTQIATRFAELHDTSLRMAAKGVIKEVVDWGNSRSFFYRRLH 384 Query: 62 RRISEESLIKTVRDAAGEQLSHKSASDLIKNWFLSSDIPGCREDAWVDDEIFFRWKENPK 121 RR+ E SLIK VRDAAG+Q+SHK A DLIK WFL S+I +DAW DD+ FF WK +P Sbjct: 385 RRVIEGSLIKVVRDAAGDQMSHKCAMDLIKKWFLDSEIASGSKDAWADDQAFFTWKNDPA 444 Query: 122 NYEDKLKELRVQKVLLQLANIGDSVSDXXXXXXXXXXXXSKVEPSSRALLIDELRRVL 179 NYE+KL+ELR QKVLL L+ IGDS SD KVEPSSRA LI ELR+VL Sbjct: 445 NYEEKLQELRAQKVLLHLSKIGDSASDLQSLPQGLAALLQKVEPSSRAQLIGELRKVL 502 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32982 (262 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226750865 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18366261 223 2e-60 >Vv18366261 Length = 172 Score = 223 bits (567), Expect = 2e-60, Method: Compositional matrix adjust. Identities = 111/181 (61%), Positives = 123/181 (67%), Gaps = 9/181 (4%) Query: 1 MESHDETGCQAPDRPILCVNNCGFFGRAATMNMCSKCYKDTLLKQEQANLAAXXXXXXXX 60 MESHDETGCQAP+ PILC+NNCGFFG AATMNMCSKC+KD LKQEQA LAA Sbjct: 1 MESHDETGCQAPEGPILCINNCGFFGSAATMNMCSKCHKDLALKQEQAKLAASSIGSIVN 60 Query: 61 XXXXXXXXXXXXXXXFIDPXXXXXXXXXXXXXETSVVSTEAYIESSPSMKIEMKENKGPS 120 +P E +STEA +SS + IE K +GP+ Sbjct: 61 GSSSGNGK---------EPIVAGTVDVQAGPVEVKAISTEASNDSSSNQIIESKVKEGPN 111 Query: 121 RCTTCRKRVGLTGFNCKCGNTFCASHRYSDKHDCPFDYRTAGQDAIAKANPIVKADKLDK 180 RCT CRKRVGLTGFNCKCGN FCA HRYSDKHDCPFDYRTA +DAIAKANP+VKA+KLDK Sbjct: 112 RCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYRTAARDAIAKANPVVKAEKLDK 171 Query: 181 I 181 I Sbjct: 172 I 172 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46612112 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24202 (313 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26121 (586 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810865 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11635 (418 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16354 597 e-172 >Vv16354 Length = 432 Score = 597 bits (1539), Expect = e-172, Method: Compositional matrix adjust. Identities = 276/381 (72%), Positives = 313/381 (82%) Query: 38 LQDPELVVQEVQRNISDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQSLADCAIGFG 97 + DP+ V V +I +S RR LGY SCGTGNPIDDCWRCD NW+KNR+ LADC IGFG Sbjct: 52 VDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLADCGIGFG 111 Query: 98 KNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNS 157 +NAIGGRDG+ YVVTD GDDDPVNPKPGTLRHAVIQD PLWI+F+RDM I LK+ELIMNS Sbjct: 112 RNAIGGRDGRFYVVTDPGDDDPVNPKPGTLRHAVIQDAPLWIVFKRDMVITLKQELIMNS 171 Query: 158 FKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSPRHFGWRTVSDG 217 FKTIDGRG +VHIA G CIT+QFVTN+IIHGLHIHDCK GNAMVRSSP HFGWRT++DG Sbjct: 172 FKTIDGRGVNVHIANGACITVQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADG 231 Query: 218 DGVSIFGGSHVWVDHCSLSNCKDGLVDAIYGSTAITISNNYMTHHDKVMLLGHSDSYTND 277 D +SIFG SH+WVDH SLS+C DGLVDA+ GSTAITISNN+ HH++VMLLGHSDSY D Sbjct: 232 DAISIFGSSHIWVDHNSLSSCADGLVDAVMGSTAITISNNHFAHHNEVMLLGHSDSYERD 291 Query: 278 KNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFAA 337 K MQ+TIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+ A Sbjct: 292 KQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLA 351 Query: 338 PDIRSSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTXXXXXXXXXXXXXXXXXXKPS 397 P +KEVTK D P +WK WNWRSEGDL+LNGA+FT K S Sbjct: 352 PVNPFAKEVTKRVDTPSGQWKGWNWRSEGDLLLNGAYFTPSGAGASASYARASSLGAKSS 411 Query: 398 SLVGAITTASGALSCRKGSRC 418 S+VG+IT+ +GALSCR+GS+C Sbjct: 412 SMVGSITSNAGALSCRRGSQC 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25511 (242 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23749 216 3e-58 >Vv23749 Length = 237 Score = 216 bits (550), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 113/240 (47%), Positives = 145/240 (60%), Gaps = 5/240 (2%) Query: 1 MRPEIVLFGDSITEQSFQSGGWGAALADSYSRKADVKVRGYGGYNTRWALFLLQNLFPLD 60 MRPEI LFGDSITE SF GGWGA+LA +SR DV +RGY GYNTRWAL +++ +FP+ Sbjct: 1 MRPEIYLFGDSITEASFCDGGWGASLAHHFSRTVDVVLRGYSGYNTRWALEVIEKVFPVV 60 Query: 61 S--DKPPAAATIFFGANDAAILGRTSERQHVPLEEYKENLRKFVLHLKECSXXXXXXXXX 118 S P A T+FFGANDA + R S QHVP+ EYK+NL V LK+ Sbjct: 61 SRGGGAPLAVTVFFGANDACLPDRCSAFQHVPIHEYKQNLHSIVSFLKKRWPTTLVLLIT 120 Query: 119 XXXXDEDGRNEYARSLYGKDARELPERTNEVTGVYAKKCIELAEEMGLRSINLWSTLQET 178 DE+GR R+ Y ++ LPERTNE G YAK C+++A E G +++W+ +Q Sbjct: 121 PPPIDEEGR---LRNPYVENPMGLPERTNEAAGAYAKACVDVAGECGGPVVDIWTKMQHI 177 Query: 179 EGWQKKFLSDGLHLTPEGNAVVHQEVVKVFTEAWFSATEMPHDFPHHSEIDGKNPEKAFQ 238 W + LSDGLHLT GN +V +EVV E S + D PH +EID +P K+F Sbjct: 178 SDWPRICLSDGLHLTQSGNKIVFEEVVARLREEGISLETLLVDLPHIAEIDPNDPLKSFS 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13102 (291 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv569 376 e-106 >Vv569 Length = 284 Score = 376 bits (965), Expect = e-106, Method: Compositional matrix adjust. Identities = 206/288 (71%), Positives = 228/288 (79%), Gaps = 8/288 (2%) Query: 8 MDPPLINESSFSAAHPASYSLAEIWPISXXXXXXXXXXXXXXXXXXQSFGGL----GDSS 63 MDPPLINESSFSAA+P++YSLAEIWP +FG + DSS Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVNSASAIGEPTAGLGLRIANFGQIMGQFADSS 60 Query: 64 VNRDGSLEESTVTEQSGGGCGGRKRRDVSSEDESSKQVSTSSGNGLKYSGGKRMKLAGSS 123 NRD S++ESTVTEQSG GGRKRRDVSSEDESSK VSTSSG+G+ S GKRMK++ + Sbjct: 61 ANRDVSVDESTVTEQSGSRGGGRKRRDVSSEDESSKIVSTSSGSGMNASNGKRMKISRTP 120 Query: 124 NENGSLKAEVEESSAAGDNKPAEESTKPSEPPKQDFIHVRARRGQATDSHSLAERARREK 183 +ENG KAE+E SS AG+ KPAEES KP+E KQD+IHVRARRGQATDSHSLAERARREK Sbjct: 121 DENGGSKAELEASSVAGE-KPAEES-KPAEQSKQDYIHVRARRGQATDSHSLAERARREK 178 Query: 184 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQHQVEFLSMKLEAVNSRMNMNPTIE 243 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQ QVEFLSMKLEAVNSRMN T+E Sbjct: 179 ISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRMNH--TVE 236 Query: 244 AFPPKDLGAQPFDAAGLLFGSHTPREYAQSSQPEWLHMQVGGSFERAT 291 FP KDLG Q FDAA +++GS REYAQ SQPEWLHMQVGGS ERA+ Sbjct: 237 GFPLKDLGVQTFDAAAMIYGSQATREYAQGSQPEWLHMQVGGSIERAS 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9568 (610 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43779 803 0.0 >Vv43779 Length = 588 Score = 803 bits (2073), Expect = 0.0, Method: Compositional matrix adjust. Identities = 378/583 (64%), Positives = 472/583 (80%), Gaps = 16/583 (2%) Query: 40 STDEEPVIYRGWKVMPFVIGNETFEKLGTTGTLANLLVYLTSVFNMKRNTAATLVTTFNG 99 +TDE +RG K MPFVIGNETFEKLGT GT NLLVYLT+VFNMK TA T V FNG Sbjct: 9 ATDEPKTKHRGIKAMPFVIGNETFEKLGTIGTSTNLLVYLTTVFNMKSITATTFVNVFNG 68 Query: 100 TTNFATLLGAFASDTYFGRYKTLGFSTIASFM--GLLLIDFTAVFKNLHPPHCKPEEKGT 157 +TNFATL+GAF DTYFGRY TLGF++I+SF+ G+L+I TA + +HPPHC + GT Sbjct: 69 STNFATLIGAFLCDTYFGRYNTLGFASISSFLLKGMLVITLTAAVQKMHPPHCGTTDTGT 128 Query: 158 CKGATAGQMAFLLTGFGMLIVGAAGIRPCNLVFGADQFNQKTESGKRGVNSFFNWYMFTF 217 C G TAGQMAFLL+GFG+L++GAAGIRPCNL FGADQFN +TESGKRG++SFFNWY FT+ Sbjct: 129 CIGPTAGQMAFLLSGFGLLVIGAAGIRPCNLAFGADQFNPETESGKRGISSFFNWYYFTY 188 Query: 218 TFAQMIALTLIVYIQSNVSWSLGFGIPAILMLISCVLFFIGSKLYVKVKASGSPMNSVAQ 277 TFA M++LT+IVY+QS+VSWSLG IP +LML+SC L+F+G+++YVKVK GSP+ +VA Sbjct: 189 TFAMMVSLTVIVYVQSDVSWSLGLAIPTLLMLLSCALYFMGTRIYVKVKPEGSPLKNVAH 248 Query: 278 VVVVSIAKRHLKLKEPERPWLSMFVYMPPDSINSNLPYTNQFRCLDKAAILTPEDKINPD 337 V+V ++ KR L+L P +PWLS+F ++P +SINS LP+T+QFR L K AILTPE +IN D Sbjct: 249 VIVAAVKKRRLEL--PGQPWLSLFNHIPANSINSKLPHTDQFRFLSKGAILTPEVQINSD 306 Query: 338 GSAADPWRLCSMQQVEEVKCLLRVLPIWAAALIYHIAIVQQQTYVVFQALQSNRRLGKTS 397 GSAA+PWRL SMQ+VEEVKC++RV+PIWAA +IY++A+VQQ TYVVFQALQS+RRLG T Sbjct: 307 GSAANPWRLSSMQKVEEVKCVIRVIPIWAAGIIYYVALVQQSTYVVFQALQSDRRLGSTG 366 Query: 398 FQIPAASYTIFLMLGMTIWIPIYDRLLVPFLQRLTGKEGGITLLQRIGIGIFLSVITMLV 457 F+IPAASYT+F ML +TIWIPIYD+++VP L+RLTGKE GITLLQ++GIG+ L+VITM++ Sbjct: 367 FKIPAASYTVFTMLSLTIWIPIYDQIIVPLLRRLTGKEVGITLLQKMGIGMVLAVITMIL 426 Query: 458 SAFVEQHRRTIALTK----------PIPGMSGFWLVPQLTLAGLAEAFAAVGQIEFYYKQ 507 SA VE+ RRT+ALTK I +SG WLVPQLTL G++E +GQ+EF+YKQ Sbjct: 427 SALVEERRRTLALTKATVGIEARRGAISSLSGMWLVPQLTLIGISEGLTIIGQVEFFYKQ 486 Query: 508 FPENMRSIGGSLFFCGMAGSSYLSSALIAIVHRTTEGAATGNWLPEDLNKGRLDYFYYLI 567 FPENMRS G+ FCG+A S+YLSS L++IVH++T G ATGNWLPEDLNKGRLDYFYYL+ Sbjct: 487 FPENMRSFAGAFLFCGIAFSNYLSSFLVSIVHQSTGGTATGNWLPEDLNKGRLDYFYYLV 546 Query: 568 AALGVVNLGYFLMCSKWYNYKGGGDNNALEVEVVQKSHDQHEI 610 AALG+VNL YFL C+KWY YK + + LEV ++K Q + Sbjct: 547 AALGMVNLLYFLACAKWYKYK-DSEESPLEVS-LEKMQPQKPL 587 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9457 (253 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3309 117 2e-28 >Vv3309 Length = 273 Score = 117 bits (293), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 74/203 (36%), Positives = 105/203 (51%), Gaps = 24/203 (11%) Query: 64 PDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIGILN 123 P YLTG +PGD G+DP L++ PE+ Y EL++ RWAMLG G ++PE F G Sbjct: 75 PAYLTGEVPGDYGYDPFGLSKKPEDFAKYQAYELIHARWAMLGAAGFIIPEAFNKFGANC 134 Query: 124 VPK--WY-------DAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFK 174 P+ W+ D YF + + +I ++ V + G I Sbjct: 135 GPEAVWFKTGALLLDGNTLNYFGKNIPINLIFAVVAEVVLV---------GGAEYYRIIN 185 Query: 175 QYSLPPGEVGYPGGIFNPLNF--EPTLEA--KEKELANGRLAMLAFLGFVVQHNVTGKGP 230 L + +PGG F+PL +P A K KE+ NGRLAM A LGF +Q VTG+GP Sbjct: 186 GLDLE--DKLHPGGPFDPLGLANDPDQAALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGP 243 Query: 231 FDNLLQHLSDPWHNTIVQTLSGS 253 +NL HLSDP+ N ++ ++G+ Sbjct: 244 VENLAAHLSDPFGNNLLTVIAGT 266 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14144 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3882 (262 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28920 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33590 92 5e-21 >Vv33590 Length = 198 Score = 92.4 bits (228), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 52/129 (40%), Positives = 72/129 (55%), Gaps = 10/129 (7%) Query: 3 RKATSEMMCMRCLTVQPVGPICTTPSCNELSMAKYYCNICKFFDDERT--VYHCPFCNLC 60 R +++C C T QPV +CT N M +Y+C +CKF+DD+ T +HC C +C Sbjct: 60 RHDVKQVICAVCDTEQPVAQVCTNCGVN---MGEYFCEVCKFYDDDTTKGQFHCDDCGIC 116 Query: 61 RLGKGLGID-FFHCMTCNCCLGIKLV-NHKCLEKSLETNCPICCDFLFTSSATVRALPCG 118 +G G D FFHC C CC + L NH C+E S+ +CPIC ++LF S + CG Sbjct: 117 IVG---GRDKFFHCKKCGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCG 173 Query: 119 HYMHSACFQ 127 H MH C+ Sbjct: 174 HTMHCECYN 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12415 (250 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30991 422 e-120 >Vv30991 Length = 244 Score = 422 bits (1086), Expect = e-120, Method: Compositional matrix adjust. Identities = 198/222 (89%), Positives = 214/222 (96%) Query: 28 ATTLTMHNKCNHPVWPGIQPSAGQPLLARGGFTLPPNKAYTLHLPRLWSGRFWGRHGCAF 87 ATT++++NKC+HPVWPGIQP AG+P+LARGGF LPPNKAY+LH+P WSGR WGRHGC+F Sbjct: 23 ATTISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAAWSGRIWGRHGCSF 82 Query: 88 DASGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGNDQDFYDVSLVDGYNLAISITPFK 147 DA GRGRCATGDCGG+LFC+G+GGTPPATLAEITLG++QDFYDVSLVDGYNLAISITPFK Sbjct: 83 DAHGRGRCATGDCGGSLFCNGMGGTPPATLAEITLGSEQDFYDVSLVDGYNLAISITPFK 142 Query: 148 GSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSCK 207 GSGKCSYAGCVSDLN MCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSCK Sbjct: 143 GSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSPQSCK 202 Query: 208 PTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCPHH 249 PTAYSKIFKAACP+AYSYAYDDPTSIATCT GNYLVTFCPHH Sbjct: 203 PTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCPHH 244 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15142 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25482 (263 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2430 283 3e-78 >Vv2430 Length = 265 Score = 283 bits (723), Expect = 3e-78, Method: Compositional matrix adjust. Identities = 136/211 (64%), Positives = 158/211 (74%) Query: 52 ASVSSEAVALTGVVFQPFEEVKNDAFVVPVSPQVSLARQRYTDESEAAINEQINVEYNVS 111 AS + LTGVVF+PFEEVK + +VP PQ SL+R +YT++ E+AINEQINVEYNVS Sbjct: 54 ASKGANNRPLTGVVFEPFEEVKKELLLVPTVPQESLSRHKYTNDCESAINEQINVEYNVS 113 Query: 112 YVYHALFAYFDRDNVALKGLANFFKXXXXXXXXXXXKLMEYQNKRGGRVKLHSVIAAPTE 171 Y YHA++AYFDRDNVALKGLANFFK KLMEYQNKRGG+VKL S++ +E Sbjct: 114 YAYHAMYAYFDRDNVALKGLANFFKESSLEEREHAEKLMEYQNKRGGKVKLQSILMPHSE 173 Query: 172 FDHAEKGDALYAMELAXXXXXXXXXXXXXXHKVADQNNDPQLMDFIESEFLAEQVEAIKK 231 FDH EKGDAL+AMELA H +AD++NDPQL DFIESEFL EQVEAIKK Sbjct: 174 FDHPEKGDALHAMELALSLEKLTNEKLLHLHSIADRSNDPQLADFIESEFLIEQVEAIKK 233 Query: 232 IADYVTQLRRVGKGHGVWHFDQYLLHEGDAA 262 I++YV QLRRVGKGHGVWHFDQ LL+ G A Sbjct: 234 ISEYVAQLRRVGKGHGVWHFDQMLLNGGVVA 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16998 (124 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41286 97 7e-23 >Vv41286 Length = 191 Score = 97.4 bits (241), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 37/70 (52%), Positives = 58/70 (82%) Query: 55 IPHTPRVNGEIPDVNDATQDHERLSARLATYDLSELQIEGDGNCQFRAIADQLFRNPEYH 114 +PH P++NGEIP +++AT DH+RL RL +DL EL+++GDGNCQFR+++DQ++ PE+H Sbjct: 4 VPHVPKINGEIPSLDEATLDHQRLLDRLQLFDLVELKVQGDGNCQFRSLSDQVYCTPEHH 63 Query: 115 KHVRKQVIKQ 124 + +R+QV+ Q Sbjct: 64 QFIRQQVVNQ 73 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17519 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12560 (85 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21429 (236 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6662 (368 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22766257 459 e-131 >Vv22766257 Length = 356 Score = 459 bits (1182), Expect = e-131, Method: Compositional matrix adjust. Identities = 222/332 (66%), Positives = 265/332 (79%), Gaps = 1/332 (0%) Query: 29 DLAALQSIRTGLTDSSLGIFNSWVGTDCCVNWYGVSCDPTTGRVVDINLRGESEDPILKK 88 D AL + L + LGIF SW G DCC +W+G+SCD + GRV DINLRGESEDPI ++ Sbjct: 25 DRQALLDFKAALNEPYLGIFKSWSGNDCCSSWFGISCD-SAGRVADINLRGESEDPIFER 83 Query: 89 SGQSGFMSGSISPKICSLDRLTTLVLADWKGVTGEIPQCLTTLSNLRVLDLVGNKISGKI 148 +G+SG+M+G+ISP IC LD LTTL++ADWKG++GEIP C+++LS LR+LDLVGNKI+G I Sbjct: 84 AGRSGYMTGAISPSICKLDSLTTLIIADWKGISGEIPPCISSLSKLRILDLVGNKITGVI 143 Query: 149 PADIGNLKMLRVLNLADNQISGKIPASLVGLSGLMHMDLSNNQITGELPADFGKLKMLSR 208 PADIG L+ L VLN+ADN ISG IPAS+V L+ LMH+DL NNQITG +P DFGKL MLSR Sbjct: 144 PADIGKLQRLTVLNVADNSISGGIPASVVNLASLMHLDLRNNQITGGIPQDFGKLTMLSR 203 Query: 209 ALLNRNQLTGSIPDSIGNMNRLADLDLSRNQMWGSVPDCLGKMQVLSTLNLDGNKFSGQL 268 A+L RNQLTG+IP SI + RLAD DLS NQ+ G +P LG M VLSTLNLD N+ SG + Sbjct: 204 AMLGRNQLTGTIPSSISGLYRLADFDLSVNQISGVIPAELGSMPVLSTLNLDSNRLSGSI 263 Query: 269 PASVLSNRGMGILNLSRNGFEGNIPDVFHGNSYFMALDLSYNNLKGPIPGSLSAAKYIGH 328 PAS+LSN G+ ILNLSRN EG +PDVF +YF+ LDLSYNNLKG IP SLS+A YIGH Sbjct: 264 PASLLSNTGLNILNLSRNSLEGKLPDVFGSKTYFIGLDLSYNNLKGQIPKSLSSAAYIGH 323 Query: 329 LDLSHNHLCGAIPVGNPFDHLEVSSFTNNDCL 360 LDLSHNHLCG+IP G PFDHLE SSF+ NDCL Sbjct: 324 LDLSHNHLCGSIPTGWPFDHLEASSFSFNDCL 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28518 (80 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7568 (115 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv63997 77 7e-17 >Vv63997 Length = 116 Score = 77.4 bits (189), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 37/93 (39%), Positives = 54/93 (58%) Query: 23 HAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSI 82 +A+TCGQV +SLAPC+ Y+ GG CCNG++ + L DR+ AC C+K A Sbjct: 24 YAVTCGQVETSLAPCMPYLTGGGNPAAPCCNGVQNLKLLIPPPTDRRDACRCVKAAASKF 83 Query: 83 SGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115 + + A+ LP KCGV + IS + NC ++ Sbjct: 84 QNIKEDAASALPTKCGVQIGIPISMTPNCDQIQ 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31574 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11995 94 8e-22 >Vv11995 Length = 105 Score = 94.0 bits (232), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 42/68 (61%), Positives = 52/68 (76%), Gaps = 3/68 (4%) Query: 29 FFKPANCSPIIXXXXXXXEADVSILCEDCNGRGWLLCDFCKGQKTNVKSETSRIYRRCPS 88 F KP +C+P+ + DV I+CE CNG+GWLLCDFCKGQKTNVK+E +RIYRRCPS Sbjct: 28 FLKPPHCAPL---QQIQEQIDVGIMCEPCNGKGWLLCDFCKGQKTNVKAENNRIYRRCPS 84 Query: 89 CRAIGQVL 96 CRA+ +L Sbjct: 85 CRAVSCLL 92 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13625 (290 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13996 (203 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57270 99 8e-23 >Vv57270 Length = 251 Score = 98.6 bits (244), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 61/196 (31%), Positives = 96/196 (48%), Gaps = 10/196 (5%) Query: 11 VGAVSPVLFKSGEGCGACYKVKCLDQSICSRRAVTIIVTDECPGGYCSNGRTHFDLSGAA 70 VGAVS L+++G GCGACY+V+C ++C+ + ++VTD G Y T F LS Sbjct: 63 VGAVSR-LYRNGTGCGACYQVRCKVPNLCADNGMKVVVTDHGEGDY-----TDFILSPRG 116 Query: 71 FGRMAVAXXXXXXXXXXXXSVLYRRTPCKYPGKQIAFHVNEGST-NYWLSLLVEFEDGDG 129 F +A + YRR PC+YPG I F V+E S +L++++ ++ G Sbjct: 117 FSMLARPNMAADLFAYGVVGIEYRRVPCQYPGSNIFFKVHEHSRFPDYLAIVMLYQAGLS 176 Query: 130 DVGSMHIRPASSSEWIAMSHVWGANWCINGGPLNGPFSVK--ITTLSTAKTLSARDVIPS 187 D+ ++ I EW M +GA W + P GP ++ ++ K + +VIPS Sbjct: 177 DITAVDIWQEDCQEWKGMRKSYGAVWDM-ANPPKGPVGLRFQVSGRGGQKWVQLMNVIPS 235 Query: 188 NWSPKATYTSRLNFRF 203 +W Y S + Sbjct: 236 DWKAGVAYDSAFQLDY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8326 (344 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8462 69 2e-13 >Vv8462 Length = 305 Score = 68.6 bits (166), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 214 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITQIVYKGNHNH 269 +DG+ WRKYGQK VK S PRSYY+CT C KK+VERS D I Y+G H H Sbjct: 162 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSIVITTYEGQHCH 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8270 (411 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5212 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27935 (256 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22966256 245 6e-67 >Vv22966256 Length = 306 Score = 245 bits (626), Expect = 6e-67, Method: Compositional matrix adjust. Identities = 123/256 (48%), Positives = 159/256 (62%), Gaps = 5/256 (1%) Query: 1 MPPRRYAFGRADEATHPDSIRATLAELVATFIFVFAGEGSALALGKIYKDSGTSASEXXX 60 MP R A G+ + HPD+++ LAE T IFVFAGEGS +A K+ D T+ + Sbjct: 56 MPFLRIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA 115 Query: 61 XXXXXXXXXXXXXXXXXNVSGGHVNPAVTFGALLGGRLSVVRALYYWVAQLLGAIVASLL 120 N+SGGH+NPAVTFGA +GG ++++R + YW+AQLLG+ VA LL Sbjct: 116 EALGHGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL 175 Query: 121 LRLVTNGMRTVGFNVASGVAEVHGLILEIVLTFGLVYTVYATAIDPKRGSLGTIAPLAIG 180 L+ T+GM T F ++SG + +LEIV+TFGLVYTVYATAIDP+ G++G IAPLAIG Sbjct: 176 LKFCTHGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIG 235 Query: 181 FIVGANILVGGPFDGACMNPARAFGPALVGWRWRNHWIYWVXXXXXXXXXXXIYEYMVIP 240 IV ANIL GG FDGA MNPA +FGPALV W W NHW+YW +YE + I Sbjct: 236 LIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFI- 294 Query: 241 TETPHHAHQPLAPEDY 256 H+PL ++ Sbjct: 295 ----DRTHEPLPGSEF 306 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3904 (202 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10297 (326 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15466256 190 3e-50 >Vv15466256 Length = 322 Score = 190 bits (482), Expect = 3e-50, Method: Compositional matrix adjust. Identities = 117/316 (37%), Positives = 175/316 (55%), Gaps = 11/316 (3%) Query: 12 VCVTGAGGFTASWVVNLLLSRDYVVHGTVRQPGDSKYA-HLNKLEKASVNLKLFKADLLD 70 VCVTGA G+ ASW+V LLL R Y V +VR P D K HL L+ A L LFKA+LL+ Sbjct: 6 VCVTGASGYIASWLVKLLLQRGYTVKASVRDPNDPKKTEHLLSLDGAKERLHLFKANLLE 65 Query: 71 YDSLRLAIEGCSGVFHVASPVPNSLNDSDPEEFLEPAIKGTLNVL---XXXXXXXXXXXX 127 S +EGC GVFH ASP +++ D E ++PA+KGTLNVL Sbjct: 66 EGSFDSIVEGCVGVFHTASPFFHAVTDPQ-AELIDPAVKGTLNVLGSCAKASSVKRVVVT 124 Query: 128 XXXXXXXXXMNPEWPKDQVKDETCWSVPEYIKTTKKWYYLSKTEAEREALEFGKRNGLEV 187 NP P D V DET ++ P++ K + WY +SKT AE A +F K G+++ Sbjct: 125 SSIAAVAYNRNPRTP-DVVVDETWFTDPDFCKGLQLWYVVSKTLAEDAAWKFAKEKGIDM 183 Query: 188 VTVCPSIILGPILQSTLNSSSSLIVKTIIGGLESLGCNYWTFVDVRXXXXXXXXXYNKPE 247 VT+ P++++GP+LQ TLN+S++ I+ I GG ++ + +V+V+ + P Sbjct: 184 VTINPAMVIGPLLQPTLNTSAAAILNLINGG-QTFPNASFGWVNVKDVAEAHIQAFEVPS 242 Query: 248 AAGERYLCNSHSIGIRDVVEKYLRPTYPDYKYPKNLTYAEEEVQHF--SSEKLQKLGWTF 305 A+G RY + ++V K L+ +PD++ P+ + V F S EK + LG F Sbjct: 243 ASG-RYCLVERVVHYSELV-KILKELFPDFQLPEKCADDKPFVPTFQVSKEKAKSLGIEF 300 Query: 306 RPVEETLNDSIESYRK 321 P+E +L +++ES ++ Sbjct: 301 IPLEVSLKETVESLKE 316 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6386 (57 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31927 (350 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29842 (497 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58683 70 8e-14 >Vv58683 Length = 247 Score = 70.1 bits (170), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 32/79 (40%), Positives = 44/79 (55%) Query: 146 DPIHRKIFVHGLGWDTNAETLTGVFREYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGAR 205 D K+FV GL W+T E + F +YGEI + + DK++G+SKGYGF+ FK A+ Sbjct: 12 DTTLTKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAK 71 Query: 206 KALQQPQKRIGNRMTACQL 224 KA + I R C L Sbjct: 72 KACEDTTPMINGRRANCNL 90 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3077 (89 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26743 (696 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5005 (257 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31753 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12801 (238 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9361 (305 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv51319 225 6e-61 >Vv51319 Length = 189 Score = 225 bits (574), Expect = 6e-61, Method: Compositional matrix adjust. Identities = 102/137 (74%), Positives = 126/137 (91%) Query: 167 KELLRGPLYYVLILILCALVFWRESPVGLISLAMMCGGDGVADIMGRKFGSIKIPYNPKK 226 +ELLRGPLYYVLIL++C +VFWRESP+G+ISL+MMCGGDG+ADIMGR+FGS+K+PYN +K Sbjct: 51 RELLRGPLYYVLILLVCTMVFWRESPIGVISLSMMCGGDGIADIMGRRFGSLKLPYNQQK 110 Query: 227 SWAGSISMFLFGFLISMGMLYYYSFLGYFELNWIQTAEKVAFVALVATLVESLPITEVLD 286 SWAGSISMF+FGFLIS+GML+Y+S LGYF+L+W T EKVA +LVAT+VESLP T+V+D Sbjct: 111 SWAGSISMFVFGFLISIGMLHYFSALGYFQLDWFWTMEKVALTSLVATVVESLPTTKVVD 170 Query: 287 DNVSVPLASMAAAYLSF 303 DN+SVPLASM A+LSF Sbjct: 171 DNISVPLASMVMAFLSF 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780713 (125 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7583 (376 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57970 362 e-102 >Vv57970 Length = 277 Score = 362 bits (929), Expect = e-102, Method: Compositional matrix adjust. Identities = 171/295 (57%), Positives = 224/295 (75%), Gaps = 19/295 (6%) Query: 82 ILELCRAFNRIFKEHLDGGRAGGDRIYGVFDNQLPAALRKLPFDRHLSLQNVRKVVSEAD 141 I+E+ R F++I+KEHLDG RAGGD+IY VFDNQLPAAL++L FD+ LS++NVRK+++EAD Sbjct: 2 IMEISRVFDQIYKEHLDGVRAGGDKIYHVFDNQLPAALKRLQFDKQLSMENVRKLITEAD 61 Query: 142 GYQPHLIAPEQGYRRLIEGSLSYFRGPAEASVDAVHFVLKELVRKSLAETQELKRFPTLQ 201 GYQPHLIAPEQGYRRLIE S+ RGPAEA+VDAVH +LKE+V K+++ET E K++P L+ Sbjct: 62 GYQPHLIAPEQGYRRLIESSIVSIRGPAEAAVDAVHAILKEMVNKAISETAEFKQYPALR 121 Query: 202 AEIAAACNEALERFRNESKKTTLRLVDMESSYLTVDFFRRLPQEMEXXXXXXXXXXXXXX 261 E+A A ++L+R R+ESKK TL+LVDME SYLTVDFFR+LPQ++E Sbjct: 122 IEVANAACDSLDRMRDESKKATLKLVDMECSYLTVDFFRKLPQDIE-------------- 167 Query: 262 XXXXXXXXXXXXXXMDRYSEGHFRRIGSNVSSYVGMVSETLRNTIPKAVVHCQVKEANTS 321 DRY++ + RRIG+ V SYV MV TLRN+IPK++V+CQV+EA S Sbjct: 168 -----KGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCATLRNSIPKSIVYCQVREAKRS 222 Query: 322 LLNHFYIQIGKREAKHLSQLLDEDPALMERRHQCAKRLELYKSARDEIDSVAWVR 376 LL+HF+ ++GK E K L+ LL+EDPA+M RR AKRLELY+SA+ EID+VAW + Sbjct: 223 LLDHFFTELGKLEPKQLASLLNEDPAVMARRTALAKRLELYRSAQAEIDAVAWSK 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48939927 (124 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv61002 109 2e-26 >Vv61002 Length = 100 Score = 109 bits (272), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 63/108 (58%), Positives = 65/108 (60%), Gaps = 23/108 (21%) Query: 1 MATLDSDVPMIXXXXXXXXXXXXXX---XXXXRFEIKKWNAVALWAWDIVVDNCAICRNH 57 MA+LDSDV M+ RFEIKKWNAVALWAWDIVVDNCAICRNH Sbjct: 1 MASLDSDVTMVPVGEPSGSAGPSSSSSCKKPKRFEIKKWNAVALWAWDIVVDNCAICRNH 60 Query: 58 IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPL 105 IMDL VCNHAFHFHCISRWLKTRQVCPL Sbjct: 61 IMDL--------------------WVCNHAFHFHCISRWLKTRQVCPL 88 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754210 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5772 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2998 209 1e-56 >Vv2998 Length = 387 Score = 209 bits (532), Expect = 1e-56, Method: Compositional matrix adjust. Identities = 98/116 (84%), Positives = 105/116 (90%) Query: 1 MSKFLDLLPNSSPVATASWNAQLPSANEAIVIPTQVNYVGKAGNIYDAGYRLSGSAHVIS 60 +SKFLDLLP+SS V +WN +L S NEAIVIPTQVNYVGKA NIYD GY+L GSA+VIS Sbjct: 168 VSKFLDLLPSSSSVEKTTWNGRLSSENEAIVIPTQVNYVGKATNIYDTGYQLKGSAYVIS 227 Query: 61 KYISNTWLWDRVRVSGGAYGGFCDFDSHSGVFSFLSYRDPNLLKTLGVYDGTGDFL 116 KYISNTWLWDRVRVSGGAYGGFCDFD+HSGVFSFLSYRDPNLLKTL VYDGTGDFL Sbjct: 228 KYISNTWLWDRVRVSGGAYGGFCDFDTHSGVFSFLSYRDPNLLKTLDVYDGTGDFL 283 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5057 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5908 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8381 (352 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11566258 97 4e-22 >Vv11566258 Length = 537 Score = 97.4 bits (241), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 40/70 (57%), Positives = 57/70 (81%) Query: 71 KIRKPYTITKSRESWTDQEHDKFLEALQLFDRDWKKIESFVGSKTVIQIRSHAQKYFLKV 130 + RKPYTITK RE WT++EH++FLEAL+L+ R W++IE +G+KT +QIRSHAQK+F K+ Sbjct: 136 QTRKPYTITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFSKL 195 Query: 131 QKKGTSEHVP 140 +K+ + VP Sbjct: 196 EKEALVKGVP 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12578 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32458 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226778833 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10855 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv161 61 2e-11 >Vv161 Length = 95 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 13/93 (13%) Query: 98 EEFSKILERARESGALVVVDFYRTSCGSCKYIEQGFSKLCKGAGDGEAAVIFLKHNVIDE 157 +EF L +A + LV+V+FY T C SC+ + F KLCK A D +IFLK N Sbjct: 8 QEFLSALSQAGDK--LVIVEFYGTWCASCRAL---FPKLCKTAQD-YPNIIFLKVN---- 57 Query: 158 YDEQSEVADRLRIKTVPLFHFYK--DGVLLEAF 188 +DE + L +K +P FHFY+ DG LLE+F Sbjct: 58 FDENKSMCKSLNVKMLPCFHFYRGSDG-LLESF 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49631623 (62 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146193 (137 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22824 (399 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25452 (419 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27972 (434 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 182 8e-48 >Vv31003 Length = 427 Score = 182 bits (463), Expect = 8e-48, Method: Compositional matrix adjust. Identities = 110/286 (38%), Positives = 164/286 (57%), Gaps = 13/286 (4%) Query: 121 FTMQEINKATKNFSPSFKIGQGGFGTVYKGRLGDGT-LVAIKRAKKSVYDKHLGV-EFQS 178 FT ++ AT NF +G+GGFG V+KG L + + +VAIK+ ++ G+ EF Sbjct: 99 FTFHQLAVATDNFRSDCFLGEGGFGKVFKGYLDNPSQVVAIKQLDRNGLQ---GIREFFV 155 Query: 179 EIQMLAQVEHLNLVKFYGYLEHEDEKIVVVEYVPNGTLRQHLECL--YGQILDLAARLDV 236 E+ L+ V+H NLVK GY D++++V EY+P G+L HL L + LD +R+ + Sbjct: 156 EVLTLSSVDHPNLVKLIGYCAEGDQRLLVYEYMPLGSLENHLHDLPPGTKPLDWNSRMKI 215 Query: 237 AIDVAHAVTYLHMYTDHPIIHRDIKSSNILLTENFRAKVADFGFARLAADSDSGETHVST 296 A A + YLH P+I+RD+K SNILL E + K++DFG A++ D +THVST Sbjct: 216 AAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGD--KTHVST 273 Query: 297 QVKGTAGYLDPEYLRTYQLTEKSDVFSFGVLLVELVTGRRPIEPKREIKERITAKWAMKK 356 +V GT GY P+Y T QLT KSD++SF V+L+EL+TGR+ I+ + +E+ WA Sbjct: 274 RVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAWARPL 333 Query: 357 FTDGDALSILDPRLEQTAANNVAIEKILELALQCLAPRRQNRPSMR 402 F D S + L + + L +A C+ Q +P+MR Sbjct: 334 FKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCV----QEQPNMR 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19075 (84 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13126 (304 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26571 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12515 (163 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32253 (200 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34517 266 1e-73 >Vv34517 Length = 488 Score = 266 bits (681), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 127/199 (63%), Positives = 163/199 (81%) Query: 1 MNSKDISRIVSSTQFTRLAKLLDEDKVSNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQ 60 + SKD++ IV+S F RLAKLLD+DKVS KI+ GGQ D+ LK APTILLDVPED+ +M Sbjct: 290 LESKDLAHIVNSNHFARLAKLLDDDKVSGKIIHGGQRDKANLKFAPTILLDVPEDSLVMN 349 Query: 61 EEIFGPLMPIVTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTV 120 EEIFGPL+PI+TV+K+EDSF +I S+ KPLA Y FTNN++LK+ FV VS+GG++INDTV Sbjct: 350 EEIFGPLLPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTV 409 Query: 121 LHVSIGGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLF 180 LH + LPFGGVGESGMGSYHGKFS++ FSH+K+VLY+GFAGD+ RYPPY+ K +L Sbjct: 410 LHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYKGFAGDASARYPPYSDRKLKLL 469 Query: 181 RAVINRDIFTIILALIGWS 199 +A+++ + +ILALIGWS Sbjct: 470 KALLSGSVLGVILALIGWS 488 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32576 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30618 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91046348 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11566258 97 2e-22 >Vv11566258 Length = 537 Score = 97.1 bits (240), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 40/69 (57%), Positives = 55/69 (79%) Query: 27 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKV 86 + RKPYTITK RE WT+EEH++FLEAL+L+ R W++IE+ +G+KT +QIRSHAQK+F K+ Sbjct: 136 QTRKPYTITKQRERWTEEEHNRFLEALKLYGRAWQRIEEHIGTKTAVQIRSHAQKFFSKL 195 Query: 87 QKSGTTAHV 95 +K V Sbjct: 196 EKEALVKGV 204 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10590 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20220 142 2e-36 >Vv20220 Length = 129 Score = 142 bits (358), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 77/133 (57%), Positives = 88/133 (66%), Gaps = 12/133 (9%) Query: 1 MGSMSSPLTMISAQPLKQSA--------AAVGRSPSLFRMHSEKKKSLTVVAAIGDVSAD 52 M S++ T+ LKQS+ VG + S +KK+SLTVVAA+G+VS D Sbjct: 1 MVSLAPLQTLFPGNSLKQSSLPGFYARPTPVGSAVS----WKKKKRSLTVVAAVGEVSTD 56 Query: 53 GTPYLIXXXXXXXXXXXXFPILFSRKDLCPECDGAGFVRKGGATLRANAARKDEAQIVCA 112 GT YLI FPI FSRKDLCPECDGAGFVR+ G LRANAARKD+AQIVCA Sbjct: 57 GTIYLIAGAVAVTVLGTAFPIFFSRKDLCPECDGAGFVRQSGVALRANAARKDQAQIVCA 116 Query: 113 RCNGLGKLNQVDK 125 RCNGLGKLNQVDK Sbjct: 117 RCNGLGKLNQVDK 129 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71823815 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65458 124 1e-30 >Vv65458 Length = 352 Score = 124 bits (310), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 79/218 (36%), Positives = 111/218 (50%), Gaps = 18/218 (8%) Query: 3 FAPNVQEMVISNPLQVPETFLVSKKEENEPKSTADVLDLSSKIPILDLSMLSREHKE--- 59 A VQEMV+ P+ ++ + +E DV S IPI+DLS+ S E Sbjct: 13 LAKRVQEMVLKGE-DPPQPYICRDGDGSE-----DVSSSLSPIPIIDLSLFSSSAPETTE 66 Query: 60 -ELNKLDQACKEWGFFHVVNHGVATELLHEMKDATAKFFELPLEEKNKRRMSGGRE---G 115 EL KL A WG F HG++T L E++ T +FFE P+EEK K +S G E G Sbjct: 67 KELQKLKSALSSWGCFQATGHGISTSFLDEIRQVTKEFFEQPIEEKKK--ISKGVEEFEG 124 Query: 116 YGQAYAISEGQTMDWSDTLILSLYPAQSRDLHVWPTAPNGFKETIEAYSSEVKRIGEELI 175 YG EGQ +DWSD + L +YP R WP +PN F++ +E Y+ ++K + E + Sbjct: 125 YGADPTPEEGQYLDWSDRVFLDVYPEDLRKYKFWPESPNSFRDVLENYTIKMKIVTEMIS 184 Query: 176 TSLSTIMELEKDALLGLHKE--VLQALRVNYTPPCSMP 211 +++ + LE+ L E LQA R NY C P Sbjct: 185 KAMAKSLNLEEKCFLNQFGERGALQA-RFNYYSRCLRP 221 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18443 (118 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6269 116 1e-28 >Vv6269 Length = 186 Score = 116 bits (290), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 70/120 (58%), Positives = 85/120 (70%), Gaps = 4/120 (3%) Query: 1 MAKRELSSTLRNLKFMQRATQREVKKEEDVKPAV--DFAFPSRQIRKCVVIVEGDPQPEA 58 M+KRELSSTLRNLKFMQRA Q+E K +++ + +F P+ RKCVVI+EGDP P A Sbjct: 1 MSKRELSSTLRNLKFMQRANQKEEKSKKEEEVKPEDNFFSPNTVKRKCVVIMEGDPHPGA 60 Query: 59 VRGRMSFQSFNPAIDKLNQVPENPGQPAAAATSSSIHSEKVSFRENGSSMDEAGCSNTDK 118 +GRMSFQ+FNPAIDKLN NP QPA +AT S+ SEK + REN SS+D N DK Sbjct: 61 TKGRMSFQNFNPAIDKLNDA-ANPCQPAVSATCSNNQSEK-NCRENRSSLDGEESMNVDK 118 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25354 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813426 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27448 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9628 (201 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27265 (486 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1830 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4708 154 4e-40 >Vv4708 Length = 471 Score = 154 bits (390), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 67/90 (74%), Positives = 77/90 (85%) Query: 39 TWCVANAKAGEEKLQAALDYACGEGGADCRPIQEGSTCFTPNTLEAHASYAFNSFYQKRA 98 TWCVAN + G+EKLQAALDYACGEG ADC PIQ G+TC+ PNTLEAHAS+AFNS+YQK+ Sbjct: 382 TWCVANGETGKEKLQAALDYACGEGQADCHPIQPGATCYDPNTLEAHASFAFNSYYQKKG 441 Query: 99 RGTGTCNFGGAAYVVAQPPKYGTCEFPTGY 128 R GTC+F GAAYVV Q P++G CEFPTGY Sbjct: 442 RVIGTCDFQGAAYVVTQAPRFGKCEFPTGY 471 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17017 (103 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27182 (447 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3466264 877 0.0 >Vv3466264 Length = 447 Score = 877 bits (2266), Expect = 0.0, Method: Compositional matrix adjust. Identities = 420/436 (96%), Positives = 431/436 (98%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD 240 VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD++ EPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGPTGLTTEVKSVEMHHE+L EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRGFVASNSKDDPAKEAANF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 AEI+TKIDRRSGKELEKEPKFLKNGDAG+VKMIPTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKEPTG 436 VAVGVIK+VEKK+P+G Sbjct: 421 VAVGVIKNVEKKDPSG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6439 (450 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19588 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9420 (377 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32486 207 3e-55 >Vv32486 Length = 134 Score = 207 bits (526), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 97/134 (72%), Positives = 110/134 (82%) Query: 244 MCFTYFSMYGMMVVALTPGHQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPV 303 MCF YF++YGMM+VALTP HQIAAIVMSFFLSFWNLFSGFLIPR IPIWWRWYYW SPV Sbjct: 1 MCFIYFTLYGMMIVALTPNHQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWASPV 60 Query: 304 AWTIYGIFTSQVGDMKTNIDIPIQGPQKIDVFLKNYLGFDYDFLIPVVIAHLGWVLLFFF 363 AWTIYG+ TSQVGD + + +P + +LK LGF+YDFL V +AH+GWVLLF F Sbjct: 61 AWTIYGLVTSQVGDKEDPVQVPGADDMSVKQYLKEALGFEYDFLRAVALAHIGWVLLFLF 120 Query: 364 VFAYGIKYLNFQRR 377 VFAYGIK+LNFQRR Sbjct: 121 VFAYGIKFLNFQRR 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11611 (329 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24960 (93 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23203 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24121 (439 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18416 216 5e-58 >Vv18416 Length = 340 Score = 216 bits (551), Expect = 5e-58, Method: Compositional matrix adjust. Identities = 117/285 (41%), Positives = 169/285 (59%), Gaps = 24/285 (8%) Query: 12 KYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIKHP 71 +Y+ + +G G F + R+ +T E VA+K +++ K K+ E ++REI + ++HP Sbjct: 4 RYDALKELGSGNFGVARLVRDKKTKELVAVKYIERGK----KIDENVQREIINHRSLRHP 59 Query: 72 NVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRYFQQLINAVDYCHSRG 131 N+V+ EV+ + T + IVME+ GGELF++I N GR EDEAR +FQQLI+ V YCHS Sbjct: 60 NIVRFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSME 119 Query: 132 VYHRDLKPENLLLDA--YGNLKVSDFGLSALSQQVRDDGLLH----TTCGTPNYVAPEVL 185 + HRDLK EN LLD LK+ DFG S LLH + GTP Y+APEVL Sbjct: 120 ICHRDLKLENTLLDGSPMPRLKICDFGYSK-------SALLHSQPKSAVGTPAYIAPEVL 172 Query: 186 NDRGYDGATADLWSCGVILFVLLAGYLPFDDS----NLMNLYKKISAAEFTCPPWLSFGA 241 + + YDG AD+WSCGV L+V+L G PF+D N +I + +++ P ++ A Sbjct: 173 SRKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEDPRNFRKTIGRIMSVQYSIPDYVHVSA 232 Query: 242 --MKLIARILDPNPMTRVTIAEILEDEWFKKDYKAPVFEEKENTN 284 +L++RI NP R+TI EI + WF K++ + E E TN Sbjct: 233 ECRQLLSRIFVANPAKRITIPEIKQHPWFLKNFPKELI-EGEKTN 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13065 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18545 (75 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv59489 126 7e-32 >Vv59489 Length = 375 Score = 126 bits (317), Expect = 7e-32, Method: Compositional matrix adjust. Identities = 59/75 (78%), Positives = 67/75 (89%) Query: 1 MAINLIDRMLTFDPTKRITVEQALAHPYLERLHDIADEPICTKPFSFDFEQQPLGEEQMK 60 +AI+LIDRMLTFDPTKRITVE+ALAHPYL RLHD ADEP+C +PFSF+FEQQ L EEQMK Sbjct: 301 LAIDLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMK 360 Query: 61 DMIYREAIALNPEYA 75 DMIY+EA+ NP YA Sbjct: 361 DMIYQEALFFNPGYA 375 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30481 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57061 214 7e-58 >Vv57061 Length = 158 Score = 214 bits (545), Expect = 7e-58, Method: Compositional matrix adjust. Identities = 124/160 (77%), Positives = 140/160 (87%), Gaps = 2/160 (1%) Query: 1 MSQAPSLPRLRSPFLSCPLKLSTSPSSFCASHKFSGNQRSPKSYPCIRAIDLDQNTVVAI 60 MS APSLPRL S F+ CPLKLS+ S SHKF+ NQRSP SYP IRA+DLDQNT+VAI Sbjct: 1 MSIAPSLPRLHSSFICCPLKLSSPSPS--LSHKFARNQRSPASYPRIRALDLDQNTIVAI 58 Query: 61 SVGLVSVAVGIGIPVFYESQIDSAAKRDNTQPCFPCNGTGAQKCRFCTGSGTVTVELGGG 120 SVG+VSVAVGIG+P+FYE+QID+AAKR+NTQPCFPC+G+GAQ+CRFC G+G VTV LGG Sbjct: 59 SVGVVSVAVGIGVPIFYETQIDNAAKRENTQPCFPCDGSGAQRCRFCMGTGNVTVVLGGD 118 Query: 121 EKEVSNCINCEGVGSFTCTTCQGSGIQPRYLDRREFKDDD 160 EKEVS CINC+G GS TCTTCQGSGIQPRYLDRREFKDDD Sbjct: 119 EKEVSRCINCDGAGSLTCTTCQGSGIQPRYLDRREFKDDD 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990148 (123 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30021 (66 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27653 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226780478 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48279658 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12837 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4505 (254 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15768 (307 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6543 (275 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18023 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22878 (358 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6942 (151 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48398376 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56745 142 7e-36 >Vv56745 Length = 547 Score = 142 bits (357), Expect = 7e-36, Method: Compositional matrix adjust. Identities = 83/213 (38%), Positives = 119/213 (55%), Gaps = 36/213 (16%) Query: 1 LEEGITLAVRRLGEGGSQRFKEFQTEVEAIGKLRHPNVVTLKAYYWSVDEKLLIYDYIPN 60 LE G +AV+RL + EF+ ++E +G + H ++V L+AYY+S DEKLL+YDY+P Sbjct: 272 LEMGTVVAVKRLKDVTISE-NEFREKIEGVGAMDHEHLVPLRAYYYSRDEKLLVYDYMPM 330 Query: 61 GSLATALHGKPGLVSFTPLSWSVRLNIMKGIAKGLVYLHEFSPKKYVHGDLKPNNILLGQ 120 GSL+ LHG G TPL+W +R I G A+G+ YLH P HG++K +NILL + Sbjct: 331 GSLSALLHGNKG-AGRTPLNWEIRSGIALGAARGIEYLHSQGP-SVSHGNIKSSNILLTK 388 Query: 121 NMEPRISDFGLGRLANIAGGSPTLQSNRIPTEKSQERQQKSAAPXXXXXXXXXXNLGSCY 180 + + R+SDFGL L P+ NR+ + Y Sbjct: 389 SYDARVSDFGLAHLV-----GPSSTPNRV----------------------------AGY 415 Query: 181 QAPESLKVVKPSQKWDVYSYGVILLEMITGRLP 213 +APE K SQK DVYS+GV++LE++TG+ P Sbjct: 416 RAPEVTDPRKVSQKADVYSFGVLILELLTGKAP 448 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5915 (298 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23931 144 2e-36 >Vv23931 Length = 251 Score = 144 bits (364), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 67/120 (55%), Positives = 86/120 (71%) Query: 9 EENEFRRGPWTLEEDNLLIHYIVNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIKR 68 E+ +G WT EED+ LI YI HGEG W SL K AGL R GKSCRLRW+NYL+PD+KR Sbjct: 8 EKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKR 67 Query: 69 GNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQLNIESNSEQ 128 GN T +E +I++LHS GN+WS IA LPGRTDNEIKNYW T ++++ I+ ++ + Sbjct: 68 GNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRGIDPSTHR 127 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226744329 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9270 (281 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26633 (253 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226812699 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10801 (276 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5650 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24526 (193 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1988 (110 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2558 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4842 (401 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16354 542 e-156 >Vv16354 Length = 432 Score = 542 bits (1396), Expect = e-156, Method: Compositional matrix adjust. Identities = 257/381 (67%), Positives = 294/381 (77%), Gaps = 3/381 (0%) Query: 24 VKDPELVMQEVQESINAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFG 81 V DP+ V V SI S RR LGY SCGTGNPIDDCWRCD NW+KNR+RLADC IGFG Sbjct: 52 VDDPDAVASMVDMSIRNSTERRKLGYFSCGTGNPIDDCWRCDHNWQKNRKRLADCGIGFG 111 Query: 82 KHAIGGRDGKIYVVTDSGDH-PVNPKPGTLRYGVIQNEPLWIIFQRDMTIKLNEELMMNS 140 ++AIGGRDG+ YVVTD GD PVNPKPGTLR+ VIQ+ PLWI+F+RDM I L +EL+MNS Sbjct: 112 RNAIGGRDGRFYVVTDPGDDDPVNPKPGTLRHAVIQDAPLWIVFKRDMVITLKQELIMNS 171 Query: 141 FKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHFGWRTLSDG 200 FKTIDGRG +VHIA G CIT+Q+VTN+IIHGL+IHDCK GNA VR SP HFGWRT++DG Sbjct: 172 FKTIDGRGVNVHIANGACITVQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADG 231 Query: 201 DGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLGHSDSYTQD 260 D +SIFG SH+WVDHNSLS+C DGL+DA+ GST+ITISNN+ HHN+VMLLGHSDSY +D Sbjct: 232 DAISIFGSSHIWVDHNSLSSCADGLVDAVMGSTAITISNNHFAHHNEVMLLGHSDSYERD 291 Query: 261 KNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQGNRFLA 320 K MQVTIA+NHFGEGLIQRMPRCRHG FHVVNNDYTHWEMYAIGGSASPTINSQGNR+LA Sbjct: 292 KQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLA 351 Query: 321 PNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNXXXXXXXXXXXXXXXXXXXXXXXXXX 380 P + F KEVTK D P +W WNWRS GDLLLN Sbjct: 352 PVNPFAKEVTKRVDTPSGQWKGWNWRSEGDLLLNGAYFTPSGAGASASYARASSLGAKSS 411 Query: 381 XXXXXXXAGAGSLRCKKGSRC 401 + AG+L C++GS+C Sbjct: 412 SMVGSITSNAGALSCRRGSQC 432 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5097 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746547 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16576 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24820 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26371 (388 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2343 (585 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43779 360 e-101 >Vv43779 Length = 588 Score = 360 bits (923), Expect = e-101, Method: Compositional matrix adjust. Identities = 199/553 (35%), Positives = 317/553 (57%), Gaps = 14/553 (2%) Query: 45 KACSFILGTFFCERLAFYGISTNLVNYFIDKLHEETVVASTSITNWKGTCYITPLIGAIL 104 KA F++G E+L G STNL+ Y + +++ A+T + + G+ LIGA L Sbjct: 21 KAMPFVIGNETFEKLGTIGTSTNLLVYLTTVFNMKSITATTFVNVFNGSTNFATLIGAFL 80 Query: 105 ADTYWGRYWTI--AGFTTVYLIGMCTLTLSASVPALKPAECVGS---VCPAATSAQYAVL 159 DTY+GRY T+ A ++ L GM +TL+A+V + P C + C T+ Q A L Sbjct: 81 CDTYFGRYNTLGFASISSFLLKGMLVITLTAAVQKMHPPHCGTTDTGTCIGPTAGQMAFL 140 Query: 160 IAGLYLIALGTGGIKPCIWPFGADQFDDTDPKERVKKGSYFNWFYFSQNIGAIIASSLLV 219 ++G L+ +G GI+PC FGADQF+ + S+FNW+YF+ +++ +++V Sbjct: 141 LSGFGLLVIGAAGIRPCNLAFGADQFNPETESGKRGISSFFNWYYFTYTFAMMVSLTVIV 200 Query: 220 WIQENVGWGIGFGIPTALMGVCIASLLIGTPLYRFQKPGGSPLTRIFQVLVAAFRKRNVK 279 ++Q +V W +G IPT LM + A +GT +Y KP GSPL + V+VAA +KR ++ Sbjct: 201 YVQSDVSWSLGLAIPTLLMLLSCALYFMGTRIYVKVKPEGSPLKNVAHVIVAAVKKRRLE 260 Query: 280 VLGDSVLYETQDKSSAIEGSRKLDHSNELRCLDKAALIT-NTEI-AYGNFSDPWRLCTVT 337 + G L + A + KL H+++ R L K A++T +I + G+ ++PWRL ++ Sbjct: 261 LPGQPWL-SLFNHIPANSINSKLPHTDQFRFLSKGAILTPEVQINSDGSAANPWRLSSMQ 319 Query: 338 QVEELKILVRMFPIWATGIVFSAVFAQMSTLFVVQGKLMDRTVGSV--TIPAASLSFFDF 395 +VEE+K ++R+ PIWA GI++ Q ST V Q DR +GS IPAAS + F Sbjct: 320 KVEEVKCVIRVIPIWAAGIIYYVALVQQSTYVVFQALQSDRRLGSTGFKIPAASYTVFTM 379 Query: 396 VSVIIWVPIYDRVITPIAKRYTHKERGFSQLQRMGIGLFVSILCMAAAALLEIKRLQLA- 454 +S+ IW+PIYD++I P+ +R T KE G + LQ+MGIG+ ++++ M +AL+E +R LA Sbjct: 380 LSLTIWIPIYDQIIVPLLRRLTGKEVGITLLQKMGIGMVLAVITMILSALVEERRRTLAL 439 Query: 455 --RELGLIHQKVAV-PLSILWQIPQYFLLGAAEVFTFIGQHEFYYEQAPDAMRSLCSALS 511 +G+ ++ A+ LS +W +PQ L+G +E T IGQ EF+Y+Q P+ MRS A Sbjct: 440 TKATVGIEARRGAISSLSGMWLVPQLTLIGISEGLTIIGQVEFFYKQFPENMRSFAGAFL 499 Query: 512 LLTNSLGNYXXXXXXXXXXXXXXEGGKAGWIPDNLNEGHLDYFYWLLAGLSFLNLVVYMV 571 + NY W+P++LN+G LDYFY+L+A L +NL+ ++ Sbjct: 500 FCGIAFSNYLSSFLVSIVHQSTGGTATGNWLPEDLNKGRLDYFYYLVAALGMVNLLYFLA 559 Query: 572 FSRKYIEKKASAA 584 ++ Y K + + Sbjct: 560 CAKWYKYKDSEES 572 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig926 (423 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 210146429 (115 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33350 80 1e-17 >Vv33350 Length = 189 Score = 79.7 bits (195), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 33/79 (41%), Positives = 54/79 (68%) Query: 14 EKSDIYSYGVILWELATEKIPWDNLNSMQVIGAVGFMDQRLEIPKDVDPQWTCLIESCWQ 73 EK D+YS+G+++WEL T P+ +++ +IG + R +IP+ +P+W L+ESCW Sbjct: 104 EKIDVYSFGIVMWELLTGDEPYADMHCASIIGGIVNNTLRPQIPRWCEPEWKYLMESCWA 163 Query: 74 SDAASRPTFQELLEKLRDL 92 SD A RP+F E+ +KLR++ Sbjct: 164 SDPAERPSFSEISQKLRNM 182 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9502 (271 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 143 3e-36 >Vv12866259 Length = 264 Score = 143 bits (361), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 95/243 (39%), Positives = 128/243 (52%), Gaps = 43/243 (17%) Query: 36 GGR-KLRVRSFTAPTGSSSSFTVRAAAADPDRPLWFP--GSTPPPWLDGSLPGDFGFDPL 92 GGR +R F AP+GS PDR L+ PP +L G PGD+G+D Sbjct: 30 GGRVSMRKTGFKAPSGSPWY--------GPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTA 81 Query: 93 GLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGI-LNTPSWYTAGEQ------ 145 GLS+DP++ N++ E++HCRWAMLGA G PE L++ G+ W+ AG Q Sbjct: 82 GLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGG 141 Query: 146 -EYFTDTT--------TLFVVELVLIGWAEGRRWADILKPGSVNTDPIFPNNKLTGTDVG 196 +Y + + ++ +++L+G EG R A P TDP+ Sbjct: 142 LDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAG--GPLGEVTDPL------------ 187 Query: 197 YPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHL 256 YPGG FDPLG PE EL+ KEIKNGRLAM ++ G + Q I TG GP++NL HL Sbjct: 188 YPGGS-FDPLGLAD-DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL 245 Query: 257 ADP 259 ADP Sbjct: 246 ADP 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 53858449 (131 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21685 161 3e-42 >Vv21685 Length = 220 Score = 161 bits (408), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 85/129 (65%), Positives = 98/129 (75%), Gaps = 1/129 (0%) Query: 1 MAVSWSGAKMGETVLDLCCGSGDLAFLLSEKVGSNGKVIGLDFSKEQLSVASSRQKLKSK 60 MAVSWSGAK G+ VLDLCCGSGDLAFLLSE+VGS+GKV+ S L + KS Sbjct: 61 MAVSWSGAKRGDDVLDLCCGSGDLAFLLSERVGSDGKVLISQGSNYWLLHLDNTCSQKSA 120 Query: 61 ACYLNIEW-VEGDATELPFSDGHFDAITMAYGLRNVVDKHKAMEEIFRVLKAGSRVSILD 119 L+ W +EGDAT+LPFSD FDAITM YGLRNV+D+ KAM+E+FRVLK GSRVSILD Sbjct: 121 TKTLSEHWWIEGDATKLPFSDCSFDAITMGYGLRNVLDRGKAMQEMFRVLKPGSRVSILD 180 Query: 120 FNKSTNPIV 128 FNKST P + Sbjct: 181 FNKSTKPSI 189 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23341 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13739 (485 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22056 863 0.0 >Vv22056 Length = 487 Score = 863 bits (2231), Expect = 0.0, Method: Compositional matrix adjust. Identities = 412/465 (88%), Positives = 433/465 (93%), Gaps = 1/465 (0%) Query: 1 MAPIKGILSLQRAALARHHGAKWGLAFRSFSTQGAAPSTTAQXXXXXXX-EKTHFGGLKD 59 MAPI+GIL+LQR AL KWG R+FSTQ A ++ +Q EKTHFGGLKD Sbjct: 1 MAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFGGLKD 60 Query: 60 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKSGLRGRGGAGFPSGL 119 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKD+V+KG+DWIVNEMKKSGLRGRGGAGFPSGL Sbjct: 61 EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKSGLRGRGGAGFPSGL 120 Query: 120 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRASAAYIY 179 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRA+ AYIY Sbjct: 121 KWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGVGMRATTAYIY 180 Query: 180 IRGEYVNERLNLVKARNEAYAAGLLGKNACGSGYDFDVHIHFGAGAYICGEETALLESLE 239 IRGEYVNER NL +AR EAY AGLLGKNACGSGYDFDVHIH+GAGAYICGEETALLESLE Sbjct: 181 IRGEYVNERKNLERARKEAYEAGLLGKNACGSGYDFDVHIHYGAGAYICGEETALLESLE 240 Query: 240 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFASFGRKNNSGTKLFC 299 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFA FGRKNN+GTKL+C Sbjct: 241 GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFAGFGRKNNAGTKLYC 300 Query: 300 ISGHVNKPCTVEEEMSIPLKELLERHCGGVRGGWDNLLAVIPGGSSVPLLTKDICNDVLM 359 +SGHVNKPCTVEEEMSIPLKEL+ERHCGGVRGGWDNLLAVIPGGSSVPLL K IC+DVLM Sbjct: 301 VSGHVNKPCTVEEEMSIPLKELIERHCGGVRGGWDNLLAVIPGGSSVPLLPKHICDDVLM 360 Query: 360 DFDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHESCGQCTPCREGTGWLWMIME 419 D+DALKAVQSGLGTAAVIVMDKSTD+VDAIARLSYFYKHESCGQCTPCREGTGWL M+ME Sbjct: 361 DYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREGTGWLLMMME 420 Query: 420 RMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF 464 R+KVGNA LEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF Sbjct: 421 RLKVGNANLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIRHF 465 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10093 (272 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26388 (74 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14657 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4228 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27691 (210 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6436 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17978 356 e-100 >Vv17978 Length = 673 Score = 356 bits (913), Expect = e-100, Method: Compositional matrix adjust. Identities = 166/191 (86%), Positives = 179/191 (93%) Query: 1 MDFRFFTLGNLWSIVSSLGTQKQNEGILNLIEAKWDDFVAQMPLKICYPALEYEEWRIIT 60 MDFRFFTLGNLWSI+SSLGT KQNEGILNLIEAKWDD VA MPLKICYPALE EEWRIIT Sbjct: 482 MDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPALENEEWRIIT 541 Query: 61 GGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVALAEKRLSMDNWPEYYDTK 120 G DPKNTPWSYHNGGSWPTLLWQFTLACIKMGR ELA+KAVALAE+RLS+D+WPEYYDT+ Sbjct: 542 GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVALAEERLSVDHWPEYYDTR 601 Query: 121 SGRFIGKQSRLHQTWTIAGYLTSKMLLENPDKASLLFWEEDYELLETCVCALNKTSRKKC 180 +GRFIGKQSRL+QTWTIAG+LTSKMLLENP+ ASLL WEEDYELLE CVCAL+KT RKKC Sbjct: 602 NGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICVCALSKTGRKKC 661 Query: 181 SRFAAKSQVAV 191 SR AA+SQ+ V Sbjct: 662 SRSAARSQIPV 672 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22760 (313 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10532 (387 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32220 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv569 149 1e-38 >Vv569 Length = 284 Score = 149 bits (375), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 68/92 (73%), Positives = 75/92 (81%) Query: 1 CNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNTRMNPGIEAFPSKDFGQQTFDNAA 60 CNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVN+RMN +E FP KD G QTFD AA Sbjct: 193 CNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRMNHTVEGFPLKDLGVQTFDAAA 252 Query: 61 MAFSTQPPREYNRGNSPEWLHMQVGGGFNRTT 92 M + +Q REY +G+ PEWLHMQVGG R + Sbjct: 253 MIYGSQATREYAQGSQPEWLHMQVGGSIERAS 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226790710 (50 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18465 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv50427 113 2e-27 >Vv50427 Length = 141 Score = 113 bits (283), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 47/95 (49%), Positives = 69/95 (72%) Query: 12 LQVVANNLDVLALPLVTLVYPLYASIRAIETKSRTDDQQWLTYWVLYSLMTIFELTFAKV 71 L +A +L LA P+ L+YPLYAS+ AIE+ ++ DD+QWL YW+LYS +T+ E+ + Sbjct: 4 LWTLATHLHSLAGPVTMLLYPLYASVMAIESTTKVDDEQWLAYWILYSFLTLMEMLLQPI 63 Query: 72 LECLPVWTYAKLIFTCWLVLPQFNGAAYVYRRFIR 106 L+ +P+W KL+F WLVLPQF GAA++Y +F+R Sbjct: 64 LKWIPIWYDVKLVFVAWLVLPQFRGAAFIYEKFVR 98 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17475 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31690 (159 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6829 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4613 145 5e-37 >Vv4613 Length = 177 Score = 145 bits (365), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 69/109 (63%), Positives = 78/109 (71%) Query: 62 SNPAEAGFLSGSTGKKSVPGPELPQIDFLKRFNEENQKKYAENDARFRSTQXXXXXXXXX 121 SNPA AGFLSG +G +SVPGPELPQ+DFL +FNEENQKKYAE D RF+S+ Sbjct: 65 SNPANAGFLSGFSGIESVPGPELPQVDFLNKFNEENQKKYAEFDERFKSSPLLKELLERS 124 Query: 122 XXXXXXXXXXIQDKYCIRGAEWGVGDCSAEGMTPNEKDKFIAMLKEKAG 170 IQDKYCIRGAEWGVGDCS EGM+P +KD FIA LK+K G Sbjct: 125 KLNQEKNRKEIQDKYCIRGAEWGVGDCSVEGMSPADKDNFIATLKQKLG 173 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5373 (198 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5471 (348 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489103 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226754887 (71 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814953 (145 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226811488 (89 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17294 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6531 (406 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19136 (108 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6902 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14679 (327 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18416 167 2e-43 >Vv18416 Length = 340 Score = 167 bits (424), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 92/227 (40%), Positives = 131/227 (57%), Gaps = 20/227 (8%) Query: 7 DQIKREISVMRLVRHPNIIHLYEVMATKTKIYFVIEYAKGGELFNKVAK-GKLKEEVARK 65 + ++REI R +RHPNI+ EV+ T T + V+EYA GGELF ++ G+ E+ AR Sbjct: 44 ENVQREIINHRSLRHPNIVRFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARF 103 Query: 66 YFSQLIDALDFCHSRGVYHRDIKPXXXXXXXXXX--XKISDFGLSALAESKRQDGLLHT- 122 +F QLI + +CHS + HRD+K KI DFG S + LLH+ Sbjct: 104 FFQQLISGVSYCHSMEICHRDLKLENTLLDGSPMPRLKICDFGYS-------KSALLHSQ 156 Query: 123 ---TCGTPAYVAPEVINRRGYDGVKADIWSCGVVLYVLLAGCLPFQDSNLMEMYRK-IGK 178 GTPAY+APEV++R+ YDG AD+WSCGV LYV+L G PF+D +RK IG+ Sbjct: 157 PKSAVGTPAYIAPEVLSRKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEDPRNFRKTIGR 216 Query: 179 ---AEFKCPNF--FSPEARRLLYRMLDPNPNSRISIAKVGESSWYRK 220 ++ P++ S E R+LL R+ NP RI+I ++ + W+ K Sbjct: 217 IMSVQYSIPDYVHVSAECRQLLSRIFVANPAKRITIPEIKQHPWFLK 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18502 (359 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3581 186 5e-49 >Vv3581 Length = 277 Score = 186 bits (472), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 106/266 (39%), Positives = 151/266 (56%), Gaps = 18/266 (6%) Query: 105 SAVMAKLTDDVESLSHAFDGCRGVFHTSAFVDPAGLSGYTKSMAEIEVKASENVMKACAV 164 S V+AK+ D++SL AF GC VFHTS+F+D G+SGY++ MA +E +A+ NV++AC Sbjct: 15 SVVVAKM-GDLDSLCDAFRGCHAVFHTSSFIDIHGVSGYSEWMAFLETEAARNVIEACCR 73 Query: 165 TPSVRKCVLTSSLLACVWQDSTHNHLSPVINHDSWSTESLCIDKKLWYALGKLRXXXXXX 224 V++C+ TSSLLA +W D + + +I+ WS E C D+KLW A+GK Sbjct: 74 AAYVKRCIFTSSLLASIWTD---DDRTGIIDESCWSDEEFCRDRKLWLAMGKTAAEKVAW 130 Query: 225 XXXXXXGVKLATICPALITGPEISTRNPTATLAYLKGAQEMYQSGVLATVDITRLAEAHL 284 VKL T+CP L+ P + ++ YLKG + M Q GVLAT DI+++A+AH+ Sbjct: 131 SKSQEMKVKLVTVCPGLLMAPSFPNAHTETSVPYLKGGRMMLQRGVLATNDISKVAKAHV 190 Query: 285 GVFEAMNEAAFGRYICFDRVVDGEEEAEKLAEATSMPKTKFVGNGGSNIIQN-------- 336 V+E M+ A GRY CF+RVV +EA +L M +GG N+ + Sbjct: 191 HVYEEMDYGACGRYFCFERVVRRLDEAIQLENNLKMHGQL---SGGGNLPSSTQETDGEI 247 Query: 337 RFELSNRKLTNLL---SGRVHCCYSS 359 + LSN KL L+ S R C SS Sbjct: 248 QISLSNSKLAKLMLRVSQRSSCKQSS 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27642 (351 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17962 (89 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20731 (198 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32826 (455 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35733 180 4e-47 >Vv35733 Length = 262 Score = 180 bits (457), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 94/246 (38%), Positives = 148/246 (60%), Gaps = 21/246 (8%) Query: 222 DLEPAAFTLAPEILPI---GPLLASSRLENS--QGNFWPQDSTCLDWLDQQKPRSVIYVA 276 +LEP +I PI GPL + ++ N+ +G+F D C++WLD + P SV+Y++ Sbjct: 6 ELEPEVIKYMSKICPIKPVGPLYKNPKVPNAAVRGDFMKADD-CIEWLDSKPPSSVVYIS 64 Query: 277 FGSLTVFDQTQFQELALALELSGRPFLWVVRPDTTDGASD--PYPEGYQERVGSRGLMVG 334 FGS+ Q Q E+A L SG FLWV++P D + PEG+ E+ G +G MV Sbjct: 65 FGSVVYLKQDQVDEIAYGLLNSGVQFLWVMKPPHKDAGLELLVLPEGFLEKAGDKGKMVQ 124 Query: 335 WAPQQKVLSHPSIACFISHCGWNSTLEGLSSGLPFLCWPYFADQLLNESYICDIWKVGLR 394 W+PQ++VL+HPS+ACF++HCGWNS++E LSSG+P + +P + DQ+ + Y+ D++KVG+R Sbjct: 125 WSPQEQVLAHPSVACFVTHCGWNSSMEALSSGMPVVAFPQWGDQVTDAKYLVDVFKVGVR 184 Query: 395 FDKNES--GIITEGEIKTKVEQLLSDENFTARASKLKEVAMN-------NIKEGGQSYET 445 + E+ +IT E VE+ L + +A++LK+ AM + EGG S Sbjct: 185 MCRGEAENKLITRDE----VEKCLIEATTGEKAAELKQNAMKWKKAAEEAVAEGGSSDRN 240 Query: 446 FKNFIE 451 + F++ Sbjct: 241 LQEFVD 246 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16051 (297 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15952 274 2e-75 >Vv15952 Length = 151 Score = 274 bits (700), Expect = 2e-75, Method: Compositional matrix adjust. Identities = 132/150 (88%), Positives = 137/150 (91%) Query: 140 MLTYGFPLAIIGMAFKYAELKPVPCLTYSDALQLRETSATPILTQVRNDVTRYRYGDEQH 199 MLTYGFPLAIIGMA KYAELKPVPCLTYSDA +LRETS PIL QVRNDV RYRYGDEQH Sbjct: 1 MLTYGFPLAIIGMALKYAELKPVPCLTYSDAQKLRETSXPPILKQVRNDVIRYRYGDEQH 60 Query: 200 LDEALKRIFQYGQGGGIARRSAPTLQSIREEVTGDGRYSLVLVFEAKALQLSDFEQRQAK 259 L+EALKRIFQYG GGGI RRSAPTLQ IREEVT DG+Y LVLVFEAKALQLSDFE+RQAK Sbjct: 61 LEEALKRIFQYGLGGGIPRRSAPTLQMIREEVTEDGKYCLVLVFEAKALQLSDFEKRQAK 120 Query: 260 FASFFGPGITAEVGKGENNLYEVRLISNSN 289 FASFFGPGITAEV KGEN+LYEVRLISNS Sbjct: 121 FASFFGPGITAEVAKGENDLYEVRLISNST 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14383 (381 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig732 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11499 (121 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9097 (113 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12866259 170 7e-45 >Vv12866259 Length = 264 Score = 170 bits (430), Expect = 7e-45, Method: Compositional matrix adjust. Identities = 83/111 (74%), Positives = 92/111 (82%) Query: 1 MLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQV 60 MLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QV Sbjct: 105 MLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV 164 Query: 61 VLMGFIEGYRVXXXXXXXXXXXXXXXXAFDPLGLADDPEAFAELKVKELKE 111 +LMG +EGYR+ +FDPLGLADDPEAFAELKVKE+K Sbjct: 165 ILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKN 215 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24488 (308 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30334 227 2e-61 >Vv30334 Length = 435 Score = 227 bits (578), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 131/308 (42%), Positives = 188/308 (61%), Gaps = 28/308 (9%) Query: 23 SSLAPDRDDSVTPEPVDPRVR----LMYMANEGDLDAIRELIDSGTN-VNFTDIDGRTAL 77 S+ A +D + + RV +++ A++ D A+R+L++ + V+ D D RT L Sbjct: 13 STSAAGKDKASDKQKEKARVSRTSLILWHAHQNDAAAVRKLLEEDQSLVHARDYDSRTPL 72 Query: 78 HVAACQGQTDVVQLLLQRGAEVDPRDCWGSTPLADAIYYKNDDVIKLLEDYGAKPPMAPM 137 HVA+ G DV + L++ GA+V+ +D W +TPLADA K +I+LL+ YG Sbjct: 73 HVASLHGWIDVAKCLIEFGADVNAQDRWKNTPLADAEGAKKHSMIELLKSYGGLS----- 127 Query: 138 HVQNSREVP------------EYEINPNELDFSNSVEITKGTYR---IASWRGIQVAVKT 182 + QN ++EI+P+ELDFSNS I KG++ A WRG VAVK Sbjct: 128 YGQNGSHFEPKPVPPPLPNKCDWEIDPSELDFSNSSIIGKGSFGEILKACWRGTPVAVKR 187 Query: 183 LGEKVFADEDKVNAFRDELSLLQKIRHPNVVQFLGAVTQSSPMMIVIEYLSKGDFRAYLK 242 + + D + FR E++LL K+RHPN+VQFLGAVT P+M++ EYL GD YLK Sbjct: 188 ILPSLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDKKPLMLITEYLRGGDLHQYLK 247 Query: 243 RKGALKPPSALKFSLDIARGMNYLHEHKPEAIIHRDLEPSNILRDDSG--HLKVADFGVS 300 KG+L P +A+ F++DIARGM YLH ++P IIHRDL+P N+L ++G HLKV DFG+S Sbjct: 248 EKGSLSPSTAITFAMDIARGMAYLH-NEPNVIIHRDLKPRNVLLVNTGADHLKVGDFGLS 306 Query: 301 KLLKVANT 308 KL+KV N+ Sbjct: 307 KLIKVQNS 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12777 (236 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv59233 159 6e-41 >Vv59233 Length = 448 Score = 159 bits (401), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 105/236 (44%), Positives = 151/236 (63%), Gaps = 6/236 (2%) Query: 2 IRVVQQSLLGSILSNMLLVLGCAFFTGGIIHYQKIQVFNKSAALVNSGLLLMAVMGLMFP 61 I VV+ SLLGS+LSN+LLVLG + F GGI + ++ Q +++ + +NS LLL+ ++ M P Sbjct: 147 ILVVKYSLLGSVLSNLLLVLGTSLFCGGIYNLREEQKYDRKQSDINSLLLLLGLLCHMLP 206 Query: 62 AVLHFTRSEIH---FGKSELSLSRFSSCVMLVAYASYLFFQLRSHRNLYNPXXXXXXXXX 118 + + + S LSLSR S VMLVAY +YL FQL +HR L+ Sbjct: 207 LMFRYAANPSGAALIADSTLSLSRAGSIVMLVAYLAYLVFQLWTHRKLFE---APEDGDD 263 Query: 119 XXXXXXXXXXXTHWEAIGWLAVLTVWVSVLSGYLVDAIQGASDSFNMPVAFISVILLPIV 178 W ++ WL ++T +++LS ++V I+ AS+S+ + V+FIS+ILLPIV Sbjct: 264 DTVSSDEEPVIGFWSSVVWLILMTAIIALLSEFVVGTIEVASESWGISVSFISIILLPIV 323 Query: 179 GNAAEHASAIMFAMKDKLDITLGVAIGSSTQISMFVIPFCVVVGVDHGTANGLEFS 234 GNAAEHA A++FA K+KLDI+LGVA+GS+TQI+MFV+P CV+V G L+FS Sbjct: 324 GNAAEHAGAVIFAFKNKLDISLGVALGSATQIAMFVVPLCVLVAWIMGIRMDLDFS 379 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54686638 (89 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51913309 (207 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21254 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24662 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12766262 62 6e-12 >Vv12766262 Length = 668 Score = 62.4 bits (150), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 43/156 (27%), Positives = 77/156 (49%), Gaps = 13/156 (8%) Query: 46 CIHVAVSGGHIDVVKELLRVCPELARVVDENGNSPLHYASCKGHREITGMLLRIDPNLAQ 105 +H A GG+++++KELL C ++ D G++ LH AS +G EI LL ++ Sbjct: 191 AVHAAARGGNLEILKELLHDCTDVLVYRDMQGSTILHTASGRGQVEIVKGLLE-SYDIIN 249 Query: 106 EYNNNGHTPLHLAVINYKVSVLQVFVSTAKPSFQMVTKSGETVFHLAV---------RYG 156 +N G+T L++A ++VL+V + + S + G+T+ H+AV R Sbjct: 250 STDNQGNTALNVAAYRGYLTVLEVLILASPSSIFLTNNYGDTLLHMAVAGFRSPGFRRLD 309 Query: 157 QHDALM---YLTHVCDDTEFFDCQDLHGNTILHLAV 189 + LM + + + + ++ G T LH+AV Sbjct: 310 RQIELMKQLLRGKIVNMEDIINAKNNDGRTALHMAV 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2612 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22966256 245 7e-67 >Vv22966256 Length = 306 Score = 245 bits (625), Expect = 7e-67, Method: Compositional matrix adjust. Identities = 128/241 (53%), Positives = 162/241 (67%) Query: 4 IAFGRFDDSFSLGSLKAYLAEFISTLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAIAH 63 IA G+ D++ +LK LAEF TL+FVFAG GS +A++KLT D + PAGL+A A+ H Sbjct: 61 IAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIAEALGH 120 Query: 64 GFALFVAVSIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLVGAIVAAFILKFVT 123 G LFVAVS NISGGH+NPAVTFG +GG IT+L GI YWIAQL+G+ VA +LKF T Sbjct: 121 GLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLLLKFCT 180 Query: 124 GGLTIPIHSLAAGVGAIQGVVFEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGA 183 G+T ++++G V EI++TF LVYTVYATA DP+ G++G IAP+AIG IV A Sbjct: 181 HGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIGLIVAA 240 Query: 184 NILAAGPFSGGSMNPARSFGPAVASGDFHDNWIYWVXXXXXXXXXXXXXXNVFIHSEHAP 243 NILA G F G SMNPA SFGPA+ S D+ ++W+YW +FI H P Sbjct: 241 NILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFIDRTHEP 300 Query: 244 L 244 L Sbjct: 301 L 301 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5506 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3302 280 1e-77 >Vv3302 Length = 652 Score = 280 bits (715), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 134/155 (86%), Positives = 145/155 (93%) Query: 1 MTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPR 60 MTVLIPRNTTIPTKKEQ+FSTYSDNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPR Sbjct: 416 MTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPR 475 Query: 61 GVPQINVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERMVQEAEKYKAED 120 GVPQINVCFDIDANGILNVSAEDKT G KNKITITNDKGRLSKEEIE+MVQEAEKYK+ED Sbjct: 476 GVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSED 535 Query: 121 EEVKKKENAKNSLENYALHMRNTVKEDKVAGKLNP 155 EE KKK AKN+LENYA +MRNT+K++K+ KL P Sbjct: 536 EEHKKKVEAKNALENYAYNMRNTIKDEKIGAKLPP 570 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265055 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9175 (294 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18597 317 1e-88 >Vv18597 Length = 309 Score = 317 bits (812), Expect = 1e-88, Method: Compositional matrix adjust. Identities = 178/314 (56%), Positives = 216/314 (68%), Gaps = 25/314 (7%) Query: 1 MAGAMVRIPVIRR----SSDDIYEFPGTTVSLADMVLGFIEEVEVPPEN--TTSGSDEDD 54 MA A RIP I R ++ ++ G SL+DM GF+E+ E PE+ +T G E+ Sbjct: 1 MARATARIPAIHRNFLSANLELGFTAGQAASLSDMAFGFLEDGEGWPESFSSTGGCSENG 60 Query: 55 ------------ENSCSVEENKAFWEEQDQLLQATLCKTSSVESKIRQATKEAVREINSS 102 +NS SVEENK FWE Q Q+L TLC+TSS+E IR ATKEA++EI Sbjct: 61 ALDDDEDDDDKEKNSSSVEENKNFWESQHQILHTTLCRTSSLELGIRNATKEALKEIQMD 120 Query: 103 SAEYCVCSRPVAGGCRKCLRTEICKRLIDSGYNCAICKSKWRSSTNAPAGEHTYLEVLDK 162 CVC RPV GGCR CL E+ RL ++GYN AICKSKWRSS N P+GEHT+L+V+ Sbjct: 121 D-NVCVCLRPVVGGCRSCLLREVSDRLRNAGYNSAICKSKWRSSPNIPSGEHTFLDVVHN 179 Query: 163 S-SKRGEIRVVIELNFRAEFEMARASENYNRLISWLPEVFVGKADRLRALIKILCCAAKT 221 S +K+GE+RV+IELNFRAEFEMARASE YNRLI LPEVFVGK +RL L+KILC AAK Sbjct: 180 SNAKKGEVRVIIELNFRAEFEMARASEEYNRLIRRLPEVFVGKVERLHTLVKILCMAAKK 239 Query: 222 CMKEKKMHLGPWRKHKYVQAKWFGTLER-STPGSLPVGFSHGPPKPKASILTFDLLEAAM 280 CMKEKKMH+GPWRKH+Y+QAKW T R ++ SL G S PKPKAS+LT DL+E + Sbjct: 240 CMKEKKMHMGPWRKHRYMQAKWLSTCVRSTSTSSLLSGDSGRLPKPKASMLTVDLME-KL 298 Query: 281 PAGLHCAGTAVEVV 294 P +HC TAVEVV Sbjct: 299 P-NMHC--TAVEVV 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855795 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990137 (83 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040385 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47598 178 6e-47 >Vv47598 Length = 293 Score = 178 bits (451), Expect = 6e-47, Method: Compositional matrix adjust. Identities = 81/109 (74%), Positives = 93/109 (85%) Query: 1 MTNAILSHFKFKRRGGAAIQGLKGCGYTAHPPPSSPFEIMSPGEAMKADTPGWFSFGSEP 60 +T+A+LSHFKFKRRGGAAIQGLKGC Y +HPP SSPFEI+SP EAMK ++PGWFSF SE Sbjct: 183 LTSAMLSHFKFKRRGGAAIQGLKGCSYCSHPPLSSPFEILSPAEAMKTESPGWFSFDSES 242 Query: 61 QEKPGSWSRQDVPYTILKNKLSRVYAAPPQERLKPVYNTPPSKYETLDQ 109 ++K GSW+ QD PY ILKNKLSRVY PP ERLK Y+TPPSKYET+DQ Sbjct: 243 EKKRGSWTVQDDPYIILKNKLSRVYTTPPTERLKEFYDTPPSKYETIDQ 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2474 (420 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824629 (100 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3444 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16040 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25324 (400 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200602 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23023 (350 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1157 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283027 (115 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71815794 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5396 (134 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55037 83 2e-18 >Vv55037 Length = 444 Score = 83.2 bits (204), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 40/84 (47%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Query: 1 MPTLTKLYTMQEASQHNTKDNCWVVIDGKVYDVSTYLDDHPGGDDVLLDATGRDATEDFE 60 M T +K+Y+M E +HN+ D+ W+V+ G VYD + +L DHPGG D +L G D TE+F Sbjct: 66 MNTSSKMYSMSEVKKHNSADSTWIVVHGHVYDCTRFLKDHPGGTDSILINAGTDCTEEF- 124 Query: 61 DAGHSKTAREEMEAFCIGELDTTS 84 DA HS A++ +E + IGEL TT Sbjct: 125 DAIHSDKAKKLLEDYRIGELMTTG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226813500 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48270958 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48266188 (127 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60475 104 6e-25 >Vv60475 Length = 405 Score = 104 bits (259), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 52/100 (52%), Positives = 66/100 (66%) Query: 27 ASALRGFASSAKEMTVRDALNSALDEEMSADPKVFLMGEEVGEYQGAYKITKGLLDKYGP 86 AS + E+ + +AL L+EEM DP+V +MGE+VG Y G+YK+TKGL KYG Sbjct: 72 ASVTSTASKPGHELLLFEALREGLEEEMDRDPRVCVMGEDVGHYGGSYKVTKGLATKYGD 131 Query: 87 DRVLDTPITEAGFTGIGVGAAYYGLRPVIEFMTFNFSMQA 126 RVLDTPI E FTG+G+GAA GLRP+IE M F + A Sbjct: 132 LRVLDTPIAENSFTGMGIGAAMTGLRPIIEGMNMGFLLLA 171 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10758 (436 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27440 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36137 185 3e-49 >Vv36137 Length = 198 Score = 185 bits (470), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 103/164 (62%), Positives = 121/164 (73%), Gaps = 4/164 (2%) Query: 1 MAESNAVIGLSWEPKLPAFXXX-XXXXXXXXXXPRPEGNPLWKPSTQLVDGLFVPPNDPV 59 M+ES AVIGLSWEPKL G LWKP ++LVDGLFVPPN+P Sbjct: 1 MSESKAVIGLSWEPKLSLLSSAPKNGSDKSENVAENSGASLWKPDSELVDGLFVPPNNPR 60 Query: 60 KRNKLAKKQIKDTAGTSWFDMPAPTMTPELQKDLQLLKLRNVMDPKRHYKKGDAQPN--- 116 K NKL +KQ+KDT GT WFDMPAPT+TPEL+KDLQLLKLR+ +DPKRHYKK D++ Sbjct: 61 KVNKLLRKQVKDTTGTKWFDMPAPTITPELKKDLQLLKLRSAIDPKRHYKKSDSKSKTLP 120 Query: 117 KYFQVGTIIESPLDFFSGRLTKKERKVSLAEEVLSDRNLGNYRK 160 KYFQVGT+IES DFFSGRLTKKERK SLA+E+LS+ + +YRK Sbjct: 121 KYFQVGTVIESASDFFSGRLTKKERKASLADELLSNSSFADYRK 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51098616 (168 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10326 (54 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55699223 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13485 (397 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41423 134 2e-33 >Vv41423 Length = 360 Score = 134 bits (338), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 103/360 (28%), Positives = 168/360 (46%), Gaps = 21/360 (5%) Query: 19 AAMAAVQLFNGGYHVITKVALNVGVNQLVFCVYRDXXXXXXXXXXXYVREKR-IRQPMNR 77 +AM A++ N G + + K A G+N VF VY ++ +R + P++ Sbjct: 14 SAMVALECTNVGLNTLYKAATLRGLNYHVFVVYAYGIAALVLLPSPFITHRRGVLPPLSF 73 Query: 78 RLFVSFFFLGLTGIFGNQLLFLIGLGYTNPTYAAAIQPAIPVFTFILAVLMGTERVNLLR 137 + F LGL G +Q + G+ ++PT A+AI +P FTFILAV+ E++ L Sbjct: 74 PVLCKIFVLGLIGC-ASQTMGYRGINISSPTLASAISNLVPAFTFILAVIFRMEKLALRS 132 Query: 138 TEGQAKVGGTLLCVSGAILMVLFRGPPLIGYTEPDFAAHSEISAKGQPEPAGWLMSSFLE 197 + QAK+ GT++ +SGA ++ L++GPP+I P + H P P SS++ Sbjct: 133 SSSQAKIIGTIVSISGAFVVTLYKGPPIILTPSPSISLHQP------PHPLRSSESSWI- 185 Query: 198 FGLDHFHLGVLCLLGNCMCMAAFLAIQAPLLKRYTANLSVTAYSYFFGALLMVVTALFMT 257 +G L L + +QA ++K Y + +V + F +LL + L Sbjct: 186 -------IGALFLSVEYFLTPVWYIVQAHIIKEYPSEPTVVFFYNLFVSLLAAIVGLVTE 238 Query: 258 NESTDWSL-THSELFAVFYAGTVASALNYGLLTWSNKILGPAMVALYNPLQPAASAFLSR 316 S+ W + L ++ +G S L + TW+ ++ GP VA++ PL + + Sbjct: 239 PNSSVWIVRPRIALASIVCSGIFGSFLGNTIHTWAIRMKGPVYVAMFKPLAIIIAVTMGV 298 Query: 317 IFLGSPIYLGSVLGGILIIAGLYVVTWASLRERQAALDVVIPHVARGS---EPLIQKDAT 373 LG +YLGSV+G +I G Y V W +E D I + S PL+Q T Sbjct: 299 ALLGDSLYLGSVIGATIITMGFYTVMWGKAQEDMVE-DCTIGSLESPSAQKAPLLQNYKT 357 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27045 (240 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48290058 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22668 (337 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71919120 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26134 (234 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11451 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv50427 189 2e-50 >Vv50427 Length = 141 Score = 189 bits (481), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 91/146 (62%), Positives = 112/146 (76%), Gaps = 5/146 (3%) Query: 1 MGKAWTFLTQLHTVAGPVLMLLYPLYASVVAIESTSKLDDQQWLAYWIIYSFLTLMEMVL 60 MG+ WT T LH++AGPV MLLYPLYASV+AIEST+K+DD+QWLAYWI+YSFLTLMEM+L Sbjct: 1 MGRLWTLATHLHSLAGPVTMLLYPLYASVMAIESTTKVDDEQWLAYWILYSFLTLMEMLL 60 Query: 61 QPALEWLPIWYNVKLVFVAWLVLPQFKGAAFLYERYVRDQVRKYAGFNNHPQYNHPQSSK 120 QP L+W+PIWY+VKLVFVAWLVLPQF+GAAF+YE++VR+Q+ K+ + Sbjct: 61 QPILKWIPIWYDVKLVFVAWLVLPQFRGAAFIYEKFVREQIWKHGRAG-----RAENRAS 115 Query: 121 TSSPTGKAKNKFVQFMNPKNEEQEAY 146 TS GK NK VQF+ K EAY Sbjct: 116 TSHHHGKGDNKSVQFVGLKKGPHEAY 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23306 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25856 (305 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8669 (179 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764647 (176 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25162 81 1e-17 >Vv25162 Length = 112 Score = 80.9 bits (198), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 34/42 (80%), Positives = 40/42 (95%) Query: 120 KCGSEMVAALWITELSSPFLHIRELLKELGYRDSDLNLAADL 161 +CGSEMVA+LWITE+SSPFLH+RELLKELGYRD+DLNL D+ Sbjct: 2 QCGSEMVASLWITEISSPFLHLRELLKELGYRDTDLNLTVDM 43 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25753 (308 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24056 (423 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2660 (229 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11572 293 3e-81 >Vv11572 Length = 233 Score = 293 bits (749), Expect = 3e-81, Method: Compositional matrix adjust. Identities = 138/175 (78%), Positives = 152/175 (86%) Query: 55 QGLRIRSAATKQAKTPAEEDWKTKRELLLQKKVRSVDVKEALRLQKENNFVILDVRPEAE 114 +GL+I+SAATK AK+PAEEDWK KRE+LL+KKVRSVD KEALRLQ+ENNFVILDVRPEAE Sbjct: 53 RGLKIQSAATKPAKSPAEEDWKIKREVLLEKKVRSVDAKEALRLQQENNFVILDVRPEAE 112 Query: 115 FREAHPAGAINVQIYRLIKEWTAWDXXXXXXXXXXXXXXXTEENPEFMSSVESQLDKKAK 174 F+EAHP GAINVQIYRLIKEWTAWD TEENPEFM SVES++DK AK Sbjct: 113 FKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFAGTEENPEFMQSVESKIDKSAK 172 Query: 175 IIVACAAGGTMKPTQNLPEGQQSRSLIAAYLLVLNGYTNVFHLDGGLYAWFKEEL 229 IIVAC++GGTMKP+QNLPEGQQSRSLIAAYLLVLNGYTNVFHL+GGLY WFKE L Sbjct: 173 IIVACSSGGTMKPSQNLPEGQQSRSLIAAYLLVLNGYTNVFHLEGGLYTWFKEGL 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990485 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43002 162 2e-42 >Vv43002 Length = 213 Score = 162 bits (409), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 79/115 (68%), Positives = 96/115 (83%), Gaps = 3/115 (2%) Query: 1 MGCYCSKEAKT-PGYEDPATLAAATPFAVTVNEVEALYELFKKLSSSIIDDGLIHKEEFQ 59 MGC+ S K PG+EDP LA+ T F+V+ EVEAL+ELFK +SSS+IDDGLI+KEEFQ Sbjct: 1 MGCFQSTARKQFPGHEDPVILASQTAFSVS--EVEALFELFKSISSSVIDDGLINKEEFQ 58 Query: 60 LALFRNKNQRNLFADRIFDLFDVKRNGVIEFGEFVRSLGVFHPHAPVEDKISFAF 114 LALF+N+ + NLFA+RIFDLFDVKR GVI+FG+FVRSL VFHP+AP EDKI F+F Sbjct: 59 LALFKNRKKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNAPQEDKIDFSF 113 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20929 (331 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21889 (267 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28510 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41793 218 5e-59 >Vv41793 Length = 323 Score = 218 bits (554), Expect = 5e-59, Method: Compositional matrix adjust. Identities = 109/136 (80%), Positives = 116/136 (85%) Query: 17 WMFNVVTSVGIIIVNKALMATYGFSXXXXXXXXXXXXXXXMTVVLRWLGYIQPSHLPVSE 76 WMFNVVTSVGII+VNKALMATYGFS MT VLRWLGYIQ SHLPVSE Sbjct: 20 WMFNVVTSVGIIMVNKALMATYGFSFATTLTGLHFATTTLMTTVLRWLGYIQGSHLPVSE 79 Query: 77 LLKFMVFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDKIRYSRDTKLSIGI 136 LL+F++FAN SIVGMNVSLMWNSVGFYQIAKLSMIPVSC+LEVVLDK+RYSRDTKLSI + Sbjct: 80 LLRFVLFANLSIVGMNVSLMWNSVGFYQIAKLSMIPVSCVLEVVLDKMRYSRDTKLSISL 139 Query: 137 VLLGVGVCTVTDVSVN 152 VLLGV VCTVTDVSVN Sbjct: 140 VLLGVAVCTVTDVSVN 155 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31715 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24371 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7694 (302 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv318 214 1e-57 >Vv318 Length = 316 Score = 214 bits (545), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 114/271 (42%), Positives = 164/271 (60%), Gaps = 18/271 (6%) Query: 48 SNRIDPSRVVRLSWQPRVFLYKGFLSDEECDHLVSLALGGEDKSVTEYDELGNTNTMRL- 106 ++ DP+RV +LSW+PR FLYKGFLS+EECDHL++LA +KS+ +E G + + Sbjct: 46 ASGFDPTRVTQLSWRPRAFLYKGFLSEEECDHLITLAKDKLEKSMVADNESGKSIMSEVR 105 Query: 107 IKSLEIPLDMEDEVVSRIEARISAWTFLPKENSRAIQVFHFGN-EEGDKNFNYFGNKSTL 165 S L +DE+V+ IEARI+AWTFLP EN +IQ+ H+ N E+ + +F+YF +K Sbjct: 106 TSSGMFLLKAQDEIVADIEARIAAWTFLPVENGESIQILHYENGEKCEPHFDYFHDKVNQ 165 Query: 166 EQTEPLLATVICI--------------SQMSLVVLTSKVQSDCRRSSSILRPVKGNAILF 211 +ATV+ S+ SDC + + P KG+A+LF Sbjct: 166 LLGGHRIATVLMYLATVDEGGETVFPNSEGRFSQPKDDSWSDCAKKGYAVNPKKGDALLF 225 Query: 212 FTLHPNASPDKSSPHTRCPVLEGEMWCATKFLHAKAIAGEKISSDSGSSECTDEDDNCPR 271 F+LHP+A+ D SS H CPV+ GE W ATK++H ++ +K S EC DED++CP+ Sbjct: 226 FSLHPDATTDPSSLHGSCPVIVGEKWSATKWIHVRSF--DKPSKRGVQGECVDEDEHCPK 283 Query: 272 WASMGECQRNPVFMVGSPDYHRTCRKSWNGC 302 WA++GEC++NPV+MVGS + CRKS C Sbjct: 284 WAAVGECEKNPVYMVGSENSDGFCRKSCGVC 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19908 (110 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33766 61 5e-12 >Vv33766 Length = 134 Score = 61.2 bits (147), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Query: 4 QKAVLKVLTMTDDKTKQKAIEAAADIFGIDSIAADIKDQKLTVVGMMDPXXXXXXXXXXX 63 +K VLK L + DDK KQKA++A + + G++SIA D+KD+KLTVVG +DP Sbjct: 2 KKVVLK-LDLHDDKAKQKAMKAVSSLSGVNSIATDMKDKKLTVVGDVDPVDIVSKLRKGW 60 Query: 64 XXDIVSVGPA 73 DI++VGPA Sbjct: 61 HTDILTVGPA 70 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226765319 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27416 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9536 (425 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33397 330 4e-92 >Vv33397 Length = 216 Score = 330 bits (845), Expect = 4e-92, Method: Compositional matrix adjust. Identities = 158/214 (73%), Positives = 182/214 (85%) Query: 1 MDRLEAPARLMIVSDLDHTMVDHHDTENLSLLRFNSLWEANYRHDSLLVFSTGRSPTLYK 60 M + + RLM+VSDLD TMVDH+D+EN SLLRFN+LWEANYRH+SLLVFSTGRSP +YK Sbjct: 3 MAGVNSCPRLMVVSDLDLTMVDHYDSENHSLLRFNALWEANYRHNSLLVFSTGRSPAIYK 62 Query: 61 ELRKEKPMLTPDITIMSVGTEITYGNTMVPDDGWVEVLNKKWDRNIVKEEASKFSELKLQ 120 +LRKEKP+L+PDIT+MSVGTEI YG +MVPD+ WVE LN+ WDRN+V EE KF EL Q Sbjct: 63 QLRKEKPLLSPDITVMSVGTEIAYGESMVPDNDWVEFLNQNWDRNMVIEETRKFPELIPQ 122 Query: 121 AETEQRPHKVSFYVEKAKAQEVTKALSEVFVKRRLDVKIIYSGGMDLDILPQGAGKGQAL 180 +ETEQRPHKVSFY+EK KA EV KALSE K LD KIIYSGG+ LD+LP GAGKGQAL Sbjct: 123 SETEQRPHKVSFYIEKDKAGEVIKALSESLEKNGLDFKIIYSGGIALDVLPHGAGKGQAL 182 Query: 181 AYLLKKLKSEGRPPVNTLVCGDSGNDAELFSIPE 214 AYLLK+LK+EG+ P NTLVCGDSGNDAELFS+PE Sbjct: 183 AYLLKRLKTEGKVPDNTLVCGDSGNDAELFSVPE 216 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6621 (284 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv569 324 1e-90 >Vv569 Length = 284 Score = 324 bits (830), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 186/292 (63%), Positives = 205/292 (70%), Gaps = 16/292 (5%) Query: 1 MDPPLINEXXXXXXXXXXXXLAEIWPFS-------GEPXXXXXXXXXXXXXXXXXXXXXX 53 MDPPLINE LAEIWPF GEP Sbjct: 1 MDPPLINESSFSAANPSAYSLAEIWPFPVNSASAIGEPTAGLGLRIANFGQIMGQFADSS 60 Query: 54 XXXVNRDGSLEESTVTEQSXXXXXXXRKRRDVNYEDESSKRVSTRSGNGLK-DLGKRMKL 112 NRD S++ESTVTEQS RKRRDV+ EDESSK VST SG+G+ GKRMK+ Sbjct: 61 ---ANRDVSVDESTVTEQSGSRGGG-RKRRDVSSEDESSKIVSTSSGSGMNASNGKRMKI 116 Query: 113 AVSRNENDNLKAEVEESSAGGDSKPAEESTKPSEPPKQDYIHVRARRGQATDSHSLAERA 172 + + +EN KAE+E SS G+ KPAEES KP+E KQDYIHVRARRGQATDSHSLAERA Sbjct: 117 SRTPDENGGSKAELEASSVAGE-KPAEES-KPAEQSKQDYIHVRARRGQATDSHSLAERA 174 Query: 173 RREKISERMKVLQDLVPGCNKVIGKALVLDEIINYIQSLQHQVEFLSMKLEAVNSRVNMN 232 RREKISERMK+LQDLVPGCNKVIGKALVLDEIINYIQSLQ QVEFLSMKLEAVNSR MN Sbjct: 175 RREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSR--MN 232 Query: 233 PTIEAFPPKDLGAQPFDAAALLFSSHTPREYAQSSQPEWLHMQVGGSFDRAT 284 T+E FP KDLG Q FDAAA+++ S REYAQ SQPEWLHMQVGGS +RA+ Sbjct: 233 HTVEGFPLKDLGVQTFDAAAMIYGSQATREYAQGSQPEWLHMQVGGSIERAS 284 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27007 (207 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19510 267 1e-73 >Vv19510 Length = 257 Score = 267 bits (682), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 132/208 (63%), Positives = 157/208 (75%), Gaps = 3/208 (1%) Query: 1 MGLKFEEEEFLACCASTKFAKEMAEASPFSSLDEAVTAARDIWFNKVDVNGWLQSFSAHP 60 M K EE++FLACC S KFA+EM + PF++LD+A+ AARDIWFNKVDVNGWL++F+AHP Sbjct: 1 MDSKMEEKDFLACCGSKKFAEEMTSSGPFANLDQAIDAARDIWFNKVDVNGWLEAFAAHP 60 Query: 61 QIG-NXXXXXXXXXXAQWSKGEQXXXXXXXXXXXLQELAEWNAKYRQKFGFVFLICASGK 119 QIG N AQWSKGEQ LQEL++WNA+Y +KFGFVFLICASG+ Sbjct: 61 QIGQNPSAKHPSDTSAQWSKGEQSTALQTATDSSLQELSDWNARYWKKFGFVFLICASGR 120 Query: 120 SSDGILAELKKRYPNRPIVEFEIAAQEQMKITELRLAKLFAAKENVTSTGNKNPTIVAKK 179 ++ ILAELK+RYPNRPIVEFEIAAQEQMK+TELRLAKLF+ + S +NP AKK Sbjct: 121 TASEILAELKRRYPNRPIVEFEIAAQEQMKVTELRLAKLFSTQVKAASISTQNPETAAKK 180 Query: 180 A-EDRVSIIGGHLTATASEASSVKLSQL 206 A EDRVSIIG HLTAT SEAS+ K Q+ Sbjct: 181 AGEDRVSIIGAHLTAT-SEASAGKTPQI 207 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27018 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8475 85 8e-19 >Vv8475 Length = 88 Score = 85.1 bits (209), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 49/84 (58%), Positives = 55/84 (65%), Gaps = 5/84 (5%) Query: 15 RVHQSG---ESPCVGGIHGSTRRSSFCLXXXXXXXX-XXXXXXLQRSILNQAYMDEKLGV 70 R HQSG +SP V +HG TRRSSFCL +QRS+LNQAY DEKLG Sbjct: 2 RFHQSGGCSDSPTVA-VHGCTRRSSFCLYTSNHENHHATSSSSMQRSVLNQAYSDEKLGG 60 Query: 71 EAREAKGRLDERLRTQRKPQPKRH 94 AREAK RLDERLRTQRK +P R+ Sbjct: 61 VAREAKERLDERLRTQRKSEPTRN 84 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7377 (65 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20275 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15114 (306 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27821 99 7e-23 >Vv27821 Length = 418 Score = 99.4 bits (246), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 59/147 (40%), Positives = 82/147 (55%), Gaps = 13/147 (8%) Query: 18 KQRLRWTHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLP 77 K RL+WT +LHERF++AV QLGG D+ATPK V+++MG+ GLT+YH+KSHLQKYRL+K L Sbjct: 46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRLSKNLH 105 Query: 78 XXXXXXXXXXXXEPGDVLSNLDG----SP--GMQITEALKL-----QMEVQKXXXXXXXX 126 G+ + +G SP G Q ++L L +E Q+ Sbjct: 106 GQANSATSKTVV--GERMPEANGALMSSPNIGNQTNKSLHLSETLQMIEAQRRLHEQLEV 163 Query: 127 XXXXXXXXXAQGKYLKKIIEEQQRLSG 153 AQGKYL+ ++E+ Q G Sbjct: 164 QRHLQLRIEAQGKYLQAVLEKAQETLG 190 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27589 (543 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15994 184 2e-48 >Vv15994 Length = 269 Score = 184 bits (468), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 83/125 (66%), Positives = 102/125 (81%), Gaps = 4/125 (3%) Query: 423 YNKADFPEEYTDAKFFIIKSYSEDDVHKSIKYNVWASTPNGNKKLHAAYQEAQEKSGGC- 481 YN DF EY +AKF++IKS+SEDD+HK IKY+VWASTPNGNKKL AA+ +A+ K+ Sbjct: 1 YNLQDFQTEYENAKFYVIKSFSEDDIHKCIKYDVWASTPNGNKKLDAAFHDAEAKANETG 60 Query: 482 ---PVFLLFSVNTSGQFVGLAEMLGPVDFNKNLEYWQQDKWNGCSPVKWHIVKDVPNSLL 538 P+FL FSVN SGQFVG+AEM+G VDFNK++++WQ DKWNG PVKWHIVKD+PNS L Sbjct: 61 TKFPIFLFFSVNGSGQFVGVAEMVGQVDFNKDMDFWQLDKWNGFFPVKWHIVKDIPNSQL 120 Query: 539 KHITL 543 +HITL Sbjct: 121 RHITL 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20884 (490 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6166 (98 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10034 (323 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56337 186 5e-49 >Vv56337 Length = 311 Score = 186 bits (472), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 105/230 (45%), Positives = 137/230 (59%), Gaps = 42/230 (18%) Query: 118 NEEEIENQRMTHIAVERNRRKQMNEYLSVLRSIMPDSYVQRGDQASIIGGAINYVKELEQ 177 N+EE E QRMTHIAVERNRR+QMNE+L++LRS+MP+SYVQRGDQASI+GGAI +VKELE Sbjct: 91 NKEEAETQRMTHIAVERNRRRQMNEHLAILRSLMPESYVQRGDQASIVGGAIEFVKELEH 150 Query: 178 EVQFL---------GVQKPNDRA--------------------PFSEFFTFPQYSSRSST 208 +Q L GV++ D + PFS+FF +PQY+ Sbjct: 151 LLQSLEARKHKMLQGVRENVDDSSSSSSSSTGTGITANKFMPPPFSQFFVYPQYTWSQMP 210 Query: 209 SDHESAVSAMAELPLLECRLSKIAADIEVTMVESHASLKVRSKKVPKQLWKIVSGLHDMX 268 + + S A ADIEVT++E+HA+L++ S K P+ L K+V+G + Sbjct: 211 NKYTSKSKAA-------------VADIEVTLIETHANLRILSHKSPRLLSKMVTGFQTLY 257 Query: 269 XXXXXXXXXXXDDIVLYSLSLKVENECMLTSVDEIATAVHEMLARIQEEA 318 D +VLYS+S KVE C LTSVD+IA AVH ML I+EEA Sbjct: 258 LTILHLNVTTVDPLVLYSISAKVEEGCQLTSVDDIAGAVHHMLRIIEEEA 307 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15529 (240 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30388 (443 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26272 70 1e-13 >Vv26272 Length = 357 Score = 69.7 bits (169), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 32/70 (45%), Positives = 46/70 (65%) Query: 79 VRADSDFYSVLGVSRNASKSEIKSAYRKLARSYHPDVNKEPGAETKFKEISNAYEVLSDD 138 V+ D+Y VLG+ ++ + +I+ AYRKL+ HPD NK PGAE FK +S A++ LS++ Sbjct: 108 VKKKKDYYEVLGLEKSCTVEDIRKAYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNE 167 Query: 139 EKRSLYDKYG 148 E R YD G Sbjct: 168 ESRKKYDLVG 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21658 (352 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv40140 131 2e-32 >Vv40140 Length = 391 Score = 131 bits (329), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 86/255 (33%), Positives = 135/255 (52%), Gaps = 15/255 (5%) Query: 104 LGITFTKD-GDLVACDTDQGLLKITEAG--VTVLTSHVNGSKIRFADDVIEGPDGSLYFS 160 LG+ F K GDL D+ GL+K+ G T L + +G +RF +D+ G++YF+ Sbjct: 134 LGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEADGVPLRFTNDLDIDDAGNIYFT 193 Query: 161 VASTKFGPHDGYLDMLEAKPHGQLLKYDPSSGETSILLDHLGFANGVAVSKDQDYLVVCE 220 +S+K+ + + ++ G+LLKYDP + ET++LL L F NGV++SKD +LV+CE Sbjct: 194 DSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVSLSKDGSFLVLCE 253 Query: 221 -----TWKYWLEGKNKGKTEIFVENLPGGPDNINLAPDGSFWIALLQLTREGFEFV---- 271 KYWL+G G +E+F LPG PDN+ G FW+A + R + ++ Sbjct: 254 GSPGRLVKYWLKGDKAGTSEVFA-ILPGYPDNVRTNEKGEFWVA-IHCRRTMYSYLCGLY 311 Query: 272 -HTSKAAKHLVAASRKLTELVSGMRTEAMAVNVAADGKIIKKLMDPDGSVISFVTNALEF 330 L +R L G R A+ V + +GK++K L D +G V+ V+ E Sbjct: 312 PKLRMFLLKLPIPTRYQYLLHIGGRLHAVVVKYSPEGKLVKILEDSEGKVVRAVSEVEER 371 Query: 331 EDHLYLGSLNTNFIG 345 E L++GS+ F+ Sbjct: 372 EGKLWMGSVLMPFVA 386 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2260 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17022 (443 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57051 322 6e-90 >Vv57051 Length = 247 Score = 322 bits (826), Expect = 6e-90, Method: Compositional matrix adjust. Identities = 145/243 (59%), Positives = 192/243 (79%) Query: 189 VLDEGLASPTETYRAFYAERCPMWLVIKATGAPGHGAKLYDNTAMENLLKSIESVRRFRA 248 +LDEG AS ++ +R FYA+R P L+IKA G PGHG++LYDN+AMENL+KS+E + +FR Sbjct: 1 MLDEGQASTSDEFRVFYADRSPWNLIIKAFGMPGHGSRLYDNSAMENLMKSVEIITKFRE 60 Query: 249 AQFDLVKAGLKAEGEVISVNMVFLKAGTPTPTGFVMNMQPSEAEAGFDIRVPPIADQESL 308 + FD+VKAG A EVISVN V+LKAG P+PTGFVMNMQPSEAEAGFD+R+PP AD + + Sbjct: 61 SLFDVVKAGKAANSEVISVNPVYLKAGIPSPTGFVMNMQPSEAEAGFDLRMPPTADPDLV 120 Query: 309 EKRIAEEWAPTSRNMTFRFKQKVSVLDKSGKPILTATDSSNPWWALLEDAVKKANGKLGK 368 + RIAEEWAP RNMT++ +K + D G+P++T T+ SNPWW++ + A+ +A GKL K Sbjct: 121 KIRIAEEWAPAIRNMTYQIIEKGPIRDYMGRPLMTLTNDSNPWWSIFKQAITEAGGKLAK 180 Query: 369 PEIFPASTDARYFRNLGLPAIGFSPMANTPILLHDHNEFLNKDEYLKGIEIYESIIKAYA 428 PEI ++TDARY R +G+P +GFSPM NTPILLHDHNEFL YL+GI++YES+I + + Sbjct: 181 PEILASTTDARYMRQMGIPTLGFSPMTNTPILLHDHNEFLKDTIYLRGIKVYESVISSLS 240 Query: 429 SYV 431 S+V Sbjct: 241 SFV 243 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25479 (392 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746565 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51864488 (135 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7983 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46232 213 2e-57 >Vv46232 Length = 220 Score = 213 bits (543), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 112/211 (53%), Positives = 135/211 (63%), Gaps = 4/211 (1%) Query: 1 MFKRVF--GKAKQEANPLPTIHKLNDTXXXXXXXXXXXXXXXXXXXXXXXQFTQAKNRNA 58 MF R+F GK + + N + T+ KLN+T ++T+AKN+ A Sbjct: 1 MFSRMFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA 60 Query: 59 AIKCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGANATTETVDALRSGTAVMKAMNKATK 118 AI+CLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGA ATTETVDALR+G A MK M+K T Sbjct: 61 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKTMHKTTN 120 Query: 119 IEDLEKTMDEINDQTESMKQIQEALSAPIGXXXXXXXXXXXXXXXXXXXXXXXXXXXQPA 178 I+DL+KTMDEIN+QTE+MKQIQEALS PIG QP Sbjct: 121 IDDLDKTMDEINEQTENMKQIQEALSTPIGSAADFDEDELEAELEELEGAELEEQLLQPT 180 Query: 179 TSAPAAPVYVNPEAGRQPTRPAPQRNNREED 209 T+APAAPV + A RQP RPAPQ++ E+D Sbjct: 181 TTAPAAPVSI--PAARQPARPAPQKSTAEDD 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226749360 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226755800 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14484 (459 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6468 (410 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48285622 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24495 (144 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21292 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48120635 (91 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012308 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7380 (55 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10660 (324 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25085 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16315 121 6e-30 >Vv16315 Length = 306 Score = 121 bits (303), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 5/124 (4%) Query: 15 LDDIIRRLLEGKGGKQVQLSEAEIRQLCVNARQIFLSQPNLLEVRAPVRICGDIHGQYQD 74 LD I L+E K LSE+E++ LC AR I + + N+ V+ PV +CGDIHGQ+ D Sbjct: 7 LDRQIEHLMECK-----PLSESEVKTLCDQARTILVEEYNVQPVKCPVTVCGDIHGQFYD 61 Query: 75 LLRVFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPNKIFLLRGNPEKAKNN 134 L+ +F GG P NYLF+GDYVDRG S+ET+ LL+A K+RY +I +LRGN E + Sbjct: 62 LIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT 121 Query: 135 RIYG 138 ++YG Sbjct: 122 QVYG 125 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19740 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10557 (394 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16336 84 5e-18 >Vv16336 Length = 400 Score = 84.0 bits (206), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 55/170 (32%), Positives = 80/170 (47%), Gaps = 32/170 (18%) Query: 215 PLWGSVSICGRRPEMEDAFAAVPRFINIPIKMLVGSQVYNGMSQSLTHLTSHFFGIYDGH 274 P +G S+ GRR +MEDA + P F + +Q+ T L H++G+YDGH Sbjct: 104 PKFGMTSVRGRRRDMEDAVSIHPSF-------------WGQDAQNCTGL--HYYGVYDGH 148 Query: 275 GGPQVANYCSERLHLALAEELGGIKDDSRDGIMVETQQVQWEKAFTNCFQRVDDEIGGKV 334 G VA C +R+H EE +E WE+ F R+D E+ + Sbjct: 149 GCSHVAMKCKDRMHEIAKEE-------------IERCGQSWEQVMERSFSRMDKEVV-EW 194 Query: 335 SRGIIESNADASEASFEPVAPETVGSTAVVALVSSSHIIVANCGESRTIL 384 G SN + VGSTAVVA+V+ ++V+NCG+SR +L Sbjct: 195 CNGQWSSNC---RCELRTPQCDAVGSTAVVAIVTPEKVVVSNCGDSRAVL 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1788 (83 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29655 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48703 174 2e-45 >Vv48703 Length = 273 Score = 174 bits (440), Expect = 2e-45, Method: Compositional matrix adjust. Identities = 91/134 (67%), Positives = 104/134 (77%), Gaps = 5/134 (3%) Query: 161 RSFVAVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNTKYPLVVKKTTDKNGYFFIT 220 RS VAVQGVVYCK+C Y G+DTL GA P+LGATVKLQCNNTKYPLVV TDKNGYFFI Sbjct: 140 RSLVAVQGVVYCKACKYRGIDTLLGASPLLGATVKLQCNNTKYPLVVLGKTDKNGYFFIQ 199 Query: 221 APKTVTTFGAHKCKVSLVSAPSTACSKPSDLHGGLSGALLRPVK-PFVSQKLPFLLYNVG 279 APK +TTFGAHKCKVSLVS+ S C+ +DLH GL GA+LRP K P P++ ++VG Sbjct: 200 APKKITTFGAHKCKVSLVSSSSPTCNLATDLHFGLKGAILRPEKPPAGLPPPPYVTFSVG 259 Query: 280 PFAFEP----KCPR 289 PFAFEP +CPR Sbjct: 260 PFAFEPAKKVECPR 273 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2545 (305 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60148 177 2e-46 >Vv60148 Length = 613 Score = 177 bits (449), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 83/151 (54%), Positives = 110/151 (72%), Gaps = 10/151 (6%) Query: 165 VHAGTDPFGTITEAIRSVKVHLQTFRQRHEKKLPGFVDYFGWCTWDAFYRDVTQEDVEAG 224 +H+GT+PF I +A+++V+ H+QTF R +KKLP F+D+FGWCTWDAFY DVT E +E G Sbjct: 1 MHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGIEEG 60 Query: 225 LESLAAGGTPPKFVIIDDGWQSVGG---DDGVEKQE----PLRLTGIKENSKFQK---KD 274 L+SL+ GG PPKF+IIDDGWQ +G D+ QE RLTGIKEN KFQK + Sbjct: 61 LQSLSKGGAPPKFLIIDDGWQQIGNENKDNNCVVQEGAQFANRLTGIKENEKFQKNGRNN 120 Query: 275 DPTVGIKNIVSIAKQKHGLKYVYVWHAITGY 305 + G+K++V AKQ+H +K+VYVWHA+ GY Sbjct: 121 EQVPGLKHVVEDAKQRHNVKFVYVWHALAGY 151 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48286232 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9678 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990673 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8651 (243 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6626 145 6e-37 >Vv6626 Length = 210 Score = 145 bits (366), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 75/186 (40%), Positives = 123/186 (66%), Gaps = 4/186 (2%) Query: 19 RGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLYEYANNSV 78 RGKI+++RIEN T+RQVTF KRRNGLLKKAYELSVLCDAEVA+I+FS +GRLYE++++++ Sbjct: 3 RGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSSNM 62 Query: 79 KGTIERYKKASADSSNTGSVSEASTQYYQQEAAKLRAQIVKLQNDNRNMMGDALSSMSVK 138 + IERY++ + E Q +Q+A + +I L+ R ++G LSS S+ Sbjct: 63 QSAIERYREHAKQVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSCSLD 122 Query: 139 DLKSLENKLEKAISRIRSKKNELLFAEIEYMQKRELDLHNNNQLLRAKIAENERGQQNIN 198 ++ ++++LEK++ IR++K ++ +IE +++RE L N A++++ + Q ++ Sbjct: 123 EILEIDSQLEKSLKSIRARKAQIFQEQIEELKEREKQLLEEN----ARLSQKDTRQWQLS 178 Query: 199 VMAGGG 204 G Sbjct: 179 AQPSEG 184 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55698717 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226774982 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21596 (332 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16991 131 2e-32 >Vv16991 Length = 380 Score = 131 bits (329), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 91/304 (29%), Positives = 142/304 (46%), Gaps = 27/304 (8%) Query: 33 DYEVVRKVGRGKYSEVFEGINVNTNERCVXXXXXXXXXXXXXXXXXXLQNLCGGPNVVKL 92 Y R VG G + VF+ + T E L PNV+ L Sbjct: 39 SYMAERVVGTGSFGIVFQAKCLETGE--TVAIKKVLQDRRYKNRELQLMRTMDHPNVISL 96 Query: 93 LDIVRDQHSKTP---SLIFEFVNSTDFKVLY------PTLTDYDIRYYIYELLKALDYCH 143 S+ +L+ E+V T ++VL + ++ Y Y++ + L Y H Sbjct: 97 KHCFFSTTSRDELFLNLVMEYVPETMYRVLKHYSNAKQRMPLIYVKLYTYQIFRGLAYIH 156 Query: 144 S-QGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQ 202 S G+ HRD+KP N+++D +++L D+G A+ G+ + SR+++ PEL+ Sbjct: 157 SVPGVCHRDLKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRFYRAPELIFGAT 216 Query: 203 DYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGT---DELNAYLNKYHLE 259 +Y S+D+WS GC+ A ++ +P F G + DQLV+I KVLGT +E+ Y Sbjct: 217 EYTTSIDIWSAGCVLAELLL-GQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPSYTDF 275 Query: 260 LDPQLDALVGRHSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAKEAMGHPYF 319 PQ+ A PW K + + PEAID +LL+Y R TA EA HP+F Sbjct: 276 RFPQIKA-------HPWHKVFHKR----MPPEAIDLASRLLQYSPSLRCTALEACAHPFF 324 Query: 320 SQVR 323 ++R Sbjct: 325 DELR 328 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 54623103 (62 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27311 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29022 (90 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32890 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25471 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48265276 (117 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1122 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2866265 67 1e-13 >Vv2866265 Length = 276 Score = 67.4 bits (163), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 2/109 (1%) Query: 1 MSPEYAIDGFYSIKSDVYSFGVMVLEIVSGSRNRGFSHPDHKLNLLGHAWV--LHTEGRP 58 ++PEY G S K+DV+ +G+M+LE+++G R + + +++ WV L E + Sbjct: 123 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKL 182 Query: 59 LELLDTSVEDSITLHEVVRTIHVGLLCVQRNPEDRPSMSAAVLMLGGEG 107 L+D ++ + EV + I V LLC Q +P +RP MS V ML G+G Sbjct: 183 EMLVDPDLQTNYVEAEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDG 231 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11672 (507 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27449 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48411817 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9179 244 4e-67 >Vv9179 Length = 371 Score = 244 bits (624), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 116/135 (85%), Positives = 125/135 (92%) Query: 20 MEITNVSEYEAIAKEKLPKMVYDYYASGAEDQWTLAENRNAFARILFRPRILIDVSRIDM 79 MEITNV+EYEAIAK+KLPKMV+DYYASGAEDQWTL +NR+AF++ILFRPRILIDVS+IDM Sbjct: 1 MEITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDM 60 Query: 80 TTTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWATSSVEEVASTG 139 TTTVLGFKISMPIMIAPTAMQKMAHPEGEY GTIMTLSSWATSSVEEVASTG Sbjct: 61 TTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTG 120 Query: 140 PGIRFFQLYVYKDRN 154 PGIRFFQLYVYKDR+ Sbjct: 121 PGIRFFQLYVYKDRH 135 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18537 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17366258 111 1e-26 >Vv17366258 Length = 339 Score = 111 bits (277), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 48/93 (51%), Positives = 65/93 (69%) Query: 25 ESQLSLKCPMCRGAILGWEVVEDTRKYLNLKKRSCSRESCSFSGNYQELRRHARRVHPTT 84 ++Q L CP+CRG I GW VVE R ++N K RSC+ E+C FSG Y +LR+HAR HP Sbjct: 147 KTQPKLVCPLCRGQINGWTVVEPARHFMNAKSRSCACETCDFSGTYTDLRKHARLEHPLV 206 Query: 85 RPSDIDPSRERAWRHLEHQREFGDVVSAIHSAM 117 RPS+ DP R+R WR +E QR+ GD++S + S+ Sbjct: 207 RPSEADPERQRNWRRMERQRDLGDLLSTLQSSF 239 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15234 (240 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26935 (201 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35126 346 2e-97 >Vv35126 Length = 206 Score = 346 bits (887), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 167/206 (81%), Positives = 186/206 (90%), Gaps = 5/206 (2%) Query: 1 MVLTEEEITRLYRVRKTVMQMLKDRNYLVGDFEINMSKEQFKDKYGENMKREDLIINKTK 60 M +EEEI+RL+R+RKTVMQMLKDR Y VGDFEINM+K QF K+GENMKREDL+INK K Sbjct: 1 MSASEEEISRLFRIRKTVMQMLKDRGYFVGDFEINMTKHQFVSKFGENMKREDLVINKAK 60 Query: 61 RTDTNDQIYVFFPDEPKVGVKTMKTYTNRMKSENVFRAILVTQQSLTPFAKTCISEISGK 120 RTD++DQIYVFFP+E KVGVKTMKTYTNRMKSENVFRAILV QQ+LTPFA+TCI+EIS K Sbjct: 61 RTDSSDQIYVFFPEEQKVGVKTMKTYTNRMKSENVFRAILVVQQNLTPFARTCINEISTK 120 Query: 121 FHLEVFLEAELLVNIKEHVLVPEHRVLTNEEKKTLLERYTVKETQL-----TQPIAKYYG 175 FHLEVF EAELLVNIKEHVLVPEH+VLT+EEKKTLLERYTVKETQL + PIA Y+G Sbjct: 121 FHLEVFQEAELLVNIKEHVLVPEHQVLTSEEKKTLLERYTVKETQLPRIQVSDPIAGYFG 180 Query: 176 LKRAQVVKIIRPSETAGRYVTYRYVI 201 LKR QVVKIIRPSETAGRY+TYRYV+ Sbjct: 181 LKRGQVVKIIRPSETAGRYITYRYVV 206 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71825938 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv34249 308 6e-86 >Vv34249 Length = 259 Score = 308 bits (788), Expect = 6e-86, Method: Compositional matrix adjust. Identities = 147/201 (73%), Positives = 172/201 (85%), Gaps = 4/201 (1%) Query: 6 ISVFPSPLETRSCLGIQIAASLQPCTDREVSSGASGFQPYGYGGNFQPPVFPVARLRGLP 65 +S+F ++ L ++ + + CTDREVSS ASGFQPYGYG FQPP FPV RLRGLP Sbjct: 5 VSIFSPQIQIFKFLPLKAS---KACTDREVSSSASGFQPYGYGSGFQPPTFPVVRLRGLP 61 Query: 66 FNCTDIDIFKFFAGLDIVDVLLVNKGGRFSGEAFVVFAGPMQVELALQRDRQNMGRRYVE 125 FNCTDIDIFKFFAGLDIVDVLLVNK GRFSGEA+VVFAG MQ + ALQRDRQNMGRRYVE Sbjct: 62 FNCTDIDIFKFFAGLDIVDVLLVNKSGRFSGEAYVVFAGSMQADFALQRDRQNMGRRYVE 121 Query: 126 VFRCKRQEYYKAVAAEVNYEGIYDNDYQAASPPPSKSKRFSDKEKMEYTEILKMRGLPFS 185 VFRCK+Q+YY AVA+EVNYEGIYDND+ SPPPS+SKRFSDK++ME+TEILK+RGLPFS Sbjct: 122 VFRCKKQDYYHAVASEVNYEGIYDNDFH-GSPPPSRSKRFSDKDQMEHTEILKLRGLPFS 180 Query: 186 AKKSEILEFFEEFKVVEDRVH 206 KKS+ILEFF +F++ +D+VH Sbjct: 181 VKKSQILEFFGDFELGDDKVH 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16031 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992451 (73 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48417129 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26436 (185 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27141 (283 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv45747 162 7e-42 >Vv45747 Length = 361 Score = 162 bits (410), Expect = 7e-42, Method: Compositional matrix adjust. Identities = 77/78 (98%), Positives = 77/78 (98%) Query: 1 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSA 60 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTP SA Sbjct: 284 MRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPSSA 343 Query: 61 GGLEGPDRIFVGGLPYYF 78 GGLEGPDRIFVGGLPYYF Sbjct: 344 GGLEGPDRIFVGGLPYYF 361 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226743385 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14654 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3106 146 6e-38 >Vv3106 Length = 251 Score = 146 bits (369), Expect = 6e-38, Method: Compositional matrix adjust. Identities = 69/85 (81%), Positives = 76/85 (89%) Query: 1 MTLEKLLHYGQMLVQEQDNVKRVQLADKYLADAALGDANQDSINRGEFYGKAAQQVNVPV 60 MT+EKLL YG MLV EQ+NVKRVQLADKYL++AALGDAN DSI RG FYGKAAQQV VPV Sbjct: 167 MTIEKLLEYGNMLVMEQENVKRVQLADKYLSEAALGDANVDSIERGTFYGKAAQQVGVPV 226 Query: 61 PEGCTDRTAANFNPAARSDDGSCQY 85 PEGCTD +AANF+P ARSD+GSCQY Sbjct: 227 PEGCTDPSAANFDPTARSDNGSCQY 251 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32383 (202 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801430 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65578 168 7e-44 >Vv65578 Length = 265 Score = 168 bits (426), Expect = 7e-44, Method: Compositional matrix adjust. Identities = 89/181 (49%), Positives = 117/181 (64%), Gaps = 2/181 (1%) Query: 3 QTMLFSATFPKEIQRLASDFLAKYIFLAVGRVGSSTDLIVQRVEFVHESDKRSHLMDLL- 61 QT+LFSAT P EI+ LA ++L + + VG+V T + Q +E V ES+K L+ LL Sbjct: 22 QTLLFSATMPMEIETLAQEYLNNPVQVKVGKVSCPTANVSQILEKVSESEKIDGLLALLV 81 Query: 62 -HAQRANGAQGKQALTLVFVETKKGADSLEHWLCMNGFPATTIHGDRSQQEREQALRSFK 120 A +A LT+VFVE K D + L G A +HG RSQ ERE ALR F+ Sbjct: 82 EEASQAERCGRPFPLTIVFVERKTRCDEVTEALVAQGLRAVALHGGRSQAEREAALRDFR 141 Query: 121 SGNTPILVATDVAARGLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNEN 180 +G T ILVATDVA+RGLD+ VAHV+N DLP +++YVHRIGRTGRAG +G AT+F+ + Sbjct: 142 NGATNILVATDVASRGLDVTGVAHVINLDLPKAMENYVHRIGRTGRAGSTGQATSFYTDR 201 Query: 181 N 181 + Sbjct: 202 D 202 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30126 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41067 291 3e-81 >Vv41067 Length = 148 Score = 291 bits (746), Expect = 3e-81, Method: Compositional matrix adjust. Identities = 138/148 (93%), Positives = 144/148 (97%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPAESPFSGGVFLVSIHFPPDY 60 MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP +SP++GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYETTARSWTQKYAMG 148 PEIAHMYKTDR KYETTARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48276288 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24372 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41067 301 5e-84 >Vv41067 Length = 148 Score = 301 bits (770), Expect = 5e-84, Method: Compositional matrix adjust. Identities = 144/148 (97%), Positives = 145/148 (97%) Query: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPGDSPYTGGVFLVSIHFPPDY 60 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRAKYEATARSWTQKYAMG 148 PEIAHMYKTDRAKYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226793997 (135 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv60475 75 4e-16 >Vv60475 Length = 405 Score = 75.5 bits (184), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 42/111 (37%), Positives = 63/111 (56%) Query: 1 MLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELIDLRTLLPWDKDTVEA 60 +L L EAE++R G +T++ + + QA K G E+ID+R+L P+D T+ Sbjct: 270 VLSLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLVNKGYDPEVIDIRSLKPFDLYTIGN 329 Query: 61 SVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARVCGLDTPFP 111 SV+KT R+LI E TGG GA ++A+I E L+AP+ + D P P Sbjct: 330 SVKKTHRVLIVEECMRTGGIGASLTAAITENFIDYLDAPIVCLSSQDVPTP 380 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25128 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50891356 (73 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31139 111 2e-27 >Vv31139 Length = 199 Score = 111 bits (278), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 51/72 (70%), Positives = 60/72 (83%) Query: 1 DVPLHVCENRDPKGLYKLARAGKIKSFTGVDDPYEPPLKCEIVLQQKGGDCVSPGEMAET 60 ++PL +CE RD KGLYKLARAGKIK FTG+DDPYEPPL CEI +QQK G C SP +MA Sbjct: 127 NMPLQLCEERDAKGLYKLARAGKIKGFTGIDDPYEPPLNCEIEIQQKDGVCPSPNDMAGD 186 Query: 61 VISYLEEKGYLQ 72 V++YLEEKG+LQ Sbjct: 187 VVTYLEEKGFLQ 198 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2908 (98 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10432 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55974 112 4e-27 >Vv55974 Length = 129 Score = 112 bits (280), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 54/110 (49%), Positives = 70/110 (63%), Gaps = 2/110 (1%) Query: 70 TSVPVRVAHELLQAGHKYLDVRTPEEFSAGHAP--GAVNIPYLYKVGSGMTKNQEFLEQV 127 ++ V A +L+ +G++YLDVRT EEF GHA +NIPYL+ G KN EFLEQV Sbjct: 11 VTIDVHAAKDLINSGYRYLDVRTVEEFKKGHADVENILNIPYLFTTPEGRVKNPEFLEQV 70 Query: 128 SSHFRKHDEIIVGCQLGKRSMMAATDLEASGFTGITDIAGGYAAWTQSGL 177 K D +IVGCQ G RS+ A + L ++GF + DI GGY AW Q+GL Sbjct: 71 QFACSKEDHLIVGCQSGVRSLAATSVLVSAGFKDVKDIGGGYLAWVQNGL 120 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7950 (326 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55855564 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20752 199 2e-53 >Vv20752 Length = 307 Score = 199 bits (506), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 98/129 (75%), Positives = 110/129 (85%) Query: 33 SRQRLDVETKDPIVARKVQKADREKLRRDRLNEHFFELGNTLDPDRPKNDKATILTDTIQ 92 S +R + E KD + ARKVQKADREKLRRDRLNE F ELGN LDPDRPKNDKATIL+DTIQ Sbjct: 11 SSKRSEGEFKDFVTARKVQKADREKLRRDRLNEQFIELGNALDPDRPKNDKATILSDTIQ 70 Query: 93 MLKDLTTDVNKLKAECSALTDESRELTQEKNELREEKASLKSDIENLNVQYQQRLRVMFP 152 +LKD T V KLKAE ++L +ESRELTQEKN+LREEKASLKS ENLNVQYQQR+R MFP Sbjct: 71 LLKDSTAQVEKLKAENASLNEESRELTQEKNDLREEKASLKSATENLNVQYQQRVRAMFP 130 Query: 153 WAGMDPSVV 161 W+ +DPSVV Sbjct: 131 WSAIDPSVV 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7270 (365 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9863 165 1e-42 >Vv9863 Length = 332 Score = 165 bits (417), Expect = 1e-42, Method: Compositional matrix adjust. Identities = 112/330 (33%), Positives = 177/330 (53%), Gaps = 15/330 (4%) Query: 8 LTSIAHEKTLQQKFVRDEDERPKVAYNDFSNEIPIISLAGIDEVEGRRGEICKKIVAACE 67 L S A L KF+R ERP+ +P+ISLA +V + K+I AC Sbjct: 9 LASGADLNELPAKFIRPAHERPENTKPLEGVSVPVISLAESHDV------LVKEIYKACS 62 Query: 68 DWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRF--DMSGGKKGGFIVSSHLQGEA 125 +WG F + DHG+ LI ++ + EFF P EEK ++ D S GK G+ + Sbjct: 63 EWGFFLLKDHGISPGLIEKLQEVGIEFFKQPQEEKEKYANDPSTGKFEGYGTKMTKNLDE 122 Query: 126 VQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDT 185 +W + + P + ++ WP P ++REVT+ Y+ EL+ + LL +LSE +GL+ Sbjct: 123 KVEWVDYFFHLMSPPSNVNHQIWPQTPSSYREVTEVYNKELLKVTDTLLELLSEGLGLEG 182 Query: 186 EALTKACVDMDQ---KVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDD 242 + L K+ V D+ ++ +N YP CPQP L LG++ HTD +TLL+ + V GLQ +DD Sbjct: 183 KVL-KSHVGGDEIELEMKINMYPPCPQPQLALGVEPHTDMSALTLLVPNDVPGLQVWKDD 241 Query: 243 GKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSIATFQNPAQEAIV 302 W+ V + A V++GD +LSNG++K+ H++ VN +R+S A F P +A++ Sbjct: 242 --YWVAVDYLPNALFVHVGDQIEVLSNGKYKSVLHRSTVNKERTRMSWAVFCAPPHKAMI 299 Query: 303 YPL-SVREGEKPILEAPITYTEMYKKKMSK 331 PL + + P + T+ E +K +K Sbjct: 300 GPLPELVDEPNPAKYSTKTFAEYRYRKFNK 329 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13504 (334 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35303 120 3e-29 >Vv35303 Length = 394 Score = 120 bits (301), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 94/309 (30%), Positives = 139/309 (44%), Gaps = 56/309 (18%) Query: 3 GWRATMEDAHAAYPDLDA----------STSFFGVYDGHGGKVVAKFCAKYLHQQVLKNE 52 G R MED H DL +F+GV+DGHGG A + K Sbjct: 93 GPRRYMEDEHIRIDDLSMHLGSVSRLPNPCAFYGVFDGHGGPEAAAYVRK---------- 142 Query: 53 AYAAGDIGTSVQKAFFRMDEMMRGQRGWRELAVLGDKINKFTGMIEGLIWSPRSSDSNDQ 112 +V + FF R ++N ++S R +S + Sbjct: 143 ---------NVDRFFFEDANFPRTS-----------EVND--------VFSERVENSVRK 174 Query: 113 ADDWAFEEGPHSDFTGPTSGCTACVAILRNKQLVVANAGDSRCVISRKGQAYNLSRDHKP 172 A A +SG TA A++ + L+VANAGD R V+ RKGQA ++S+DH+P Sbjct: 175 AFLLADLALADDSGVSSSSGTTALTALIFGRTLMVANAGDCRAVLCRKGQAVDMSQDHRP 234 Query: 173 DLELEKERILKAGGFIHAGRVNGSLNLARAIGDMEFKQNKFLPAEKQIVTASPDINTVEL 232 LE++R+ + GGF+ +NG L++ RA+GD + KF + A P+ V L Sbjct: 235 SYPLERKRVEELGGFVDGEYLNGVLSVTRALGDWDM---KFPRGSASPLIAEPEFRQVAL 291 Query: 233 CDDDEFIVLACDGIWDCMSSQQVVDFVHEQLLSESKLSVVCERALDRCLAPSTADGEGCD 292 ++DEF+++ CDGIWD MSSQ+ V V L + L +T D Sbjct: 292 TEEDEFLIIGCDGIWDVMSSQEAVSLVRRGLRRHDDPEQSARDLVMEALRLNTF-----D 346 Query: 293 NMTMIVVQF 301 N+T+IV+ F Sbjct: 347 NLTVIVICF 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48125617 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48123095 (58 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27846 (145 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2194 (156 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv11572 254 4e-70 >Vv11572 Length = 233 Score = 254 bits (650), Expect = 4e-70, Method: Compositional matrix adjust. Identities = 119/150 (79%), Positives = 130/150 (86%) Query: 4 QVRSVDVKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDXXXXXX 63 +VRSVD KEALRLQ+ENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWD Sbjct: 84 KVRSVDAKEALRLQQENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAA 143 Query: 64 XXXXXXXXXTEENPDFISSVGSQLDKKAKIIVACAAGGTMRPTQNLPEGQQSRSLIAAYL 123 TEENP+F+ SV S++DK AKIIVAC++GGTM+P+QNLPEGQQSRSLIAAYL Sbjct: 144 FAFFGIFAGTEENPEFMQSVESKIDKSAKIIVACSSGGTMKPSQNLPEGQQSRSLIAAYL 203 Query: 124 LVLNGYTNVFHLEGGLYAWFKEGLPSVAEE 153 LVLNGYTNVFHLEGGLY WFKEGLPSV+EE Sbjct: 204 LVLNGYTNVFHLEGGLYTWFKEGLPSVSEE 233 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91021444 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10435 (487 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20819 (82 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20329 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226753789 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26969 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27214 (297 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15037 270 3e-74 >Vv15037 Length = 398 Score = 270 bits (689), Expect = 3e-74, Method: Compositional matrix adjust. Identities = 152/235 (64%), Positives = 185/235 (78%) Query: 63 EAEMKLKKVEELAKAGLAATIAREKASQIEKMAEANLHINALCVAFYARSEEARQTHSAH 122 E+E++L K ELAKA LAA IA EKAS IEK+AEANLHI+ALC+AFYARSEEARQTHS H Sbjct: 164 ESELELNKALELAKAELAAAIASEKASHIEKIAEANLHIDALCMAFYARSEEARQTHSVH 223 Query: 123 KFXXXXXXXXXXXSKGLPIEREIEALHTYLEGIDKDSILDVVLSSLPEETRRNGTDTLLQ 182 K SKGLPI+ EI LH YL+GIDKDS+L + LSSLPEETR +GTDT+LQ Sbjct: 224 KLALGALALEDALSKGLPIQTEIVVLHKYLDGIDKDSLLALDLSSLPEETRNHGTDTVLQ 283 Query: 183 LNQKFDALKGTVRHXXXXXXXXXXXXAHSLAHIASWLKVKEVDHSGDGIESIINKVEYYL 242 LNQKFD LK T+RH AHSLA++AS LKVK+ D SGDGIES+IN+VE YL Sbjct: 284 LNQKFDDLKATLRHFSLIPPGGGGILAHSLANVASRLKVKQGDQSGDGIESVINRVESYL 343 Query: 243 AEGKIAEAAEALEEGVKGTQAMGVVSEWVKRARNRAITDQALTLLQSYATSISVT 297 A+G++ EAA+ALE+GV+G++A ++ +WVK+ARNRAI +QALTLLQSYATS+S+T Sbjct: 344 AQGQLVEAADALEDGVRGSEAAEIIVDWVKQARNRAIAEQALTLLQSYATSVSLT 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48118301 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23333 (356 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226801981 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16295 (317 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27986 (115 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91037763 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12395 (323 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47125 466 e-133 >Vv47125 Length = 406 Score = 466 bits (1200), Expect = e-133, Method: Compositional matrix adjust. Identities = 228/272 (83%), Positives = 241/272 (88%), Gaps = 10/272 (3%) Query: 1 MLADQMITRIEFAHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDATTNRHIP 60 MLADQMITRIE+ HSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRD+TTNRHIP Sbjct: 107 MLADQMITRIEYVHSKGFLHRDIKPDNFLMGLGRKANQVYIIDFGLAKRYRDSTTNRHIP 166 Query: 61 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKADTKKQKYD 120 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKA TKKQKYD Sbjct: 167 YRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYD 226 Query: 121 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFSREGYEFDY 180 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLF+REGYEFDY Sbjct: 227 KICEKKLSTPIEVLCKSHPVEFASYFHYCHSLTFDQRPDYGFLKRLFRDLFTREGYEFDY 286 Query: 181 VFDWTIIKYQQSQKTG-----SPVPGGSNSHAMPVRVDSHQVAGGSSAPYPAEVTDRIRS 235 +FDWTI+KYQQ+QK+ SP GGS+S AM + VD HQ GG +A Y AE T+RIRS Sbjct: 287 IFDWTILKYQQTQKSRNQPQLSPAAGGSSSRAMAMDVDRHQ--GGINASYSAEATERIRS 344 Query: 236 SNPTGSGG-RMQFKSPTTGRNLSYGNPLEKNI 266 SN S G RMQFKS TG+NLS +P EKN Sbjct: 345 SNAAASSGIRMQFKS--TGKNLSSESPAEKNF 374 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91027550 (109 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv161 97 7e-23 >Vv161 Length = 95 Score = 97.1 bits (240), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 44/55 (80%), Positives = 51/55 (92%) Query: 35 LCRTAEDHPEILFLKVNFDENKPMCKSMNVKVLPYFHFYRGSEGQLESFSCSLAK 89 LC+TA+D+P I+FLKVNFDENK MCKS+NVK+LP FHFYRGS+G LESFSCSLAK Sbjct: 41 LCKTAQDYPNIIFLKVNFDENKSMCKSLNVKMLPCFHFYRGSDGLLESFSCSLAK 95 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11148 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46232 254 8e-70 >Vv46232 Length = 220 Score = 254 bits (649), Expect = 8e-70, Method: Compositional matrix adjust. Identities = 125/150 (83%), Positives = 140/150 (93%), Gaps = 2/150 (1%) Query: 4 MFTRIF--GKPKQENSALTTLDKLNETLEMLEKKEKVLQKKAAAEVDRAKDFTKAKNKKA 61 MF+R+F GK + + +A+ TLDKLNETLEMLEKKE+VL KKA+AEV++AK++TKAKNK+A Sbjct: 1 MFSRMFRKGKEQSQTNAVATLDKLNETLEMLEKKERVLIKKASAEVEKAKEYTKAKNKRA 60 Query: 62 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAAAMKAMQKATN 121 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMI+LEGAKATTETVDALRTGAAAMK M K TN Sbjct: 61 AIQCLKRKRLYEQQIEQLGNFQLRIHDQMILLEGAKATTETVDALRTGAAAMKTMHKTTN 120 Query: 122 IDDVDKTMDEINEQTENMKQIQEALSTPIG 151 IDD+DKTMDEINEQTENMKQIQEALSTPIG Sbjct: 121 IDDLDKTMDEINEQTENMKQIQEALSTPIG 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27629 (312 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2209 (219 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 86591033 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48385879 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30530 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48484945 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22340 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24312 (482 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3623 428 e-121 >Vv3623 Length = 481 Score = 428 bits (1100), Expect = e-121, Method: Compositional matrix adjust. Identities = 209/420 (49%), Positives = 278/420 (66%), Gaps = 15/420 (3%) Query: 44 LPGQSFNLSFAHFSGYVPVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGM 103 LPGQ + F ++GYV VNE GR LFY+F EAAEDP SKP++LWLNGGPGCSS+ G Sbjct: 74 LPGQPSGVLFKQYAGYVTVNELKGRNLFYYFAEAAEDPSSKPLLLWLNGGPGCSSLGVGA 133 Query: 104 AEEIGPFHIEADGKTLYLNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTAND 163 EIGPF ++ DGKTLYL PY+WN+VAN LF +SPVGVGFSYSN S + NGDKRTA D Sbjct: 134 MVEIGPFGVKPDGKTLYLRPYAWNKVANTLFLESPVGVGFSYSNNSFEYNENGDKRTAQD 193 Query: 164 SLTFLLQWFERFPQYKGRDFYITGESYGGHYVPQLSQAIVKYNLKTKEKT-VNLKGYMVG 222 + FL+ WF RFP YK RDFYI GESY G Y+P+L+ I++ N+K + ++LKG M+G Sbjct: 194 TYAFLINWFRRFPHYKNRDFYIMGESYAGFYIPELADTIIRRNMKADSSSIIHLKGIMIG 253 Query: 223 NALTDDYHDHLGVFQFMWSAGLISDQTYKLLNLLCDFQSFIHTSNSCDNVLDIANAELGN 282 N + +D D+ G + ++WS LISD+T++ L C F S C + D E+G Sbjct: 254 NGIMNDMTDNRGFYDYLWSHALISDKTHQGLVEYCKFPD----SYECKKLEDHIELEVGL 309 Query: 283 IDPYSIYTPSCPANVSQSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHIDP 342 ID Y+IY P C + SN RK + G +DPC + + Y NLP+VQ+ALH + Sbjct: 310 IDFYNIYAPVC---IRSSNSSRKPKRHGG-----FDPCEADYVLRYLNLPQVQEALHANR 361 Query: 343 GHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSID 402 P W CS V++ +W DSP T+ +YK LI SGL I ++SGD DAV+ + TRYSI+ Sbjct: 362 TKIPYAWEVCSSVIT-SWTDSPSTMFPIYKRLISSGLHILIYSGDVDAVVSVVGTRYSIN 420 Query: 403 ALKLPTVKPWRAWYDDGQ-VGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSG 461 AL L ++PW W + + VGG+ Y GLTF ++RGAGHEVP +P++A L++SF++G Sbjct: 421 ALNLKVIRPWHPWSESTKVVGGYRVVYEGLTFATIRGAGHEVPRFQPRRAFALMESFVAG 480 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27916 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41852 125 7e-31 >Vv41852 Length = 205 Score = 125 bits (314), Expect = 7e-31, Method: Compositional matrix adjust. Identities = 61/134 (45%), Positives = 87/134 (64%), Gaps = 11/134 (8%) Query: 111 EEGEQRKIGAYYQEMLKSNPGDPLLLRNYGKFLHEVEKDAVGAEECYCRAILGSPGDGEL 170 E G++ + YY+ ML+ NP +PL LRNY +FL++ + D AEE CRAIL P DGE+ Sbjct: 72 ESGDRPGVEEYYKRMLEENPSNPLFLRNYAQFLYQSKHDLQAAEEYLCRAILADPRDGEI 131 Query: 171 LSLYAKLIWETQRDEERAKSYFDQAVSASPDDCMVLGSFASFMWEAXXXXXXXXSKEINI 230 LS YAKL+WE RD++RA SYF++AV A+P+D V ++ASF+W+ E + Sbjct: 132 LSQYAKLVWELHRDQDRASSYFERAVQAAPEDSHVQAAYASFLWQT----------EEDD 181 Query: 231 YDGT-QVSSVPALV 243 DGT V ++P L+ Sbjct: 182 DDGTCHVDAMPTLL 195 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13382 (530 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32683 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26713 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48489810 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30334 89 6e-20 >Vv30334 Length = 435 Score = 89.0 bits (219), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 64/164 (39%), Positives = 97/164 (59%), Gaps = 18/164 (10%) Query: 35 VDPKLLFIGAK--IGEGAHGKVYEGRYGDRIVAVKVLHRGSTTEERAALESRFAREVNMM 92 +DP L IG+G+ G++ + + VAVK + S +++R ++ F EVN++ Sbjct: 152 IDPSELDFSNSSIIGKGSFGEILKACWRGTPVAVKRI-LPSLSDDRLVIQD-FRHEVNLL 209 Query: 93 SRVKHENLVKFIGAC--KEPLMVIVTELLPGMSLRKYLM---SIRPNPLELHVAIKFSLD 147 +++H N+V+F+GA K+PLM+I TE L G L +YL S+ P+ AI F++D Sbjct: 210 VKLRHPNIVQFLGAVTDKKPLMLI-TEYLRGGDLHQYLKEKGSLSPS-----TAITFAMD 263 Query: 148 IAHAMECLH--ANGIIHRDLKPDNLLLY-ANQKHVKLADFGLAR 188 IA M LH N IIHRDLKP N+LL H+K+ DFGL++ Sbjct: 264 IARGMAYLHNEPNVIIHRDLKPRNVLLVNTGADHLKVGDFGLSK 307 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6102 (212 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 310 2e-86 >Vv31003 Length = 427 Score = 310 bits (793), Expect = 2e-86, Method: Compositional matrix adjust. Identities = 148/179 (82%), Positives = 159/179 (88%) Query: 1 MKIAAGAAKGLKYLHDKASPPVLHRNLKCSNILLGEGYHPKLSGFGLAKLGPAGDNTHVS 60 MKIAAGAAKGL+YLHDK PPV++R+LKCSNILLGEGYHPKLS FGLAK+GP GD THVS Sbjct: 213 MKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLAKVGPTGDKTHVS 272 Query: 61 KWVMGTYGYCAPEYAMTGQLTLKSDIYSFGVVLLEIITGRTAIDNTRGAGEQILVEWART 120 VMGTYGYCAP+YAMTGQLT KSDIYSF VVLLE+ITGR AIDN++GA EQ LV WAR Sbjct: 273 TRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGRKAIDNSKGAREQNLVAWARP 332 Query: 121 LFKDRRKLSQMADPTLQGQYPKRGLYQALAVAGMCVQEQPNMRPVIADVVTALTYLASQ 179 LFKDRRK SQMADP L GQYP RGLYQALA+A MCVQEQPNMRP+IADVVTAL YLASQ Sbjct: 333 LFKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQPNMRPLIADVVTALNYLASQ 391 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595520 (151 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1486 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27009 (178 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7364 (99 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226810834 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71925431 (188 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24826 (447 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3466264 873 0.0 >Vv3466264 Length = 447 Score = 873 bits (2256), Expect = 0.0, Method: Compositional matrix adjust. Identities = 416/436 (95%), Positives = 430/436 (98%) Query: 1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL Sbjct: 1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60 Query: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT 120 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT Sbjct: 61 DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120 Query: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK 180 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYS+ARYDEIVKEVSSYLKK Sbjct: 121 GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK 180 Query: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD 240 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EPKRPSDKPLRLPLQD Sbjct: 181 VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD 240 Query: 241 VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNV 300 VYKIGGIGTVPVGRVETG++KPGMVVTFGPTGLTTEVKSVEMHHE++ EALPGDNVGFNV Sbjct: 241 VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV 300 Query: 301 KNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF 360 KNVAVKDLKRG+VASNSKDDPAKEAANFI+QVIIMNHPGQIG GYAPVLDCHTSHIAVKF Sbjct: 301 KNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF 360 Query: 361 AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT 420 AE++TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT Sbjct: 361 AEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT 420 Query: 421 VAVGVIKSVEKKDPTG 436 VAVGVIK+VEKKDP+G Sbjct: 421 VAVGVIKNVEKKDPSG 436 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26130 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226800902 (78 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20504 (232 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30686 78 2e-16 >Vv30686 Length = 268 Score = 77.8 bits (190), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 5/123 (4%) Query: 2 RNVERNTSRITQMNSDSFGSIQAAELSWGNDDHVRAVEPPFDYIIGTDVVYKENLLEPLL 61 +NVE N + D GS EL+WG+D +EP DY++G+DV+Y E + LL Sbjct: 146 KNVETNLKQ-----GDLRGSATVHELTWGDDPEPELIEPLPDYVLGSDVIYSEGAVADLL 200 Query: 62 QTIHALSGPKTTILMGYEIRSTSVHEQMLQMWKRNFEVKTVPNSKMDSTYQHPDIQLYIM 121 T+ L G +TTI++ E+R+ S+ E L+ ++F V V ++ Y P + +YI+ Sbjct: 201 ATLMQLCGAQTTIVLAGELRNDSILEYFLEAAMKDFMVGRVDQTQWHPDYCSPRVVIYIL 260 Query: 122 TLK 124 K Sbjct: 261 VKK 263 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48264387 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43227 199 1e-53 >Vv43227 Length = 220 Score = 199 bits (507), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 98/126 (77%), Positives = 110/126 (87%), Gaps = 3/126 (2%) Query: 1 MEVPSSWDALRKQARKLEAQLDEQMNSYRKFVSAKGSTKVGTAENDLESGIDRLLKQLQQ 60 M+ PSSWDALRKQARKLEAQLDEQM+ YRK VS K G E +++SGID+LLKQLQQ Sbjct: 1 MDPPSSWDALRKQARKLEAQLDEQMHLYRKLVSMKVD---GDKEKEIDSGIDQLLKQLQQ 57 Query: 61 VNSQMQAWVSSGGSEMVSHTLTRHQEIFQDITQEFYRLRNSLRAKQEHASLLEDFREFDR 120 VNS MQAWVSSGGSE+ SHTLTRHQEI QD+TQEFYRLR+S RAK+EHASLLEDFREFDR Sbjct: 58 VNSHMQAWVSSGGSEIFSHTLTRHQEILQDLTQEFYRLRSSFRAKKEHASLLEDFREFDR 117 Query: 121 TRVDLE 126 +R+DLE Sbjct: 118 SRLDLE 123 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17480 (352 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040450 (134 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20803 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8550 (198 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12321 (226 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19775 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14225 (170 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43458 231 5e-63 >Vv43458 Length = 168 Score = 231 bits (589), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 111/148 (75%), Positives = 127/148 (85%) Query: 23 HPVDGFSAGLVNEDNIFEWNVTIIGPPDTLYEGGFFNAIMSFPEDYPCNPPIVRFTSEMW 82 PVDGFSAGLV+E N+FEW+V+IIGPPDTLY+GGFFNAIMSFP +YP +PP VRFTS+MW Sbjct: 21 RPVDGFSAGLVDESNVFEWSVSIIGPPDTLYDGGFFNAIMSFPPNYPNSPPSVRFTSDMW 80 Query: 83 HPNVYADGKVCVSILHPPGDDPNGYELATERWNPVHTVEXXXXXXXXXXXXPNDESPANV 142 HPNVY DG+VC+SILHPPG+DPNGYELA+ERW PVHTVE PNDESPAN+ Sbjct: 81 HPNVYPDGRVCISILHPPGEDPNGYELASERWTPVHTVESIVLSIISMLSSPNDESPANI 140 Query: 143 DAAKQWRESRDEFRKKVGRCVRKSQEML 170 +AAK+WRE RDEF+KKV RCVRKSQEML Sbjct: 141 EAAKEWREKRDEFKKKVSRCVRKSQEML 168 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26655 (223 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58683 66 5e-13 >Vv58683 Length = 247 Score = 66.2 bits (160), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 31/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%) Query: 106 SEVFIGGLPKDTSEEDLRDLCDEIGKIIEVRLMQDRETGESKGYAFIGFKTKEVAQKAIE 165 ++VF+GGL +T +E +RD ++ G+I+E ++ D+ TG SKGY F+ FK E A+KA E Sbjct: 16 TKVFVGGLAWETPKEAMRDHFEKYGEILEAVIISDKLTGRSKGYGFVTFKEPEAAKKACE 75 Query: 166 ELHSKVFKGKTLRCSLSETKYR 187 + + + G+ C+L+ R Sbjct: 76 DT-TPMINGRRANCNLASLGAR 96 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50701423 (54 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16686 (316 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2867 (257 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12964 165 9e-43 >Vv12964 Length = 258 Score = 165 bits (417), Expect = 9e-43, Method: Compositional matrix adjust. Identities = 99/261 (37%), Positives = 133/261 (50%), Gaps = 22/261 (8%) Query: 9 VPCLRDNYAYLLHDEDTGTVGVVDPSEAVPVIDALSRKNRNLTYILNTXXXXXXTGGNAE 68 VPCL DNY+YL+ DE + VVDP E V+ A +L +L T GGN + Sbjct: 6 VPCLEDNYSYLIIDESSKEAAVVDPVEPQKVLQAAYEYGVHLKLVLTTHHHWDHAGGNEK 65 Query: 69 LKAR------YGAKVXXXXXXXXXXXXXXXALNEGDKWMFAGH-EVQVMETPGHTRGHIG 121 +K YG V L GDK V + TP HTRGHI Sbjct: 66 IKQLVPGIEVYGGSVDNVKGCTH-------PLQNGDKLSLGSDLAVLALHTPCHTRGHIS 118 Query: 122 FYF----PQSGAIFTGDTLFSLSCGKLFEGTPEQMHSSL-TKITSLPDDTDIYCGHEYTL 176 +Y A+FTGDTLF CGK FEGT EQM+ SL + SLP T +YCGHEYT+ Sbjct: 119 YYVTGKEEDVPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLASLPKPTRVYCGHEYTV 178 Query: 177 SNSKFALSIEPENEALQSYAAHVIHLRNKGMPTVPTRLKLEKECNPFLRTSSREIRQSLN 236 N +FAL++EP+N + + H R G+PT+P+ + E E NPF+R E+++ + Sbjct: 179 KNLQFALTVEPDNVRVGQKLSWAQHQRQAGLPTIPSTIDEEMETNPFMRVDLPELQERVG 238 Query: 237 IPDTANDAEALGVIRQAKDAF 257 + +AL IR+ KD + Sbjct: 239 ---CQSAIDALQEIRRQKDNW 256 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48283176 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775772 (56 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10173 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv57566 90 3e-20 >Vv57566 Length = 286 Score = 90.1 bits (222), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 65/156 (41%), Positives = 84/156 (53%), Gaps = 27/156 (17%) Query: 51 AQLTIFYAGSVSVFDAITAEKVRELMLIAAAAADKKTSDVKNTATSGPPSPLVRTGSSSL 110 +Q+TIFYAG V VF+ AEK RE+ML+AA + TS +TSGP + TGSS+ Sbjct: 128 SQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGF--LSTSGPEK--INTGSSTA 183 Query: 111 QNSSAPGSPVVQPYPDQKSSTS---------------KLEAGFPIARRHSLQRFLEKRRD 155 + S P SP P P SS + L + PIARR+SL RFLEKR+D Sbjct: 184 PSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSELPIARRNSLHRFLEKRKD 243 Query: 156 RLVSNSPY----PTSPA-TPMDDSSKTNPSNNASPG 186 R+ S +PY P+ P+ P +D TNP N G Sbjct: 244 RVNSKAPYQVNNPSRPSPKPEED---TNPKLNKDEG 276 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1609 (111 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12773 160 4e-42 >Vv12773 Length = 119 Score = 160 bits (406), Expect = 4e-42, Method: Compositional matrix adjust. Identities = 77/106 (72%), Positives = 84/106 (79%) Query: 6 WHKVXXXXXXXXXXXXTYGAHGFKPQNPTYKEVWQTASLYHLVHTAALLAAPITKRPTIF 65 WH+V +GAH FKPQNP YKEVW+TASLYHLVHTAALLA P+TK P IF Sbjct: 14 WHQVAAVSGAVGIGLGAFGAHVFKPQNPIYKEVWKTASLYHLVHTAALLATPVTKHPNIF 73 Query: 66 GGLLTTGILAFSGTCYTVAFLEDRKYSTLAPFGGFAFIAAWGSLLF 111 GGL+T GILAFSG+CYTVA+ EDRKYS LAPFGG AFIAAWGSLLF Sbjct: 74 GGLVTAGILAFSGSCYTVAYFEDRKYSFLAPFGGLAFIAAWGSLLF 119 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30601 (274 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47251 73 6e-15 >Vv47251 Length = 261 Score = 73.2 bits (178), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 56/222 (25%), Positives = 96/222 (43%), Gaps = 7/222 (3%) Query: 29 IFQKMHELDIKPNVVTFSAILNACSRCNSFDDASMLLEELRLFDNQVYGVAHGLLMGYRD 88 + Q M L ++P++ T++ +L+ C+ S D E + + + + + D Sbjct: 32 LLQSMLRLGLQPSLQTYTLLLSCCTEARSSFDMGFCGELMAVTGHPAHMFLLSMPAAGPD 91 Query: 89 --NVWVKAQSLFDEVKQMDSSTASAFYNALTDMLWHFGQKQGAQLVVLEGKRRNVWESVW 146 NV D + D + +A+ D L G K+ A V ++NV+ Sbjct: 92 GQNVRDHVSKFLDLMHSEDRESKRGLVDAVVDFLHKSGLKEEAGSVWEVAAQKNVYPDAV 151 Query: 147 SD--SC---LDLHLMSPGAARAMVHAWLLNIRTIVFKGQQLPNLLSILTGWGKHSKVVGD 201 + SC ++LH MS G A + L + +P+ + I+TGWG+ S+V G Sbjct: 152 REKSSCYWLINLHFMSDGTAVTALSRTLAWFHREMLVSGTVPSRIDIVTGWGRRSRVTGA 211 Query: 202 STLRRAIEALLTSMGAPFHIAKCNLGRFISTGSVAAAWLKES 243 S +R+A++ LL PF N G F+ G WL +S Sbjct: 212 SLVRQAVQELLHIFSFPFFTENGNSGCFVGRGEPLGRWLLQS 253 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19591 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13112 (300 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26179 (200 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226745693 (195 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280866 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6152 (382 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4343 (182 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29071 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6806 112 4e-27 >Vv6806 Length = 388 Score = 112 bits (281), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 61/149 (40%), Positives = 86/149 (57%), Gaps = 7/149 (4%) Query: 48 LAGKCNWFRGTWVYDASSKPPYYSSTCPFVDPQFDCLKYGRPDTAFLKYRWQPFSCALPR 107 L C + G WVYD S P Y S+CP++ C K GRPD+ + K+RW+P C++PR Sbjct: 59 LGSSCEFSDGKWVYDLSY--PLYDSSCPYLSTPVTCQKNGRPDSDYEKWRWKPHGCSIPR 116 Query: 108 FNGLYFLEKWRGKKIMFVGDSLSFNQWVSLTCMLHAWVPNSRTSYVKKDGLASVTFQ--D 165 F+ L+FL + R K+IM VGDS+ NQW SL C++ +P R + V DG S+ F D Sbjct: 117 FDALHFLGRMRRKRIMLVGDSIMRNQWESLVCLVQGVIPTGRKT-VTYDG-PSMAFHALD 174 Query: 166 YGVQILLYRTPYLVDLVN-EKVGRVLKLD 193 + I P+LV+L + R+L LD Sbjct: 175 FETSIEFCWAPFLVELKKGPQNKRILHLD 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3227 (191 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv1093 81 1e-17 >Vv1093 Length = 304 Score = 81.3 bits (199), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 51/124 (41%), Positives = 69/124 (55%), Gaps = 20/124 (16%) Query: 1 MFGFVTFVYAETVRQILSKGNPHFVCGARVLVKPYREKSRLVDWKHS------------D 48 MFGFVTFVY ETV+ IL+KGNPHFVC +RVLVKPY+EK ++ + K + Sbjct: 1 MFGFVTFVYPETVKLILAKGNPHFVCDSRVLVKPYKEKGKVPEKKQQHQQQQQQQQQQLE 60 Query: 49 TMQHSMCYHSHLMDG----DSELQAMPRVCDSARFLRKQFIEEN--EQALELERRRLSEM 102 ++S C +D D L A LR++ E+ +QA+EL+ RRL M Sbjct: 61 RGEYSTCSSPSGIDPREPYDLHLGARMFYNTQEMLLRRKLEEQADLQQAIELQGRRL--M 118 Query: 103 NLAV 106 NL + Sbjct: 119 NLQL 122 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4687 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55748 112 4e-27 >Vv55748 Length = 161 Score = 112 bits (280), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 74/183 (40%), Positives = 95/183 (51%), Gaps = 33/183 (18%) Query: 1 MARSSISQTL--TLTRHLXXXXXXXXXRLITLRAQSTLP---------FHHXXXXXXXXX 49 MARS +SQTL TLTR +L+ R +S P F Sbjct: 1 MARS-LSQTLALTLTRLSHPSLHRSSSQLLAFRCRSNRPENRFLTENGFLTELDLEASDP 59 Query: 50 XXXXXLLRKLEDAIHRIIVRRSAPDWLPFLPGASYWVPPPRSRSHGLAQLVDKLANPLSE 109 + KL+DAI +I V+++ PDWLPF+PG+S+WVPP R R GLA LV KLA LSE Sbjct: 60 DLEILRILKLDDAIDQIHVKKATPDWLPFVPGSSFWVPP-RGRFSGLADLVGKLAYVLSE 118 Query: 110 EETMSMSTVRGWPSSAYFIEGTSPQLMEPVVVFQSSDDVSNPQPMETADQISNNVSKSED 169 +E MS++TVRGWPS +Y++ G SP + SNN S+SED Sbjct: 119 DEAMSLTTVRGWPSLSYYVNGASPH--------------------SEVETTSNNASQSED 158 Query: 170 EEG 172 EEG Sbjct: 159 EEG 161 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16217 (330 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9508 (279 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7629 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71922754 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13333 (66 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24583 (259 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27584 (348 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3566262 538 e-155 >Vv3566262 Length = 359 Score = 538 bits (1385), Expect = e-155, Method: Compositional matrix adjust. Identities = 269/350 (76%), Positives = 303/350 (86%), Gaps = 7/350 (2%) Query: 1 MGAEAL--TATGNSTAREAPLVLGLQASALVDHVARVDWSLLDQLPGERGGSIPVAIEEL 58 MGAE L T T +PL+LGLQ SAL+DHVA++D SLL Q+PGERGGSI VAIE+L Sbjct: 1 MGAEPLLPKKTHTHTQPNSPLILGLQPSALIDHVAKIDSSLLAQIPGERGGSIAVAIEDL 60 Query: 59 EHILSEVKPHVISYPDDSLPMKTIAGGSVANTIRGLSAGFGVSCGIIGACGDDEQGQLFV 118 EHIL+EVK H++S P D PM+T+AGGSVANTIRGLSAGFGV+CGI+GACGDDEQG LFV Sbjct: 61 EHILNEVKTHILSSPPDPSPMRTMAGGSVANTIRGLSAGFGVNCGILGACGDDEQGGLFV 120 Query: 119 SNMSSHAVNLSRLRMKKGPTAQCVCLVDALGNRTMRPCLSSAVKLQSQADDLTRADFKGS 178 SNM S VNLS LR+KKGPTAQCVCLVDALGNRTMRPCLSSAVK+ QA++LT+ DFKG Sbjct: 121 SNMGSSGVNLSALRIKKGPTAQCVCLVDALGNRTMRPCLSSAVKI--QAEELTKEDFKGV 178 Query: 179 KWLLLRYGIINLEVIQAAISIAKQEGLFVSLDLASFEMVRNFRSPLLQLLESGDIDLCFA 238 KWL++RYGI NLEVI AAI +AKQEG+FVSLDLASFEMVRNFR PLL+LL+SGDIDLCFA Sbjct: 179 KWLVMRYGIYNLEVIHAAIRMAKQEGVFVSLDLASFEMVRNFRGPLLELLQSGDIDLCFA 238 Query: 239 NEDEATELLRGSEGEQKADPDVALEFLAKHCRWAVVTLGSNGCIAKHGKEIVRVPAIGKA 298 NEDEA ELLR E A P+ ALEFLAKHC+WAVVTLGSNGC+AK G+E+VRV AIG+A Sbjct: 239 NEDEARELLRDDE---NASPEAALEFLAKHCQWAVVTLGSNGCLAKCGREMVRVAAIGEA 295 Query: 299 NAVDATGAGDLFASGFLYGLVKGLSLEECCKVGSCSGGSVIRSLGGEVTP 348 A DATGAGDLFA GFLYGLVKGLSLEECC+VG+C+GGSVIRSLGGEVTP Sbjct: 296 KATDATGAGDLFAGGFLYGLVKGLSLEECCRVGTCNGGSVIRSLGGEVTP 345 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17640 (84 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91014122 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6300 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23708 333 1e-93 >Vv23708 Length = 189 Score = 333 bits (854), Expect = 1e-93, Method: Compositional matrix adjust. Identities = 151/185 (81%), Positives = 173/185 (93%) Query: 6 IWVFGYGSLIWKAGFNYDERLVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEVC 65 +WVFGYGSLIWKAGF YD+R V FIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGE+C Sbjct: 3 LWVFGYGSLIWKAGFEYDDRRVCFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEIC 62 Query: 66 WGVAYKISNKEDQEVAITYLEVREKQYDKKAYLDFFTDPMATTAAVSGVMVYIASPDKKH 125 WGVAYK+S +ED+++A+TYLEVREKQYDKKAYLD + +PMATT +SGVMVYIASPDKK Sbjct: 63 WGVAYKVSKEEDEQIALTYLEVREKQYDKKAYLDVYAEPMATTPVISGVMVYIASPDKKL 122 Query: 126 NVNYLGPASTEEISKQIVQAEGPSGPNRDYLFRLEEALLQLGCKDRHVLDLANEVRRILS 185 N NYLGPAS EEI+KQI+ AEGPSGPNR+YLF+LE+ALLQ+GC+D+HV+DLANEVRRILS Sbjct: 123 NRNYLGPASVEEIAKQIIHAEGPSGPNREYLFQLEQALLQMGCEDKHVMDLANEVRRILS 182 Query: 186 ERELT 190 E+ELT Sbjct: 183 EKELT 187 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25573 (308 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv39691 461 e-132 >Vv39691 Length = 291 Score = 461 bits (1187), Expect = e-132, Method: Compositional matrix adjust. Identities = 221/291 (75%), Positives = 248/291 (85%) Query: 1 MGRVLDSNFLALTAIVTVGYQLLFFIVTALLKFDKVTDFAGSTNFVILAILTLVVKGSWH 60 MG V+DS+FLALTAIVTVGYQ LFFI+TALLKFDKVTDFAGSTNFVILA+LTLV+KG+WH Sbjct: 1 MGTVIDSHFLALTAIVTVGYQFLFFIITALLKFDKVTDFAGSTNFVILAVLTLVLKGTWH 60 Query: 61 FRQVVLSLLVIIWGLRLGFFLLMRILQWGEDRRFDEIRGNLGKLAVFWIFQAMWVWTVSL 120 FRQVVL+LLV+IWGLRLG FLLMRILQWGEDRRFDE+R NLGKLAVFW FQA+WVWTVSL Sbjct: 61 FRQVVLTLLVVIWGLRLGIFLLMRILQWGEDRRFDEMRSNLGKLAVFWTFQAVWVWTVSL 120 Query: 121 PVTVANASNRMPLIQAADIIGWIMWFVGFSVEAAADQQKLTFKSSPQNRGKWCNVGLWKY 180 PVT+ NAS R P +QAADIIGWIMW VG ++EA+ADQQKL+FK+SP+NRGKWCNVG+WKY Sbjct: 121 PVTIVNASGRDPSLQAADIIGWIMWSVGITIEASADQQKLSFKNSPENRGKWCNVGVWKY 180 Query: 181 TRHPNYFGEIFLWWGVFVASTPVLEGAEWXXXXXXXXXXXXXXXXXXXXXXEKSADKKFG 240 TRHPNYFGEI LWWG+FVASTPVLEGAEW E+SADKKFG Sbjct: 181 TRHPNYFGEILLWWGIFVASTPVLEGAEWLVILGPIFLTLLLLFVSGIPLLEESADKKFG 240 Query: 241 NIDEYRLYKRSTSPLIPLPPVIYKNLPLWFKTTFLFEFPLYSRNLPREKPN 291 N+ YRLYK +TSPL+PLPP++Y NLP WFKTTFL EFP YSRNLP+E N Sbjct: 241 NVAGYRLYKSTTSPLVPLPPMVYGNLPSWFKTTFLLEFPFYSRNLPQEGQN 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4740 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19697 (310 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv13409 104 2e-24 >Vv13409 Length = 206 Score = 104 bits (259), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 11/170 (6%) Query: 15 SQVTTIDVSQLHQDSHTRSVLVKSIHHACQEMGFFQVINHGISKTVTENALGSLSNFFDL 74 S+ + + L +D + R+ L++ I AC+ GFFQVINHG++ + E L F+ L Sbjct: 33 SECKHVPIIDLGKDVN-RAQLIQHIADACRLYGFFQVINHGVAAEMMEKMLEVADEFYRL 91 Query: 75 PMDQKKLFLSDDISKPVRFVT----------NSRDSIKLYANPIENWIDLWPHNPTEFRE 124 P+++K SDD +K +R T N RD ++L+ P++ + WP NP F+E Sbjct: 92 PVEEKMKLYSDDPTKTMRLSTSFNVNKEKVHNWRDYLRLHCYPLDQYTPEWPSNPPSFKE 151 Query: 125 SLGRYAAEVKRLSIDILGAIVESLGLSPTYLRSSLGQGMQMIVGSRYPRC 174 + Y EV+ L + I ESLGL ++++ G+ Q + + YP C Sbjct: 152 IVSSYCKEVRELGFRLQEMISESLGLEKDHIKNVFGEQGQHMAVNYYPPC 201 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14832 (359 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55845 85 3e-18 >Vv55845 Length = 484 Score = 84.7 bits (208), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 45/94 (47%), Positives = 54/94 (57%), Gaps = 13/94 (13%) Query: 248 LAEKQGQTKNKYC--PGQCK-----------GEPSVAPALELNFLGLPIRPGKADCLHYM 294 E+ GQT+ KY G CK +PS P LELNFLGLPIR G+ +C +YM Sbjct: 175 FPERPGQTECKYYLRTGGCKFGKACRYNHTKAKPSAVPVLELNFLGLPIRMGEKECPYYM 234 Query: 295 QTGTCKYENNCLFNHPDPTPLEESRPQSTYESHG 328 +TG+CKY NC FNHPDPT P S Y + G Sbjct: 235 RTGSCKYGANCRFNHPDPTAAGGYEPPSGYGNGG 268 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26684 (446 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 462 e-132 >Vv47659 Length = 393 Score = 462 bits (1190), Expect = e-132, Method: Compositional matrix adjust. Identities = 240/411 (58%), Positives = 285/411 (69%), Gaps = 30/411 (7%) Query: 41 SYAPPSQDYRHQQHYAPPPQSHGSAWPTGSNVGSGTKFRRINDDYNSLDQVTDALVRAGL 100 ++ P D+ HQ P + S P + G + I D++NSLDQVTDAL +GL Sbjct: 7 AFDDPHHDFLHQT----PSYAGTSMDPDYRHRG---QLPYIADNFNSLDQVTDALRESGL 59 Query: 101 ESSNLIVGIDFTKSNEWTGARSFHRKSLHHIGGEQNPYEQAIAIIGKTLSSFDEDNLIPC 160 ESSNLI+GIDFTKSNEWTG SFHRKSLH I NPYEQAI+IIG+TLS FDEDNLIPC Sbjct: 60 ESSNLILGIDFTKSNEWTGRHSFHRKSLHAISNTPNPYEQAISIIGRTLSPFDEDNLIPC 119 Query: 161 FGFGDASTHDQEVFSFYPDEGSYCNGFEEVLRRYIELVPQLRLAGPTSFAPIIEMGITIV 220 FGFGDASTHD+ VFSFYPD YC GFEEVL RY E+VP L+L+GPTSFAPII+ I IV Sbjct: 120 FGFGDASTHDKYVFSFYPDH-RYCRGFEEVLARYKEIVPYLKLSGPTSFAPIIDAAIDIV 178 Query: 221 EQSGGQYHVLVIIADGQVTRSVDTGRGQLSPQERKTVEAIVKASEYSLSIILVGVGDGPW 280 E S GQYHVLVIIADGQV+ S+D G+ SPQE+ TV +IV AS Y LSIILVGVGDGPW Sbjct: 179 EGSNGQYHVLVIIADGQVSGSLDGSSGRFSPQEQATVNSIVAASRYPLSIILVGVGDGPW 238 Query: 281 DMMKEFDDNIPARAFDNFQFVNFTEIMAKNMDRSRKEAEFALAALMEIPSQYKATLEL-- 338 D MK FDDNIP R+FDNFQFVNF++IM++NM+ S+KE FAL+ALMEIP QY+ATL L Sbjct: 239 DAMKLFDDNIPQRSFDNFQFVNFSKIMSENMEASKKETAFALSALMEIPFQYRATLRLQS 298 Query: 339 ---NILGATRGKATDRIPLPPPHYGXXXXXXXXXXXXXXXXXXXXXXQRDEFVSTASPTG 395 N++G R + PLPPP +S + Sbjct: 299 IDNNLVGGPRTR-----PLPPPKEVLDHDREALQHMMATT------------LSVEAVEQ 341 Query: 396 SASDNHACPICLTDPKNMAFGCGHQTCCDCGQDLDLCPICRTSIHTRIKLY 446 +A + CPICLT+PKNMAFGCGH TC +CG+ + LCP+CR I+TR+KLY Sbjct: 342 TAPVDQVCPICLTNPKNMAFGCGHLTCKECGESISLCPLCREPINTRLKLY 392 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27736 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11692 (287 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4758 168 9e-44 >Vv4758 Length = 383 Score = 168 bits (426), Expect = 9e-44, Method: Compositional matrix adjust. Identities = 108/300 (36%), Positives = 157/300 (52%), Gaps = 27/300 (9%) Query: 3 QESFPMAGGDDQYSYSKNSGAQGKAADTVKGMLIDAILENLHIGNHLSQGNVVSNSSFSI 62 Q+ M GGD + SY+ NS Q K VK +L ++I E L+ + I Sbjct: 4 QQVLCMKGGDGEASYANNSLLQKKVILEVKPILEESITE-LYCKTF--------SECLKI 54 Query: 63 ADLGCSVGPNTFIAIDNIMETVTQKIKNEGQSSSLPEFHVFFNDHVSNDFNTLFVNLPP- 121 ADLGCS GPNTF+ + I++ + S P F +F ND NDFN +F +L Sbjct: 55 ADLGCSSGPNTFLPLWEIIDCIGATCSR--FSREPPAFQIFLNDLPQNDFNAIFKSLARF 112 Query: 122 -----------NRQYFAVGVPGSFYGRLFPKASLNFVYSAYSVIWLSKVPEGIADLNSPI 170 +RQ F VGVPGSF+ RLFP S++F +S+YS+ WLS+VPEG+ + Sbjct: 113 YERIEKEKEGMSRQCFIVGVPGSFHRRLFPDRSIHFFHSSYSLHWLSQVPEGLVSESGTP 172 Query: 171 LNKGRMYYS-NAPIEVGHAYSVQYAKDMKCFLDARAEELAPRGLLVLLVTGRPDGTLPRE 229 LNKG ++ + P V AY Q+ +D FL R++E+ P G ++L + G DG Sbjct: 173 LNKGNIHLTVTTPPSVHKAYLNQFERDFTAFLRLRSQEIIPGGHMLLTLMG-SDGNGQNS 231 Query: 230 CSCG--PLYERVESCLIDMVNEGLISQDKLDTFNHPTYSPSMEELSELVHENGCFEIARL 287 + G + E + L DMV EG I + +LD+FN P + PS E++ ++ F + RL Sbjct: 232 STDGLYKICELISMTLKDMVTEGSIQESELDSFNIPLFMPSPEQVRSVIQRESSFTLLRL 291 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48404361 (121 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28502 (246 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26404 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13487 (663 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12632 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15312 (461 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv21063 451 e-128 >Vv21063 Length = 267 Score = 451 bits (1160), Expect = e-128, Method: Compositional matrix adjust. Identities = 215/265 (81%), Positives = 230/265 (86%) Query: 45 KDAEEKKTSFNPRPYFRLFVNWLLDLGSLDPVIDGANFQILTAFANAFHALQPLKVPTFS 104 KDAEEKKTSFNPRPYFR F+NWL +LGS DPV DGANFQ+L FANAFHALQPLK+P FS Sbjct: 1 KDAEEKKTSFNPRPYFRFFINWLSELGSPDPVFDGANFQVLITFANAFHALQPLKIPAFS 60 Query: 105 FAWLELVSHRSFMPKMLVGNGQKGWPYIQRLLVHLFQFMEPFLRNAELGVPVHFMYKGTL 164 FAWLELVSHRSFMPK+L GN KGWPY+ RLLV LFQFMEPFLRNA LG PVHF+Y+GTL Sbjct: 61 FAWLELVSHRSFMPKLLTGNPSKGWPYLHRLLVDLFQFMEPFLRNAILGEPVHFLYRGTL 120 Query: 165 RVLLVLLHDFPEFLCDYHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLA 224 RVLLVLLHDFPEFLC YHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLL Sbjct: 121 RVLLVLLHDFPEFLCGYHFTFCDVIPPSCIQMRNIILSAFPRNMRLPDPSTPNLKIDLLV 180 Query: 225 EISQSPRILSEVDAALKAKQMKADVDEYLKTRQQGSSFXXXXXXXXXXXPSEVASAGTRY 284 EI+QSP ILS+VDA+LK KQMK DVDEYLK QQGSSF P + A AGTRY Sbjct: 181 EINQSPLILSDVDASLKVKQMKTDVDEYLKMGQQGSSFLSGMKQRLLLLPIDAARAGTRY 240 Query: 285 NVPLINSLVLYVGMQAIQQLQARTP 309 N+PLINSLVLYVGMQA+QQL+ARTP Sbjct: 241 NIPLINSLVLYVGMQAMQQLKARTP 265 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12391 (343 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14207 446 e-127 >Vv14207 Length = 366 Score = 446 bits (1147), Expect = e-127, Method: Compositional matrix adjust. Identities = 217/300 (72%), Positives = 244/300 (81%), Gaps = 3/300 (1%) Query: 1 MEQLSSMFSGLARSLSLKKGKNNDEXXXXXXXXXXXXXXXXXNDMILRSSGIVYVDGSNN 60 M SSMF+G ARS S+KK ++ ND+IL SSG V V+GSNN Sbjct: 1 MGHFSSMFNGWARSFSIKKASSSGNCGGREAVEVMAKEAKK-NDLILHSSGFVNVNGSNN 59 Query: 61 FASVFSKRGEKGVNQDCCFVWEGFGFQEDMMFCGIFDGHGPWGHFVAKQIRETMPPSLLC 120 F S++SKRGEKGVNQDC VWE FG QEDM+FCG+FDGHGPWGH+VAK++RE+MP SLLC Sbjct: 60 FTSLYSKRGEKGVNQDCFIVWEEFGGQEDMLFCGVFDGHGPWGHYVAKRVRESMPSSLLC 119 Query: 121 SWQETLAQTSIDPDPDL--DKKCHRFNVWKDSYIKTCAAIDHELGQHRRIDSFYSGTTAL 178 +WQETLA+ S+DPD DL +KK HRFN+WK SY+KTCAAID EL HRRIDSF SGTTAL Sbjct: 120 NWQETLAEASLDPDFDLQAEKKLHRFNIWKHSYLKTCAAIDQELEHHRRIDSFNSGTTAL 179 Query: 179 SIVRQGELIFIANVGDSRAVLATTLDDGSLVPVQLTVDFKPSLPQEAERIIQSNGRVFCL 238 +IVRQGE IF+ANVGDSRAVLAT DDG+L PVQLT+DFKP+LPQEAERIIQ GRVFCL Sbjct: 180 TIVRQGESIFVANVGDSRAVLATMSDDGNLEPVQLTIDFKPNLPQEAERIIQCKGRVFCL 239 Query: 239 DDEPGVQRVWQPDGETPGLAMSRAFGDYCVKDFGLISVPEVSQRNITSRDQFVVLATDGV 298 DEPGV RVW P E+PGLAMSRAFGDYCVKDFGLISVPEV+QRNITSRDQFVVLATDGV Sbjct: 240 GDEPGVHRVWLPHEESPGLAMSRAFGDYCVKDFGLISVPEVTQRNITSRDQFVVLATDGV 299 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27225 (424 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10583 (90 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28787 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28707 (375 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 129 6e-32 >Vv31003 Length = 427 Score = 129 bits (325), Expect = 6e-32, Method: Compositional matrix adjust. Identities = 95/322 (29%), Positives = 157/322 (48%), Gaps = 39/322 (12%) Query: 28 ENKNKNEDSLPGFNE---FSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLED-GRWI 83 +N + +++ LP N+ F+ QL AT F S+ + E G V+KG L++ + + Sbjct: 81 KNGSPDKNGLPDKNQARTFTFHQLAVATDNFRSDCFLGEGGFGK---VFKGYLDNPSQVV 137 Query: 84 AVKRFNRSAWPDSRQFLEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHL 143 A+K+ +R+ R+F E + + + L LIG C EGD RLLV E+MP +L HL Sbjct: 138 AIKQLDRNGLQGIREFFVEVLTLSSVDHPNLVKLIGYCAEGDQRLLVYEYMPLGSLENHL 197 Query: 144 FHWE--AQPMKWAMRLRVALYLAQALDYCSSK--GQALYHDLNAYRVLFDQDGNPRLSCF 199 +P+ W R+++A A+ L+Y K +Y DL +L + +P+LS F Sbjct: 198 HDLPPGTKPLDWNSRMKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDF 257 Query: 200 GLMK--NSKDGKSYSTNL----AFTPPEYLRTGRVIPESLVYSFGTVLLDLLSGKHIPPS 253 GL K + D ST + + P+Y TG++ +S +YSF VLL+L++G+ Sbjct: 258 GLAKVGPTGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGR----- 312 Query: 254 HALDLIRG-----------------KNFLMLMDSCLEGHFSNDDGTELVKLASRCLQYEP 296 A+D +G + F + D L G + + + +A+ C+Q +P Sbjct: 313 KAIDNSKGAREQNLVAWARPLFKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQP 372 Query: 297 RERPNAKSLVTALIPLQKETEV 318 RP +VTAL L +T + Sbjct: 373 NMRPLIADVVTALNYLASQTTL 394 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56163217 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22842 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv54977 362 e-102 >Vv54977 Length = 209 Score = 362 bits (929), Expect = e-102, Method: Compositional matrix adjust. Identities = 176/209 (84%), Positives = 189/209 (90%) Query: 1 MDWGNVTAEDVIDALREVDWSSPPRPLSEFFSRFTIPRSSSKWNSRLKCNLYYYRTNYXX 60 MDWGNVTAED+IDALREVDWS+PPRPLSEFFSRFT+PRS SKW+SRLKCN YYYRTNY Sbjct: 1 MDWGNVTAEDLIDALREVDWSTPPRPLSEFFSRFTLPRSYSKWSSRLKCNFYYYRTNYFI 60 Query: 61 XXXXXXXXXXXRSPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP 120 R P+A++AA LTALSIAFLNDSFAGTFSEKV+RTVRQFSPHLAAKMRPP Sbjct: 61 MIVFILGMGFLRRPIAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP 120 Query: 121 LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSVSFILWFVSCGLLTVLWALAFGLLATLLH 180 LTPVIRGRPSAKR+I ICGRPRWVFV+IFSSVSFILWFVSC +LTVLWALA GLLAT+LH Sbjct: 121 LTPVIRGRPSAKRSILICGRPRWVFVLIFSSVSFILWFVSCSILTVLWALAIGLLATILH 180 Query: 181 ASFRTPNLKARLNTYREEFRAVWRNYSEL 209 ASFRTPNLKARLNT+REEFRAVWRNYSEL Sbjct: 181 ASFRTPNLKARLNTFREEFRAVWRNYSEL 209 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28371 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23746 405 e-115 >Vv23746 Length = 259 Score = 405 bits (1041), Expect = e-115, Method: Compositional matrix adjust. Identities = 211/269 (78%), Positives = 225/269 (83%), Gaps = 15/269 (5%) Query: 1 MATNENLPPNVIKQLAKELKSLDESPPEGIQVGLNDDDFSIIYADIEGPAGTPYENGVFH 60 MATNENLPPNVIKQLAKELK+LDE+PPEGI+V +NDDDFS I+AD+EGPAGTPYENGVF Sbjct: 1 MATNENLPPNVIKQLAKELKNLDETPPEGIKVVVNDDDFSTIFADVEGPAGTPYENGVFR 60 Query: 61 MKLLLSRDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 MKLLLS DFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI Sbjct: 61 MKLLLSHDFPHSPPKGYFLTKIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLI 120 Query: 121 EPFPESALNEQAGKMLLENYEEYARHARLYTGIHA-KPKHKFKTGAISESTTALNVDQTN 179 EPFPESALNEQAGKMLLENYEEYARHAR+YTGIHA KPK KFKTGAISESTTALNVDQTN Sbjct: 121 EPFPESALNEQAGKMLLENYEEYARHARIYTGIHALKPKPKFKTGAISESTTALNVDQTN 180 Query: 180 TLTLNADQKNTAPGAALLVISASPSLLAPSTVA--TRGNGQDQAPVVAPMETGVGGS--A 235 + LN +QKNTA + PS LA A +G G QAP ETGV GS A Sbjct: 181 SSVLNVEQKNTA-------LQLPPSSLATCMTAGGGKGGGNGQAPTT---ETGVSGSAAA 230 Query: 236 TTVRKEGGLTKAQVEKKKIDARKKSLKRL 264 T +KE GL K Q +KKK+DARKKSLKRL Sbjct: 231 TPHKKESGLAKVQADKKKMDARKKSLKRL 259 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18624 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1906 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8012 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19271 318 7e-89 >Vv19271 Length = 485 Score = 318 bits (814), Expect = 7e-89, Method: Compositional matrix adjust. Identities = 158/215 (73%), Positives = 176/215 (81%), Gaps = 10/215 (4%) Query: 1 VSSPHVIPCIEPSASGKDRSSVISQGS--------KVPGSYVKEIACGGRHSAVITDAGA 52 VSSPH+IPC PSA GKDR S++ QGS KVPGS VK IACGGRHSAVITDAG Sbjct: 256 VSSPHLIPCFNPSAYGKDRPSLVHQGSLSSTEDISKVPGSRVKGIACGGRHSAVITDAGQ 315 Query: 53 LLTFGWGLYGQCGQGNTIDQLRPSYVKSLSETKVKNIAAGLWHTLCVSVDGRVYAFGGNQ 112 LLTFGWGL+GQCG GNT DQLRP+ V +LS KV IAAGLWHTLC S +G+VYAFGGNQ Sbjct: 316 LLTFGWGLHGQCGLGNTHDQLRPACVSALSGVKVTGIAAGLWHTLCFSAEGQVYAFGGNQ 375 Query: 113 FGQLGTGADEGELQTLPKILDSPGLGSKHAKVASCGARHSVILTEDGQLFSWGWNKYGQL 172 FGQLGTGAD+ E TLPK+LD+ L +K AK+ SCGARHSV+LTE G++FSWGWNKYGQL Sbjct: 376 FGQLGTGADQAE--TLPKLLDASNLENKRAKIVSCGARHSVVLTEGGEIFSWGWNKYGQL 433 Query: 173 GLGDAVDRNIPSQVSIEGCLLKNIACGWWHTLLLA 207 GLGD +DRNIPS VSI GC LKN+ACGWWHTLLLA Sbjct: 434 GLGDCIDRNIPSPVSIGGCQLKNVACGWWHTLLLA 468 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3749 (131 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13481 (300 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6654 548 e-158 >Vv6654 Length = 311 Score = 548 bits (1413), Expect = e-158, Method: Compositional matrix adjust. Identities = 259/294 (88%), Positives = 276/294 (93%) Query: 3 KGKREVVVSALQFACTDDVATNVATAERLVRAAHAKGANIILIQELFEGHYFCQAQREDF 62 +G R VVVSALQFACTDDV TN+ TAERLVR AH KGANIILIQELFEG+YFCQAQREDF Sbjct: 16 EGNRVVVVSALQFACTDDVPTNLNTAERLVRDAHRKGANIILIQELFEGYYFCQAQREDF 75 Query: 63 FQRAKPYKDHPTILRMQILAKELGVVIPVSFFEEANNAHYNSVAIIDADGADLGLYRKSH 122 FQRAKPYK HPTILRMQ LAKELGVVIPVSFFEEANNAHYNS+AI+DADG DLG+YRKSH Sbjct: 76 FQRAKPYKGHPTILRMQKLAKELGVVIPVSFFEEANNAHYNSIAIVDADGTDLGIYRKSH 135 Query: 123 IPDGPGYQEKFYFNPGDTGFKVFKTKFATIGVAICWDQWFPEAARCLVLQGAEILFYPTA 182 IPDGPGYQEKFYFNPGDTGFKVF+TKFA IGVAICWDQWFPEAAR +VLQGAEIL YPTA Sbjct: 136 IPDGPGYQEKFYFNPGDTGFKVFETKFAKIGVAICWDQWFPEAARAMVLQGAEILLYPTA 195 Query: 183 IGSEPQDGGLDSRDHWRRVMQGHAGANVVPVVTSNRIGKEIIETEHGKSEITFYGNSFIA 242 IGSEPQD GLDSRDHW+RVMQGHAGAN+VP+V SNRIGKEII+TEHG +EITFYGNSFIA Sbjct: 196 IGSEPQDTGLDSRDHWKRVMQGHAGANLVPLVASNRIGKEIIQTEHGNTEITFYGNSFIA 255 Query: 243 GPTGEIVATANDKEEAVLVAQFDLDKIKWKRHSWGVFRDRRPDLYKVLLTSDGS 296 GPTGEIVA A+DKEEAV+VAQFDLDKIK KR+SWG+FRDRRPDLYKVLLT DGS Sbjct: 256 GPTGEIVAAADDKEEAVVVAQFDLDKIKSKRYSWGIFRDRRPDLYKVLLTLDGS 309 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25734 (346 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6654 91 3e-20 >Vv6654 Length = 311 Score = 90.9 bits (224), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 78/298 (26%), Positives = 124/298 (41%), Gaps = 40/298 (13%) Query: 38 DTPATLDKAERLLAEAAGYGAQLVVFPEAFVGGYPRGSNFGVVIGNRTAKGKEDFRKYHA 97 D P L+ AERL+ +A GA +++ E F G Y +EDF + Sbjct: 33 DVPTNLNTAERLVRDAHRKGANIILIQELFEGYY------------FCQAQREDF--FQR 78 Query: 98 AAIDVPGPEVDRLAAMAGKYKVFLVMGVIERDGYTLYCTVLFFDSQGCYLGKHRKMM--- 154 A P + R+ +A + V + + E Y ++ D+ G LG +RK Sbjct: 79 AKPYKGHPTILRMQKLAKELGVVIPVSFFEEANNAHYNSIAIVDADGTDLGIYRKSHIPD 138 Query: 155 -PTALERIIWGFGDGSTIPVFETPIGKIGAAICWENKMPLLRTAMYAKGIEIYCAPTA-- 211 P E+ + GD + VFET KIG AICW+ P AM +G EI PTA Sbjct: 139 GPGYQEKFYFNPGD-TGFKVFETKFAKIGVAICWDQWFPEAARAMVLQGAEILLYPTAIG 197 Query: 212 --------DSRDLWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYAFAGEEPAPDSVV 263 DSRD W+ M A ++++N+ + E + Sbjct: 198 SEPQDTGLDSRDHWKRVMQGHAGANLVPLVASNRIGKE----------IIQTEHGNTEIT 247 Query: 264 CAGGSVIISPSGTILAGPNYDGEALISADLDLGEIARAKFDFDVVGHYSRPEVLSLIV 321 G S I P+G I+A + EA++ A DL +I ++ + + RP++ +++ Sbjct: 248 FYGNSFIAGPTGEIVAAADDKEEAVVVAQFDLDKIKSKRYSWGIF-RDRRPDLYKVLL 304 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26993 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18416 136 2e-34 >Vv18416 Length = 340 Score = 136 bits (343), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 17/175 (9%) Query: 12 KYEIGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREIETMKLIKHP 71 +Y+ + +G G F + R+ +T E VA+K +++ K K+ E ++REI + ++HP Sbjct: 4 RYDALKELGSGNFGVARLVRDKKTKELVAVKYIERGK----KIDENVQREIINHRSLRHP 59 Query: 72 NVVQLYEVMGSKTKIFIVMEFVTGGELFDKIVNNGRMKEDEARRYFQQLINAVDYCHSRG 131 N+V+ EV+ + T + IVME+ GGELF++I N GR EDEAR +FQQLI+ V YCHS Sbjct: 60 NIVRFKEVLLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSME 119 Query: 132 VYHRDLKPENLLLDA--YGNLKVSDFGLSALSQQVRDDGLLH----TTCGTPNYV 180 + HRDLK EN LLD LK+ DFG S LLH + GTP Y+ Sbjct: 120 ICHRDLKLENTLLDGSPMPRLKICDFGYSK-------SALLHSQPKSAVGTPAYI 167 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22982 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20455 (117 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv15680 182 2e-48 >Vv15680 Length = 122 Score = 182 bits (462), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 90/117 (76%), Positives = 96/117 (82%) Query: 1 MAKSSFKLEHPLXXXXXXXXXXXXKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQ 60 MAKS FK EH KYPDRIPVIVEKAERSDIP+IDKKKYLVPADLTVGQ Sbjct: 1 MAKSYFKQEHDFEKRRAEAARIREKYPDRIPVIVEKAERSDIPNIDKKKYLVPADLTVGQ 60 Query: 61 FVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENKDEDGFLYMTYSGENTFG 117 FVYV+RKRIKLSAEKAIFIFV N+LPPT A+MS IY+E KD DGFLY+TYSGENTFG Sbjct: 61 FVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSGIYDEKKDADGFLYVTYSGENTFG 117 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14522 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91040172 (141 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12845 (233 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36401 122 7e-30 >Vv36401 Length = 297 Score = 122 bits (305), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 57/132 (43%), Positives = 80/132 (60%), Gaps = 3/132 (2%) Query: 7 IKRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPF 66 +KR+ +E + + P ++ P +I EW + + G T F GG Y+G+I+ P EYPF Sbjct: 13 VKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPSDTEFEGGIYHGRIQLPAEYPF 72 Query: 67 KPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSP--TTGS 124 +PP + TPNGRF TQ KICLS+S+ HPE W P WSV + L L++F M TSP GS Sbjct: 73 QPPSFMLLTPNGRFETQTKICLSISNHHPEHWQPSWSVRTALVALIAF-MPTSPNGALGS 131 Query: 125 VNTTVAEKKRLA 136 ++ E+ LA Sbjct: 132 LDYKKEERHALA 143 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30489 (199 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16733 (229 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11285 (332 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226763976 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56430896 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26529 (148 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41067 291 5e-81 >Vv41067 Length = 148 Score = 291 bits (744), Expect = 5e-81, Method: Compositional matrix adjust. Identities = 138/148 (93%), Positives = 143/148 (96%) Query: 1 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPGDSPFSGGVFLVSIHFPPDY 60 MASKRI KELKDLQKDPP SCSAGPVA+DMFHWQATIMGP DSP++GGVFLV+IHFPPDY Sbjct: 1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDY 60 Query: 61 PFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 PFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV Sbjct: 61 PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV 120 Query: 121 PEIAHMYKTDRQKYEATARSWTQKYAMG 148 PEIAHMYKTDR KYE TARSWTQKYAMG Sbjct: 121 PEIAHMYKTDRAKYETTARSWTQKYAMG 148 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12264 (261 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv43779 194 1e-51 >Vv43779 Length = 588 Score = 194 bits (494), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 99/238 (41%), Positives = 146/238 (61%), Gaps = 5/238 (2%) Query: 3 PIWGTGILLTTAYAQQGTFVLQQAKTMDRHL-TKSFEIPAGSMSVFTIVTMLSTLALYDR 61 PIW GI+ A QQ T+V+ QA DR L + F+IPA S +VFT++++ + +YD+ Sbjct: 332 PIWAAGIIYYVALVQQSTYVVFQALQSDRRLGSTGFKIPAASYTVFTMLSLTIWIPIYDQ 391 Query: 62 LFIPVARKFTGLERGITYFQRMGIGFFISIFATLVGGFVEIKRKEAAFAH---GLVDHPH 118 + +P+ R+ TG E GIT Q+MGIG +++ ++ VE +R+ A G+ Sbjct: 392 IIVPLLRRLTGKEVGITLLQKMGIGMVLAVITMILSALVEERRRTLALTKATVGIEARRG 451 Query: 119 DTIPISVFWLVPQYALHGIAEAFMSIGHLEFFYDQSPESMRSTAAALFSTSISVGNYVST 178 +S WLVPQ L GI+E IG +EFFY Q PE+MRS A A I+ NY+S+ Sbjct: 452 AISSLSGMWLVPQLTLIGISEGLTIIGQVEFFYKQFPENMRSFAGAFLFCGIAFSNYLSS 511 Query: 179 ILVSLVHKFSAGPNGSNWLPDNNLNKGKLENFYWLITVLQVVNLIYYIFCAKTYTFKS 236 LVS+VH+ + G NWLP+ +LNKG+L+ FY+L+ L +VNL+Y++ CAK Y +K Sbjct: 512 FLVSIVHQSTGGTATGNWLPE-DLNKGRLDYFYYLVAALGMVNLLYFLACAKWYKYKD 568 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21069 (253 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12750 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv40503 357 e-100 >Vv40503 Length = 248 Score = 357 bits (915), Expect = e-100, Method: Compositional matrix adjust. Identities = 166/248 (66%), Positives = 203/248 (81%) Query: 1 MPEKITAEDLLNNIVGTLADKKQKXXXXXXXXXXXXXXTQFNFNRLFGRQKPVHHILGGG 60 MPE ITAE LLNNI+ T++D QK F RLFGR+KPV+++LG G Sbjct: 1 MPEGITAEKLLNNIMETISDNAQKKKSVSFFEEEKSNSVTSQFKRLFGREKPVYNLLGAG 60 Query: 61 KSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFLWSNFSGMI 120 KSAD++LWRNKKISAS +T AT++WVLFEWLNYHFLTL+ FA++LGM+AQF+WSN SG+ Sbjct: 61 KSADLMLWRNKKISASFITGATLIWVLFEWLNYHFLTLLCFAVVLGMIAQFVWSNASGVF 120 Query: 121 NRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVVSLLIAAMI 180 +RS S+VPR+VLP +LF NI +++G ++N+ L F+QDVAC GN+KQF++VVVSL AA+I Sbjct: 121 SRSSSEVPRIVLPDELFQNIGVAVGVQVNQALGFLQDVACGGNLKQFLLVVVSLWAAAVI 180 Query: 181 GSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTGVLSKIPKG 240 GSWCNFLTVLY+GF+AAHTLPVLYERYEDQVD FVYQVLGQLQHNYRKLD+G LSKIPKG Sbjct: 181 GSWCNFLTVLYVGFIAAHTLPVLYERYEDQVDGFVYQVLGQLQHNYRKLDSGFLSKIPKG 240 Query: 241 KLSWKKYE 248 L KK+E Sbjct: 241 SLKGKKHE 248 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12600 (164 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6851 (169 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13659 (521 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23286 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768534 (94 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26661 (146 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv51506 91 9e-21 >Vv51506 Length = 263 Score = 90.9 bits (224), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 46/107 (42%), Positives = 68/107 (63%), Gaps = 2/107 (1%) Query: 10 LVKETSAGEEETRVIDGEEELSLKRRVWIEIKKMWLVAGPAIFTRVASFGTNVVSQAFIG 69 L+ +A E + I+G + + +E KK+W +AGPAIFT + + ++Q F G Sbjct: 26 LLATFNADESDIGPINGVRDF--YKEFIVESKKLWYLAGPAIFTSLCQYSLGAITQVFAG 83 Query: 70 HIGSLELAAFSLVFTVLVRFGNGILLGMASALETLCGQSHGAKQYNM 116 H+G+LELAA S+ +V+ F G++LGM SALETLCGQ+ GA Q +M Sbjct: 84 HVGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDM 130 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28295 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17149 (123 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16336 80 1e-17 >Vv16336 Length = 400 Score = 80.1 bits (196), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 48/110 (43%), Positives = 64/110 (58%), Gaps = 10/110 (9%) Query: 13 GDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNEEACDVARKRILLWHKKNGA 72 GD YLKP++I EPEV R+ +DECLILASDGLWDV++N+ AC VA R+ L + + Sbjct: 291 GDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVA--RMCLNAQAPPS 348 Query: 73 TPLA-ERGTGV-------DPXXXXXXXXXXXXXXQKGSKDNISVVVVDLK 114 P++ E G G+ D + S DN+SVVVVDL+ Sbjct: 349 PPVSPETGAGIGAGGESSDKACLDASMLLTKLALARDSADNVSVVVVDLR 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30271 (75 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31982 (239 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12028 59 7e-11 >Vv12028 Length = 98 Score = 58.9 bits (141), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 3/78 (3%) Query: 148 KASYESSHGTPARSRLKPRDESPEKGAAVPKFGEWDENDPASADGFTHIFNKVREEK-AG 206 + S+ S +P ++ + + G +PKFGEWD NDPASA+GFT IFNK R+EK G Sbjct: 1 RVSHLSLSLSPFSRKILSLEFMSDNGRPLPKFGEWDVNDPASAEGFTVIFNKARDEKRTG 60 Query: 207 KAPGTPSHPSYQDARKQG 224 P +P++ ++ KQG Sbjct: 61 GQPESPAN--VENNVKQG 76 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11570 (633 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2190 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28687 (433 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17496 (197 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28727 (154 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17836 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011528 (161 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25115 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226775946 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5398 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig743 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6223 (295 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28758 (73 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28013 (107 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7367 (571 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16913 (54 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2376 (162 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1188 (241 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31412 222 5e-60 >Vv31412 Length = 175 Score = 222 bits (566), Expect = 5e-60, Method: Compositional matrix adjust. Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 1/120 (0%) Query: 123 RFQRFKESDYMDTEQ-GLCLGALFDIAATNGLDTGRRLCIFGFCRSIEMLSDVVEDTVLE 181 +FQRF+ESDY+D +Q GLCLGALFDIAATNGLD GRRLCIFGFCRSIEMLSDVVEDTVLE Sbjct: 56 KFQRFQESDYLDPKQKGLCLGALFDIAATNGLDMGRRLCIFGFCRSIEMLSDVVEDTVLE 115 Query: 182 HGGEVVAAEKAMKGGLQEKLRMTVAVPLLWGVPPAAETLHLAVKSGGGIVDKVYWQWDFL 241 HGGEVVAAEKA KGGL EKL MTVAVPLLWGVPPA+ETLHLAV+SGGGIV+K+YWQWDFL Sbjct: 116 HGGEVVAAEKASKGGLHEKLTMTVAVPLLWGVPPASETLHLAVRSGGGIVEKIYWQWDFL 175 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6233 (164 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91041825 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18919 (282 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 209 5e-56 >Vv31003 Length = 427 Score = 209 bits (532), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 108/250 (43%), Positives = 159/250 (63%), Gaps = 3/250 (1%) Query: 7 IAVKVLTSNSYQGKREFSNEVTLLSRIHHRNLVQFLGYCQEDGRSMLIYEFMHNGTLKEH 66 +A+K L N QG REF EV LS + H NLV+ +GYC E + +L+YE+M G+L+ H Sbjct: 137 VAIKQLDRNGLQGIREFFVEVLTLSSVDHPNLVKLIGYCAEGDQRLLVYEYMPLGSLENH 196 Query: 67 LYGPLTHEQSINWIKRLEIAEDAAKGIEYLHTGCVPAIIHRDLKSSNILIDKHMRAKVSD 126 L+ + ++W R++IA AAKG+EYLH P +I+RDLK SNIL+ + K+SD Sbjct: 197 LHDLPPGTKPLDWNSRMKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSD 256 Query: 127 FGLSKLAVDG-ASHVSSIVRGTVGYLDPEYYISQQLTDKSDVYSFGVILLELISGQEAIS 185 FGL+K+ G +HVS+ V GT GY P+Y ++ QLT KSD+YSF V+LLELI+G++AI Sbjct: 257 FGLAKVGPTGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFRVVLLELITGRKAID 316 Query: 186 NENFGVNCRNIVQWAK-LHIESGDIQGIIDPSLDGEYDIQSMWKIAEKALMCVQAHGFMR 244 N G +N+V WA+ L + + DP L G+Y ++ +++ A MCVQ MR Sbjct: 317 NSK-GAREQNLVAWARPLFKDRRKFSQMADPLLHGQYPVRGLYQALAIAAMCVQEQPNMR 375 Query: 245 PSMSEVLKEI 254 P +++V+ + Sbjct: 376 PLIADVVTAL 385 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226768527 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25470 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30395 (274 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2866 424 e-121 >Vv2866 Length = 318 Score = 424 bits (1091), Expect = e-121, Method: Compositional matrix adjust. Identities = 200/278 (71%), Positives = 230/278 (82%), Gaps = 4/278 (1%) Query: 1 MSTDLLDTVDKMTKDHYKKTMEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNI 60 +S + +D V+K+TK HY+K MEQRFKE+VAAK L+ VQ+EI D+DWESTFFLRHLP SN+ Sbjct: 41 ISHEQMDAVEKLTKGHYRKCMEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNV 100 Query: 61 SEIPDLEEEYRKTMKEFAVXXXXXXXXXXXXXXXXXXXXXGYLKKVFYGSKGPNFGTKVS 120 S+ PDL+EEYRK MK+FA+ GYLKK F+GSKGPNFGTKVS Sbjct: 101 SDFPDLDEEYRKVMKDFALKLEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVS 160 Query: 121 NYPPCPKPDLIKGLRAHSDAGGIILLFQDDKVSGLQLLKDGEWVDVPPMHHSIVINLGDQ 180 NYPPCPKPDLIKGLRAH+DAGGIILLFQDD VSGLQLLKDG+WVDVPPM HSIV+NLGDQ Sbjct: 161 NYPPCPKPDLIKGLRAHTDAGGIILLFQDDTVSGLQLLKDGQWVDVPPMRHSIVVNLGDQ 220 Query: 181 IEVITNGKYKSVMHRVIAQSDGTRMSIASFYNPGNDSFISPAPAVLEKKTEDAPTYPKFV 240 +EVITNGKYKSV+HRV+AQ+DG RMSIASFYNPGND+ I PAPA+LEK+ E+ YPKFV Sbjct: 221 LEVITNGKYKSVLHRVVAQTDGNRMSIASFYNPGNDAVIYPAPALLEKEAENDQVYPKFV 280 Query: 241 FDDYMKLYSGLKFQAKEPRFEAMKAKEST----PVATA 274 FDDYMKLYSGLKFQAKEPRFEAMK E++ P+ATA Sbjct: 281 FDDYMKLYSGLKFQAKEPRFEAMKNVEASVNMGPIATA 318 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31678 (529 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7066 (217 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27492 (202 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv40998 231 5e-63 >Vv40998 Length = 212 Score = 231 bits (590), Expect = 5e-63, Method: Compositional matrix adjust. Identities = 109/198 (55%), Positives = 149/198 (75%), Gaps = 1/198 (0%) Query: 6 PLRKIAEAFKELEAAVNS-PAADVEVAPFSHACSLVSPLFGCLGIAFKFAEMDYVAKVHD 64 PL +AEAF+EL V + P+ + + F ACSLVS LFGCLGIAFKFAE++YV+K+ D Sbjct: 15 PLAAMAEAFEELSKLVKTCPSYHLRLITFCDACSLVSVLFGCLGIAFKFAELEYVSKIRD 74 Query: 65 LSEASDSISTLQVLLDRDIEADCVRKAGSHSRNLLRVKRGIDMVRVLFEQIIVTKGNSLK 124 L EAS + TL+ ++DRDIE + VR AGSHSRNL RV++G+D++R LFEQ +++ SL+ Sbjct: 75 LLEASKTYDTLEDIIDRDIENNTVRSAGSHSRNLRRVRQGLDLIRALFEQFLLSDDFSLR 134 Query: 125 DPASKAYAQVFAPHHGWVIRKAVAAGMYALPTREQLMNKLNEDDNSAKVQMQSYIAASAP 184 + AS AY+QV AP+H W +R AV+AGMYALP REQL+ +LNE+ SA+ QM+ YI AS P Sbjct: 135 EAASAAYSQVCAPYHTWAVRTAVSAGMYALPVREQLLVRLNENGQSAEKQMRRYINASLP 194 Query: 185 LSLYIDKLFHSRKLGVDW 202 + YID+L+ +R + +DW Sbjct: 195 VIAYIDELYMARNISLDW 212 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226752822 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31491 (255 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31834 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv42304 85 6e-19 >Vv42304 Length = 364 Score = 85.1 bits (209), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 51/138 (36%), Positives = 78/138 (56%), Gaps = 5/138 (3%) Query: 1 MNPKIADFGLARIFTHTELEANTSRIVGTLGYMPPETIEGR--VSVKTDVYSFGVLILEI 58 P IADFGLAR + +T ++ GT+GYMPPE EG +VK DVYSFG+L++EI Sbjct: 223 FEPHIADFGLARRIEWSHSHVST-QVAGTMGYMPPEYREGVTVATVKADVYSFGILMIEI 281 Query: 59 IRGRKINRLCNDDGL-LNLVGYAWELWKKNAALELKDPTLG-DSCNGNQLLRCIHISLLC 116 GR+ N DG + +V +A ++ + +E+ D + + N++ I+ LC Sbjct: 282 ATGRRPNLPTRLDGTDVGIVQWARKMVAQERHMEMVDSNVSREGLRENEVRELFRIAHLC 341 Query: 117 VEENAADRPTMSDVISML 134 E + DRP +S V+ +L Sbjct: 342 TSEISRDRPPISLVVDLL 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8613 (612 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27666 929 0.0 >Vv27666 Length = 612 Score = 929 bits (2401), Expect = 0.0, Method: Compositional matrix adjust. Identities = 467/620 (75%), Positives = 513/620 (82%), Gaps = 19/620 (3%) Query: 3 RGRADGIPKKRLVTSVLVLVIICGLLYLY--SKKNGSSGLEYGSK-IRKFGSTYLGADED 59 RGRADG ++RL+ S+ V+ I LY+Y S LEYGS+ +RK G L D+D Sbjct: 2 RGRADGSQRRRLLPSLCVVAIFLVFLYVYHGSIFGSQKALEYGSRSLRKLG---LTGDDD 58 Query: 60 ------VDESPPKLG-EDEEDGVILKSIPVCDDRHSELIPCLDRNLIYETRLKLDLSVME 112 +DES K G ED ED V+ KSIPVCDDRHSELIPCLDRNLIY+ RLKLDLS+ME Sbjct: 59 ADLGSKLDESSSKFGQEDGEDDVMPKSIPVCDDRHSELIPCLDRNLIYQMRLKLDLSLME 118 Query: 113 HYERHCPVPERRYNCLXXXXXXXXXXXXXXXSRDEVWKANIPHTHLATEKSDQKWMVVKG 172 HYERHCP+PERRYNCL SRDEVWKANIPHTHLA EKSDQ WMVVKG Sbjct: 119 HYERHCPLPERRYNCLIPPPAGYKIPIKWPKSRDEVWKANIPHTHLAHEKSDQNWMVVKG 178 Query: 173 EKIGFPGGGTHFHYGADKYIASMAXXXXXXXXXXXXGGSLRTVLDVGCGVASFGGYLLSS 232 EKI FPGGGTHFHYGADKYIAS+A GG +RTV DVGCGVASFG YLLSS Sbjct: 179 EKIVFPGGGTHFHYGADKYIASLANMLNFSNNNLNNGGRIRTVFDVGCGVASFGAYLLSS 238 Query: 233 DIIAMSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRD 292 DII MSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRD Sbjct: 239 DIITMSLAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRD 298 Query: 293 GILLLELDRVLRPGGYFAYSSPEAYAQDEEDLKIWKAMSALVERMCWKIASKRNQTVIWV 352 GILLLELDR+LRPGGYFAYSSPEAYAQDEEDL+IW+ MSALVERMCW+IASKRNQTVIW Sbjct: 299 GILLLELDRLLRPGGYFAYSSPEAYAQDEEDLRIWREMSALVERMCWRIASKRNQTVIWQ 358 Query: 353 KPLTNDCYMERPPGTQPPLCRSDDDPDAVYNVKMEACITPYSEQNHRARGSGLAPWPARL 412 KPLTNDCYMER PGTQPPLCRSDDDPDAV+ V MEACITPYS+ +H++RGS LAPWPAR Sbjct: 359 KPLTNDCYMERAPGTQPPLCRSDDDPDAVWGVPMEACITPYSDHDHKSRGSELAPWPARA 418 Query: 413 TTPPPRLGDFGYSSDIFEKDMEVWQQRVENYWNLLSPKISSDTIRNVMDMKANLGSFAGA 472 T PPPRL DFGYS DIFEKD EVW QRVE+YWNLLSPKI+SDT+RN+MDMKANLGSFA A Sbjct: 419 TAPPPRLADFGYSKDIFEKDTEVWMQRVESYWNLLSPKITSDTLRNLMDMKANLGSFAAA 478 Query: 473 LKNKDVWVMNVVPEDGPNTLKIIYDRGLIGSVHNWCEAYSTYPRTYDLLHAWTVFSDIER 532 LK KDVWVMNVVPEDGPNTLK+IYDRGLIG++HNWCEA+STYPRTYDLLHAWTVFSDIE+ Sbjct: 479 LKGKDVWVMNVVPEDGPNTLKLIYDRGLIGTIHNWCEAFSTYPRTYDLLHAWTVFSDIEK 538 Query: 533 KECSGVDLLIEMDRILRPKGFIIVRDKRKVVEFINKYMKALHWEAVATADAEGGSELDDD 592 K CS DLLIEMDRILRP GF+I+RDK V+EF+ KY+ ALHWEAV+ + +G D+ Sbjct: 539 KGCSAEDLLIEMDRILRPTGFVIIRDKPSVIEFVKKYLTALHWEAVSN-ERDG-----DE 592 Query: 593 VVFIIQKKIWRTSESFRNVE 612 +VF+IQKKIW TSES R+ E Sbjct: 593 LVFLIQKKIWLTSESLRDTE 612 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3830 (92 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32140 (294 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91020211 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25516 (301 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22624 (280 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25883 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48388896 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30236 (185 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226766586 (181 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55037 59 6e-11 >Vv55037 Length = 444 Score = 58.9 bits (141), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 24/51 (47%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Query: 77 VYDVTKFLEDHPGGDDVLVSATGKDATDDFEDVGHSDNARDMLKDFYVGEI 127 VYD T+FL+DHPGG D ++ G D T++F+ + HSD A+ +L+D+ +GE+ Sbjct: 95 VYDCTRFLKDHPGGTDSILINAGTDCTEEFDAI-HSDKAKKLLEDYRIGEL 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13408 (385 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46595162 (76 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31441 (441 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27666 264 2e-72 >Vv27666 Length = 612 Score = 264 bits (675), Expect = 2e-72, Method: Compositional matrix adjust. Identities = 162/458 (35%), Positives = 242/458 (52%), Gaps = 42/458 (9%) Query: 9 GPQGTRVFP-MTILFVLLCGFSFYLGGIFCSEK---------NKIEPVKVEDV---TEAV 55 G Q R+ P + ++ + L Y G IF S+K K+ +D ++ Sbjct: 7 GSQRRRLLPSLCVVAIFLVFLYVYHGSIFGSQKALEYGSRSLRKLGLTGDDDADLGSKLD 66 Query: 56 QSSLQ---------LKPVTFAECSSDYQDYTPCTDP----RRWRKYGVHRLTFMERHCPP 102 +SS + + P + C + + PC D + K + + ERHCP Sbjct: 67 ESSSKFGQEDGEDDVMPKSIPVCDDRHSELIPCLDRNLIYQMRLKLDLSLMEHYERHCPL 126 Query: 103 VLERKECLVPPPDGYKPPIRWPNSRDECWYRNVPYDWINKQKSNQNWLRKEGEKFLFPGG 162 R CL+PPP GYK PI+WP SRDE W N+P+ + +KS+QNW+ +GEK +FPGG Sbjct: 127 PERRYNCLIPPPAGYKIPIKWPKSRDEVWKANIPHTHLAHEKSDQNWMVVKGEKIVFPGG 186 Query: 163 GTMFPRGVSAYVDLMQDLIPEMKD-----GTVRTAIDTGCGVASWGGDLLDRGILTVSLA 217 GT F G Y+ + +++ + G +RT D GCGVAS+G LL I+T+SLA Sbjct: 187 GTHFHYGADKYIASLANMLNFSNNNLNNGGRIRTVFDVGCGVASFGAYLLSSDIITMSLA 246 Query: 218 PRDNHEAQVQFALERGIPAILGIISTQRLPFPSNSFDMAHCSRCLIPWTEFGGIYLLEVH 277 P D H+ Q+QFALERGIPA LG++ T+RLP+PS SF++AHCSRC I W + GI LLE+ Sbjct: 247 PNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGILLLELD 306 Query: 278 RILRPGGFWVLSGPPVNYENRWRGWNTTIEEQKSDYEKLQDLLTSLCFKLYNKKDDIAVW 337 R+LRPGG++ S P ++ EE + ++ L+ +C+++ +K++ +W Sbjct: 307 RLLRPGGYFAYSSPEAYAQD---------EEDLRIWREMSALVERMCWRIASKRNQTVIW 357 Query: 338 QKLSDSSCYNKLSEPDTYPAKCDDSLEPDSGWYTPLRSCVVVPDPKLKKSALKSIPQWPE 397 QK + CY + + P T P C +PD+ W P+ +C+ KS + WP Sbjct: 358 QKPLTNDCYMERA-PGTQPPLCRSDDDPDAVWGVPMEACITPYSDHDHKSRGSELAPWPA 416 Query: 398 RLHVAPERISDVHGGSASAFKHDDSKWRVRLKHYKKLL 435 R P R++D G S F+ D W R++ Y LL Sbjct: 417 RATAPPPRLADF-GYSKDIFEKDTEVWMQRVESYWNLL 453 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12295 (403 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29128 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2098 149 1e-38 >Vv2098 Length = 118 Score = 149 bits (377), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 79/120 (65%), Positives = 92/120 (76%), Gaps = 4/120 (3%) Query: 1 MEVAMEKLEDDLFFADLTKQISLLIMDDEEDPIATCPSVSLQAFSCAIHPPAHPALLYEQ 60 MEVAME +EDDLFF DL+KQISLLIMDD+EDP+A CPSVSLQAFS IHP +L++Q Sbjct: 1 MEVAME-IEDDLFFQDLSKQISLLIMDDDEDPVARCPSVSLQAFSRVIHPSTQYPILHDQ 59 Query: 61 SCRRETKGTGVFIPQSIRPRRKHRQGRFASYKTKSHRSSQADHNKTMVSQASSDCAFRPK 120 +CRRE+KGTGVFIP+S +PRRK+RQGRF S TKS R Q D N VS S +F PK Sbjct: 60 NCRRESKGTGVFIPRSSQPRRKNRQGRFNSSNTKSQR--QPD-NTRGVSHLSYKNSFNPK 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29772 (363 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8 (262 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv54183 278 7e-77 >Vv54183 Length = 204 Score = 278 bits (711), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 131/203 (64%), Positives = 158/203 (77%) Query: 59 LVKFRPEFSHYVYFCLDIYLSISVIESLMMVVASLVPNFXXXXXXXXXXXXXXXXXSGFF 118 +VKFR EFSHYV+FCL+++ I+V+ES MMVVASLVPNF SGFF Sbjct: 1 MVKFRSEFSHYVFFCLNLFSCIAVVESCMMVVASLVPNFLMGIITGAGLIGIMMMTSGFF 60 Query: 119 RLLPDLPKPFWRYPISYIGYGSWALQGSYKNDLIGLEFEPMTPGEPKLTGEYIIRHIFGI 178 RLL DLPKPFWRYP+SYI YG+W LQG+YKNDLIGLEFEP+ G+PKL G II ++ GI Sbjct: 61 RLLSDLPKPFWRYPVSYISYGAWGLQGAYKNDLIGLEFEPLISGDPKLKGSEIITNMLGI 120 Query: 179 PIDHSKWWDLAAVFAILIIYRVLFFLILKFKESALPVFQSLYAKRTLHRLDKRPSFRKLP 238 +DHSKWWDL A+F ILI YR++FFLILKFKE A P F++LY+ RT+ +L++RPSF P Sbjct: 121 QLDHSKWWDLTALFIILISYRLIFFLILKFKERAWPYFRTLYSNRTIQQLNRRPSFHTKP 180 Query: 239 SISSKRHQALHSLSSQEGLNSPL 261 S SKRHQALHSLSSQEGL+SP+ Sbjct: 181 SFPSKRHQALHSLSSQEGLSSPI 203 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226809872 (85 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11638 (66 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48278324 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24234 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27882 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24436 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14001 277 7e-77 >Vv14001 Length = 152 Score = 277 bits (709), Expect = 7e-77, Method: Compositional matrix adjust. Identities = 136/152 (89%), Positives = 137/152 (90%) Query: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS Sbjct: 1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELS 60 Query: 61 AAELDTLMTIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 AAEL+ LM IVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH Sbjct: 61 AAELENLMVIVANPRQFKIPDWFLNRKKDYKDGRYSQVVSNALDMKLRDDLERLKKIRNH 120 Query: 121 RGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 152 RGLRHYWGLRVRGQH SKKR Sbjct: 121 RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48126970 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46992020 (120 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7991 (241 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36508 340 2e-95 >Vv36508 Length = 242 Score = 340 bits (871), Expect = 2e-95, Method: Compositional matrix adjust. Identities = 170/243 (69%), Positives = 197/243 (81%), Gaps = 5/243 (2%) Query: 1 MAALTLS---IGIATTSSALLKXXXXXXXXXXXISCIGWDPEGVLGPPQTGHLARIEFKR 57 MAAL +S IG T + + + ISC+GWDPEG+ G P TGH+AR+EFKR Sbjct: 1 MAALGISSAAIGFNTIT--IFRTKSAPRRLRTKISCVGWDPEGLFGSPNTGHIARLEFKR 58 Query: 58 RLEKDADAREEFERQVIEEKERRRTVRESRVAPDTAEELIEYFLNTEAREIEFEISRLRP 117 RLEKDADARE F+R V+EEKERR+ +R+SRV PDT EELIEYFL+TEA+E EFEI+R+R Sbjct: 59 RLEKDADAREAFQRHVLEEKERRQALRQSRVIPDTPEELIEYFLDTEAQEFEFEIARMRH 118 Query: 118 RLDKEFFSHLQYELGQLRFAVSKTQDIEDRLIELEALQKALQEGTEAYDKMQTDLIKAKL 177 RLDK+FFSHLQ ELGQLRF+VSKT+++EDRLIELEALQKAL EGTEAYDKMQ DLI AK Sbjct: 119 RLDKDFFSHLQSELGQLRFSVSKTEEMEDRLIELEALQKALLEGTEAYDKMQADLITAKE 178 Query: 178 SLTKVLSSKDVKSTLLEMVEHNELNRSFLTLLDENIANAHKGNQKQAAEFMEKVRGAVLK 237 SLTK+L+SKDVK+TLLEMVE NELNRS L LLDENIA+A QKQA FMEK+R AVLK Sbjct: 179 SLTKILTSKDVKATLLEMVEKNELNRSLLALLDENIASAQSSEQKQAVAFMEKLRAAVLK 238 Query: 238 YIT 240 YIT Sbjct: 239 YIT 241 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789991 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6626 100 7e-24 >Vv6626 Length = 210 Score = 100 bits (250), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 46/85 (54%), Positives = 64/85 (75%) Query: 1 MMREKIQIKKIDYLPARQVTFSKRRRGIFKKAGELSVLCDSEVAIIIFSQTGKLFDFSSS 60 M+R KIQ+++I+ +RQVTFSKRR G+ KKA ELSVLCD+EVA+IIFSQ G+L++FSSS Sbjct: 1 MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSS 60 Query: 61 STKDVIARYNSRTGRENSDQPTLDQ 85 + + I RY + ++ P L+Q Sbjct: 61 NMQSAIERYREHAKQVETNNPELEQ 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11079 (285 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20290 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32859 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761629 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 55858404 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28657 (174 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18163 (236 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48280500 (162 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226814092 (140 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18003 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18692 (209 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18802 (63 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226746226 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29059 (329 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv4834 430 e-122 >Vv4834 Length = 227 Score = 430 bits (1105), Expect = e-122, Method: Compositional matrix adjust. Identities = 206/227 (90%), Positives = 218/227 (96%) Query: 102 IKNAETLAVPSVRNDAAFLFTVVGTTGFLGLLAGQLPGDWGFFVPYLLGSISLIVLGVGS 161 +KNAE LA+PSVRNDAAFLFTVVGTTGFLG+LAGQLPGDWGFFVPYL+GSISLIVL +GS Sbjct: 1 MKNAENLAIPSVRNDAAFLFTVVGTTGFLGVLAGQLPGDWGFFVPYLIGSISLIVLAIGS 60 Query: 162 TAPGLLQAAISGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER 221 +PGLLQ AI GFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER Sbjct: 61 ISPGLLQVAIGGFSSFFPDYQERIARHEAAHFLVAYLLGLPILGYSLDIGKEHVNLIDER 120 Query: 222 LEKLIYSGQLDAKELDRLAVVAMAGLAAEGLKYDKVIGQSADLFTLQRFINRSKPQLSKD 281 LEKLIYSGQLD KELDRLAVVAMAGLAAEGL+YDKV+GQSADLFTLQRFINRSKPQLSKD Sbjct: 121 LEKLIYSGQLDTKELDRLAVVAMAGLAAEGLQYDKVVGQSADLFTLQRFINRSKPQLSKD 180 Query: 282 QQQNLTRWAVLFAGSLLKNDKVIHEALITAMSNKATILECIEAIEKA 328 QQQNLTRWAVLFAGSL+KN+K IHEAL+TAMS K T+LECIEAIEKA Sbjct: 181 QQQNLTRWAVLFAGSLIKNNKAIHEALMTAMSKKGTVLECIEAIEKA 227 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28992 (832 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv30823 72 3e-14 >Vv30823 Length = 277 Score = 72.4 bits (176), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 64/279 (22%), Positives = 127/279 (45%), Gaps = 10/279 (3%) Query: 531 VDKYKVSIFYTAPTLVRSLMRDSDEYVTRYSRKSLRVLGSVGEPINPSAWKWVFNVVGDS 590 + KY+ + P ++ +L+ +D+ +Y SL+ S G P++ + Sbjct: 8 ISKYRATCLPLVPPILVALVHSADKIKAKYDLNSLQSTLSGGAPLSKEVIEGFAEKYPSV 67 Query: 591 KCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGVQAVIVDE-KGVEIEGECSGYL 649 K I + TE+ G + ++ G+A ++A IVD G + +G L Sbjct: 68 K--ILQGYGLTESTGIGASTDSLEESRRYGTAGLLSPSMEAKIVDPGSGKALTVNQTGEL 125 Query: 650 CVKSSWPGAFRTLYGDHERYETTYFKPFPGYYFSGDGCSRDKDGYHWLTGRVDDVINVSG 709 ++ P + + + E TT G+ +GD C D DG+ ++ R+ ++I G Sbjct: 126 WLRG--PTIMKGYFSNPE--ATTSTLDSSGWLRTGDLCYIDDDGFIFIVDRLKELIKYKG 181 Query: 710 HRIGTAEVESALVSHPQCXXXXXXXXXXXXKGQGIYAFVTLVEGVPYSEELRKSLILAVR 769 +++ AE+E+ L++HP+ GQ A++ G SE +++ + Sbjct: 182 YQVPPAELEALLLTHPEIADAAVIPFPDKEVGQYPMAYINRKAGSNLSES---AVMDFIA 238 Query: 770 KQIGPFAAPDKIHWAPGLPKTRSGKIMRRILRKIASRQL 808 KQ+ P+ ++ + +PK SGKI+R+ L ++A+ +L Sbjct: 239 KQVAPYKRIRRVAFVDSIPKNASGKILRKDLIQLATSKL 277 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22855 (237 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18766263 152 7e-39 >Vv18766263 Length = 296 Score = 152 bits (383), Expect = 7e-39, Method: Compositional matrix adjust. Identities = 74/96 (77%), Positives = 81/96 (84%) Query: 1 MSAGKLDMAEECLKHAMDXXXXXXXXXXXXDAEGISRLAVLAKEQGKNNVAFLCLFMLGR 60 MS GKL+MAEECLKHAMD DA+GIS+LA LAKEQGKNNVAFLCLFMLG+ Sbjct: 197 MSTGKLEMAEECLKHAMDLSGLLLLYSSLGDADGISKLASLAKEQGKNNVAFLCLFMLGK 256 Query: 61 LEECLELLVESNRIPEAALMARSYLPGKVSEIVAIW 96 LEECL+LLV+SNRIPEAALMARSYLP KVSEIVA+W Sbjct: 257 LEECLQLLVDSNRIPEAALMARSYLPSKVSEIVALW 292 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226756907 (114 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27480 183 6e-49 >Vv27480 Length = 93 Score = 183 bits (465), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 87/89 (97%), Positives = 89/89 (100%) Query: 22 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 81 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY Sbjct: 1 MVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHY 60 Query: 82 FQNTQGLIFVVDSNDRDRVVEARDELHRM 110 FQNTQGLIFVVDSNDRDRVVEARDELH++ Sbjct: 61 FQNTQGLIFVVDSNDRDRVVEARDELHKI 89 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4316 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53065 195 3e-52 >Vv53065 Length = 166 Score = 195 bits (495), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 96/129 (74%), Positives = 100/129 (77%) Query: 8 KRKPVFKKVDQLKPDTKGHTLXXXXXXXXXXXQKARPDGIQVRQVRIAECLVGDETGTII 67 KRKPVF KVDQLKP T GHTL QK R +R RIAECLVGDETG II Sbjct: 37 KRKPVFTKVDQLKPGTGGHTLTVKVVSSKTVLQKGRSVSQHLRHTRIAECLVGDETGAII 96 Query: 68 FTARNDQVDLMTTGATVILRNAKIDMFKGSMRLAVDKWGRVEVTEPASFSVKEDNNLSLV 127 FTARNDQVD+M GATVILRNAKIDMFKGSMRLAVDKWGRVEVTE A+F VKE NNLSLV Sbjct: 97 FTARNDQVDMMKAGATVILRNAKIDMFKGSMRLAVDKWGRVEVTEDANFVVKEQNNLSLV 156 Query: 128 EYELINVNE 136 EYEL+NV E Sbjct: 157 EYELVNVLE 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7291 (257 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18083 (316 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9863 136 6e-34 >Vv9863 Length = 332 Score = 136 bits (342), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 89/275 (32%), Positives = 137/275 (49%), Gaps = 17/275 (6%) Query: 13 LAAKIGEACRTWGFFTVINHGVPSDIRRRIMEASRKFFALPLEEKKKVSREAHNTAGF-- 70 L +I +AC WGFF + +HG+ + ++ E +FF P EEK+K + + +T F Sbjct: 53 LVKEIYKACSEWGFFLLKDHGISPGLIEKLQEVGIEFFKQPQEEKEKYANDP-STGKFEG 111 Query: 71 HNDEHSKDFKDWKEVYDFYVNDGMLMPASHEPDDPEIVPWYTPWPENLSKFRETCEEYGR 130 + + +K+ + E D++ + ++ P S+ + WP+ S +RE E Y + Sbjct: 112 YGTKMTKNLDEKVEWVDYFFH--LMSPPSNVN--------HQIWPQTPSSYREVTEVYNK 161 Query: 131 ACEKXXXXXXXXXXXXXXXPPTRLHGYF--ENQASFARLNYYAPCPKPDLVLGTGGHRDP 188 K L + + ++N Y PCP+P L LG H D Sbjct: 162 ELLKVTDTLLELLSEGLGLEGKVLKSHVGGDEIELEMKINMYPPCPQPQLALGVEPHTDM 221 Query: 189 SALTVLAQEDVEGLDVLRKSDGAWVRVKPVPDSFVINVGDVLQVWSNDLYESVEHRAMVH 248 SALT+L DV GL V + D WV V +P++ ++VGD ++V SN Y+SV HR+ V+ Sbjct: 222 SALTLLVPNDVPGLQVWK--DDYWVAVDYLPNALFVHVGDQIEVLSNGKYKSVLHRSTVN 279 Query: 249 AETERYSIPIFFHPSHDITMKPLDELVDERSPAKY 283 E R S +F P H + PL ELVDE +PAKY Sbjct: 280 KERTRMSWAVFCAPPHKAMIGPLPELVDEPNPAKY 314 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig30449 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31420 (330 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12502 127 2e-31 >Vv12502 Length = 228 Score = 127 bits (320), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 65/101 (64%), Positives = 77/101 (76%) Query: 36 FQSMLEGLDEDGCVEEAGRVSEKKRRLNVEQVKALEKNFEVENKLEPERKVKLAQELGLQ 95 FQ++ E + D E EKKRRL QV+ LE+NFEVENKLEPERK +LA+ELGLQ Sbjct: 64 FQTLHEEENGDEDFEGCFHRPEKKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQ 123 Query: 96 PRQVSVWFQNRRARWKTKQLERDYGVLKADYDSLKCSYDIL 136 PRQV++WFQNRRAR+KTKQLE+DY LKA YDSLK YD + Sbjct: 124 PRQVAIWFQNRRARFKTKQLEKDYDSLKASYDSLKADYDCI 164 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71812598 (122 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14009 (203 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv5751 127 2e-31 >Vv5751 Length = 94 Score = 127 bits (318), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 57/94 (60%), Positives = 75/94 (79%) Query: 43 MTIKEGAFTVSDVNGNLMFNIKGSLFSLHDRRVLVDNAGNPIVSFRQKIMTAHRRWQVYR 102 MTI +G F V+DVNG+++ +KG+L SL D RVL+D AG PIVS + K+++ HRRW+V+R Sbjct: 1 MTISDGNFAVTDVNGSVIIKVKGTLLSLRDHRVLLDAAGKPIVSLQSKMLSMHRRWKVFR 60 Query: 103 GESSDSKDLLFSAKKASLLQFKTELDVFLAGNTK 136 GESSD KDLLFS K +S++Q KT L+VFLA NTK Sbjct: 61 GESSDPKDLLFSTKLSSIIQLKTALNVFLAANTK 94 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18371 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28458 (350 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25687 (244 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14838 (316 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22204 (302 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5247 (235 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24758 (354 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58117 495 e-142 >Vv58117 Length = 516 Score = 495 bits (1275), Expect = e-142, Method: Compositional matrix adjust. Identities = 256/352 (72%), Positives = 290/352 (82%), Gaps = 6/352 (1%) Query: 1 MAPXXXXXXXXXXXXPNPSRATNLKNPRLSVFAKRAGPLSAFRFGKSGDDGSVSDEGQAD 60 MAP P+P R T LKNP L V+AKRAGPLSAFR GK D S +E Q + Sbjct: 1 MAPTLTSNSFLLTTPPHP-RLT-LKNPSLRVYAKRAGPLSAFRLGKQSDGPS--EESQEN 56 Query: 61 DSTNSSPFRFNFGKMPDVKSLVPVVSRPSLGLSFGNQRAKDPGTVFVAGATGQAGVRIAQ 120 S NS+PF FNFGK+ DV SL+PV+++PS GLSFG R KDPGTVFVAGATGQAG+RIAQ Sbjct: 57 GSANSAPFSFNFGKVSDVSSLIPVMTKPSSGLSFG--RRKDPGTVFVAGATGQAGIRIAQ 114 Query: 121 TLLREGFSVRAGVPELGAAQELARVASKYKIISNEESKRLNAVESVFQDAESIAKAIGNA 180 LLREGFSVRAGV +LGAAQELAR+ +KYKIISNEESKRLNAVES FQDAESIAKAIGNA Sbjct: 115 ALLREGFSVRAGVSDLGAAQELARLGAKYKIISNEESKRLNAVESSFQDAESIAKAIGNA 174 Query: 181 SKVVVTIGPAENGPTTEVTPFDALQVIQAAQLAGVGHVAIIYDGNSVGSSTNNVLDGISS 240 SKVVVTIGP ENGPT EVTP DALQVIQAA LAGVGHVAIIYD + SST NV+DGIS+ Sbjct: 175 SKVVVTIGPGENGPTAEVTPLDALQVIQAADLAGVGHVAIIYDESPFVSSTYNVIDGIST 234 Query: 241 FFNNLFSQTQLLTVAEFLQKVIEMDVSYTFIKTSLTEDFSPESSYNIVMSAEGGGGANDY 300 FFNNLFS++Q LTV EFLQKV+E DVSYT I+T+LTEDFSPESSYN+V+SAEG +NDY Sbjct: 235 FFNNLFSRSQPLTVTEFLQKVVETDVSYTLIRTNLTEDFSPESSYNVVVSAEGSVSSNDY 294 Query: 301 KVAKSQIAALVADVFSNTSMAENKVVEVYTDPSAPMRPVDQLFGTIPEDGRR 352 KVA SQIA+LVA+VFSNT++AENKVV+V+TDP AP +P +LF IP+DGRR Sbjct: 295 KVATSQIASLVANVFSNTAVAENKVVKVFTDPGAPSKPAVELFSAIPKDGRR 346 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414076 (145 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31944 (143 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14666265 140 1e-35 >Vv14666265 Length = 116 Score = 140 bits (353), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 81/116 (69%), Positives = 88/116 (75%), Gaps = 7/116 (6%) Query: 1 MAVSMATASTVIGLGSSSLSP------NRTCLTSGFVK-PIVVGNPLRQVRASGGRFTCF 53 MA +MA AS VIGLGSSSLSP RT L SGFVK P+ NPLRQ +A GG+FTCF Sbjct: 1 MATTMAAASRVIGLGSSSLSPARSSSSKRTHLASGFVKAPVAPRNPLRQAKACGGKFTCF 60 Query: 54 QRDWLRRDLNVIGFGLIGWLAPSSIPLIDGKSLTGLFFESIGAELAHFPSPPALTS 109 +RDWLR DLNVIGFGLI WLAPSSIP IDG SLTGLFF SI EL+H P+ PAL S Sbjct: 61 ERDWLRTDLNVIGFGLIAWLAPSSIPAIDGNSLTGLFFSSIETELSHLPTGPALPS 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16162 (291 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226773227 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8554 (379 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27709 (155 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29757 (470 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48693757 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48206 219 2e-59 >Vv48206 Length = 194 Score = 219 bits (557), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 109/144 (75%), Positives = 120/144 (83%), Gaps = 9/144 (6%) Query: 1 MEKALTKVNSLKVGSLWISKKAKEEFSNISDDLS--------VCNSNLSTF-SNTVEEKA 51 MEKAL KV+SLK GS WIS KAKEEFSNI+ D++ +C + SNTVEEKA Sbjct: 1 MEKALMKVSSLKAGSFWISSKAKEEFSNITQDITDICFKNGLLCKQKHEKYISNTVEEKA 60 Query: 52 KWVFNKLKGKPPKSLPDLLREYNLPPGLFPQNITCYEFDETKSKLIVYMPSACEVSFKDS 111 KWVFNKLKGKP K+LPDLLREYNLPPGLFPQNITCYEFDE+K+KL VY+PSACEVSF DS Sbjct: 61 KWVFNKLKGKPLKTLPDLLREYNLPPGLFPQNITCYEFDESKAKLTVYLPSACEVSFSDS 120 Query: 112 SVMRYATRVKAILLRGKLTGIEGM 135 SV+RYATRVK ILLRGKLTGIEGM Sbjct: 121 SVIRYATRVKGILLRGKLTGIEGM 144 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20292 (56 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3705 (158 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21457 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14295 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23013 (203 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv41286 231 6e-63 >Vv41286 Length = 191 Score = 231 bits (590), Expect = 6e-63, Method: Compositional matrix adjust. Identities = 103/174 (59%), Positives = 134/174 (77%), Gaps = 1/174 (0%) Query: 31 IPHTPRVNGEIPDVNDATQDHERLSARLATYDLSELQIEGDGNCQFRALADQLFRNPEYH 90 +PH P++NGEIP +++AT DH+RL RL +DL EL+++GDGNCQFR+L+DQ++ PE+H Sbjct: 4 VPHVPKINGEIPSLDEATLDHQRLLDRLQLFDLVELKVQGDGNCQFRSLSDQVYCTPEHH 63 Query: 91 KHVRKQVIKQLKHHKKLYEAYVPMKYSRYLMKMEKTGEWGDHLTLQAAADRFGAKICLIT 150 + +R+QV+ QLK + ++YE YVPM Y YL KM KTGEWGDH+TLQAAAD +G KI +IT Sbjct: 64 QFIRQQVVNQLKSYPEIYEGYVPMAYGDYLEKMSKTGEWGDHVTLQAAADLYGVKIFVIT 123 Query: 151 SFRDTCYIEILPKDGNHARELWLSFWSEVHYNSLYASADVPS-RTPRKKHWLSF 203 SF+DTCYIEILP R + LSFW+EVHYNS+Y DVP T +KK W SF Sbjct: 124 SFKDTCYIEILPNVQRSERVMLLSFWAEVHYNSIYFKGDVPEFETKKKKRWWSF 177 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16690 (243 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56385 311 6e-87 >Vv56385 Length = 181 Score = 311 bits (798), Expect = 6e-87, Method: Compositional matrix adjust. Identities = 141/181 (77%), Positives = 161/181 (88%) Query: 63 ESIKKLEYTRLIAVESLRLFPQPPLLIRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVY 122 + + K Y RLI ESLRL+PQPPLLIRRSLK D LPGGY G KDG+++PAGTD+F+SVY Sbjct: 1 KDLYKFRYIRLIVAESLRLYPQPPLLIRRSLKSDSLPGGYKGKKDGHSIPAGTDIFLSVY 60 Query: 123 NLHRSPYFWDNPNEFEPERFLVEKKSHVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGG 182 NLHRSPYFWD P+EFEPERFLV + S +EGW+GFDPSRSPGALYPNEI+ADFAFLPFGGG Sbjct: 61 NLHRSPYFWDRPHEFEPERFLVPRNSDIEGWSGFDPSRSPGALYPNEIVADFAFLPFGGG 120 Query: 183 PRKCVGDQFALMESTVALAMLLQKFTVELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI 242 PRKCVGDQFALMEST+AL MLLQKF VELKG P+SVE VTGAT+HTKNGLWC++ KRSD+ Sbjct: 121 PRKCVGDQFALMESTIALTMLLQKFDVELKGGPESVELVTGATIHTKNGLWCRMMKRSDL 180 Query: 243 N 243 + Sbjct: 181 H 181 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6201 (190 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv9179 237 9e-65 >Vv9179 Length = 371 Score = 237 bits (605), Expect = 9e-65, Method: Compositional matrix adjust. Identities = 112/185 (60%), Positives = 137/185 (74%), Gaps = 3/185 (1%) Query: 4 EPVNVNEYQELARQALPKMYYDYYTGGAEDQHTLKENVEAFRRITLRPRILVDVSRVDMS 63 E NV EY+ +A+Q LPKM +DYY GAEDQ TL +N AF +I RPRIL+DVS++DM+ Sbjct: 2 EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61 Query: 64 TTVLGYKISAPIMLAPTAMHQLAHPEGEVXXXXXXXXCNTIMILSYMSTCTVEEVASSCN 123 TTVLG+KIS PIM+APTAM ++AHPEGE TIM LS +T +VEEVAS+ Sbjct: 62 TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121 Query: 124 AVRFFQIYVYKRRDISAQMVRRAEKNGYKAIVLTADTPRLGRREADIKNKMVAP---QLR 180 +RFFQ+YVYK R + AQ+VRRAE+ G+KAI LT DTPRLGRREADIKN+ P L+ Sbjct: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181 Query: 181 NFEGL 185 NFEGL Sbjct: 182 NFEGL 186 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48413346 (127 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16766258 103 2e-24 >Vv16766258 Length = 393 Score = 103 bits (256), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 53/77 (68%), Positives = 62/77 (80%), Gaps = 5/77 (6%) Query: 51 MFDIPMDGSKSRKSGQLTSAPSRTGSFGGAASHSGPIMPNAAARASYTTSGPVSSGGMTG 110 MFDIP+DGS+SRKSG + +APSRTGSFGGAASHSGPIM N+ R G VSS G+ G Sbjct: 1 MFDIPVDGSRSRKSGPINNAPSRTGSFGGAASHSGPIMSNSINRP-----GSVSSAGIPG 55 Query: 111 SVSIKKTNSGPLNKHGE 127 S S+KKTNSGPLN+HG+ Sbjct: 56 SASVKKTNSGPLNRHGD 72 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29184 (255 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56446 129 7e-32 >Vv56446 Length = 240 Score = 129 bits (323), Expect = 7e-32, Method: Compositional matrix adjust. Identities = 78/214 (36%), Positives = 122/214 (57%), Gaps = 11/214 (5%) Query: 4 LRHPNVVLFMGAVTRPPNLSI--ISEFLPRGSLYRIIHRPHCQIDEKRRIKMALDVARGM 61 L HPNVV F G V P S+ ++E++ GSL + + +D+++R+ +A+DVA GM Sbjct: 15 LHHPNVVAFYGVVLDGPGGSVATVTEYMVNGSLRNSLQKNEKNLDKRKRLLIAMDVAFGM 74 Query: 62 NCLHASTPTIVHRDLKSPNLLV---DKNWNV-KVCDFGLSRLKHNTFLSSKSTAGTPEWM 117 LH IVH DLKS NLLV D + + KV D GLS++K +S GT WM Sbjct: 75 EYLHGKN--IVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQPLISG-GVRGTLPWM 131 Query: 118 APEVLRNENS--NEKCDVYSFGVILWELATLKLPWSGMNPMQVVGAVGFQNRRLEIPKEL 175 APE+L +S +EK DV+SFG+++WEL T + P++ ++ ++G + R +P+ Sbjct: 132 APELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVSNTLRPSVPEFC 191 Query: 176 DPLVARIIWECWQTDPNLRPLVLTAHGSSQALAA 209 DP ++ CW ++P+ RP +++AA Sbjct: 192 DPEWRALMERCWSSEPSERPSFTEIANQLRSMAA 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32866 (129 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25664 (718 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14066262 902 0.0 >Vv14066262 Length = 475 Score = 902 bits (2332), Expect = 0.0, Method: Compositional matrix adjust. Identities = 447/475 (94%), Positives = 457/475 (96%) Query: 244 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV 303 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV Sbjct: 1 MDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLV 60 Query: 304 GPPGTGKTLLARAVAGEAGTPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFID 363 GPPGTGKTLLARAVAGEAG PFFSCAASEFVELFVGV ASRVRDLFEKAKSKAPCIVFID Sbjct: 61 GPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVRASRVRDLFEKAKSKAPCIVFID 120 Query: 364 EIDAVXXXXXXXXXXXNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG 423 EIDAV NDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG Sbjct: 121 EIDAVGRQRGAGLGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPG 180 Query: 424 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFDKIARRTPGFTGADLQNLMNEAAIL 483 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDF+KIARRTPGFTGADLQNLMNEAAIL Sbjct: 181 RFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFEKIARRTPGFTGADLQNLMNEAAIL 240 Query: 484 AARRDLKEISKDEISDALERIIAGPEKKNAVVSEDKKKLVAYHEAGHALVGALMPEYDPV 543 AARRDLKEISKDEISDALERIIAGPEKKNAVVS++KKKLVAYHEAGHALVGALMPEYDPV Sbjct: 241 AARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPV 300 Query: 544 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGQENVTTG 603 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFG++NVTTG Sbjct: 301 AKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEDNVTTG 360 Query: 604 ASSDFMQVSRVARQMVERFGFSKKIGQVAIGASGGNPFLGQQMSSQKDYSMATADVVDAE 663 AS+DFMQVSRVARQMVERFGFSKKIGQVAIG GGNPFLGQQMSSQKDYSMATAD+VDAE Sbjct: 361 ASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADIVDAE 420 Query: 664 VRELVETAYSRAKDIVTTHIDILHTLAQLLMEKETVDGEEFMSLFIDGKAELYVA 718 VRELVE AYSRAK I+TTHIDILH LAQLL+EKETVDGEEFMSLFIDGKAEL+VA Sbjct: 421 VRELVEKAYSRAKQIMTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA 475 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6452 (283 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27375 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27515 (163 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv36536 141 8e-36 >Vv36536 Length = 161 Score = 141 bits (355), Expect = 8e-36, Method: Compositional matrix adjust. Identities = 77/151 (50%), Positives = 95/151 (62%), Gaps = 12/151 (7%) Query: 12 YYSVLGVGSDSSVEEIRRAYRKLAMKWHPDRWTRTPSLLGEAKRKFQQIQEAYSVLSDQR 71 YYSVLG+ D+S +IR AYRKLA+KWHPDRW + +L GEAKR+FQQIQEAYSVLSD Sbjct: 12 YYSVLGIRRDASSSDIRTAYRKLALKWHPDRWAKNQALAGEAKRRFQQIQEAYSVLSDAS 71 Query: 72 KRSMYDVGLYXXXXXXXXXGFCDFVQEMVSLMAESRREAKSYTMEDLQAMFREMVKG--- 128 K+SMYD G Y FCDF+QEMVS+M E S +EDLQ MF +MV G Sbjct: 72 KKSMYDAGFYDPMEEDQD--FCDFMQEMVSMMNNVGDEPDS--VEDLQKMFVDMVSGDAF 127 Query: 129 ---FESPPSSFFCGQ--PVAFEQSGCSKRTR 154 F ++ F + PVA G ++R+ Sbjct: 128 NFDFNVNANAPFAPKKSPVAGSNGGAARRSN 158 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig661 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15534 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3000 (172 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5731 (329 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22090 (464 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226789661 (75 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46597440 (79 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25132 (319 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv37731 309 3e-86 >Vv37731 Length = 359 Score = 309 bits (792), Expect = 3e-86, Method: Compositional matrix adjust. Identities = 185/340 (54%), Positives = 226/340 (66%), Gaps = 44/340 (12%) Query: 6 EHDYIGLSP-----SMETSTKSD----ALNLKATELRLGLPGSQSPERDXXX--XXXXXV 54 E +Y+GLS S ST SD +LNLKATELRLGLPGS SP R+ + Sbjct: 38 ERNYMGLSECSSVDSSAISTDSDGNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKL 97 Query: 55 EEKATGFSVCGVKGL---------VSGAKRGFSDAIDGAS-GKWVFSGSGGSEVELGKGG 104 +EK F + K L VSG KRGF+DA++G S GK++ SEV + Sbjct: 98 DEKPL-FPLHPSKDLTYTSSQKTVVSGNKRGFADAMNGFSEGKFL----ANSEVNV---- 148 Query: 105 NLLSPRGVNAGKALAAGCEPSNQPTGLAGSAVKDGVQQSPKPLHEKKPQ----GSAGSTA 160 +LSPR + L + QP + A VQ+ P+ +E P G+ S+A Sbjct: 149 -MLSPRPSPNKENLGS------QPAKMKEMASPKIVQERPRATNETPPNHTGTGNNNSSA 201 Query: 161 PAAKAQVVGWPPIRSFRKNSMASVPSKNGDDAEGKMGAGCLYVKVSMDGAPYLRKVDLKT 220 PA KAQVVGWPPIRSFRKN++A+ SKN + +GK G G L+VKVSMDGAPYLRKVDL+ Sbjct: 202 PATKAQVVGWPPIRSFRKNTLATT-SKN-TEVDGKAGPGALFVKVSMDGAPYLRKVDLRN 259 Query: 221 YGSYLDLSLALEKMFSCFTIGQCGSHGAS-RDGLSESRLMDLLHGAEYVLTYEDKDGDWM 279 Y +Y +LS ALEKMFSCFTIGQ GSHGA R+ LSES+L DLLHG+EYVLTYEDKDGDWM Sbjct: 260 YSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWM 319 Query: 280 LVGDVPWEMFTDSCKRMRIMKSSEAIGLAPRAMQKCKNSN 319 LVGDVPW+MF ++CKR+RIMKS +AIGLAPRA++KCKN N Sbjct: 320 LVGDVPWQMFIETCKRLRIMKSCDAIGLAPRAVEKCKNRN 359 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28932 (323 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv28408 433 e-123 >Vv28408 Length = 382 Score = 433 bits (1114), Expect = e-123, Method: Compositional matrix adjust. Identities = 207/314 (65%), Positives = 249/314 (79%) Query: 7 IKNDVTELIGNTPLVYLNNVVDGCVARIAAKLESMEPCSSVKDRIAYSMIKDAEDKGLIT 66 I DVT+LIG TP+VYLNN+V G VA IAAKLE MEPC SVKDRI YSMI DAE +G IT Sbjct: 65 IAEDVTQLIGKTPMVYLNNIVKGSVANIAAKLEIMEPCCSVKDRIGYSMIADAEQRGAIT 124 Query: 67 PGKTVLIEATSGNTGIGLAFIAASRGYKVKLTMPSSMSIERRIVLLAFGAEVYLTDPAKG 126 PGK+ L+E TSGNTGIGLAFIAAS+GYK+ LTMP+SMS+ERR++L AFGAE+ LTDPAKG Sbjct: 125 PGKSTLVEPTSGNTGIGLAFIAASKGYKLILTMPASMSMERRVLLKAFGAELVLTDPAKG 184 Query: 127 IKGAFDKAEELLSDTPNGYILGQFENPANPKIHYETTGPEIWRDTGAKVDALVSXXXXXX 186 +KGA KAEE+L TPN Y+L QF+NPANPK+HY+TTGPEIW DT KVD ++ Sbjct: 185 MKGAVQKAEEILKSTPNAYMLQQFDNPANPKVHYQTTGPEIWEDTRGKVDIFIAGIGTGG 244 Query: 187 XXXXXXKFLKEQNPEIKVYGVEPAESPVLNGGQAGKHLIQGIGAGIIPAVLDVSLLDEVI 246 KFLK+QNP IK GVEP ES +L+GG+ G H IQGIGAG +P+ LD ++DEVI Sbjct: 245 TISGVGKFLKKQNPNIKAIGVEPLESNILSGGKPGPHKIQGIGAGFVPSNLDQDVVDEVI 304 Query: 247 QVTSEEAIDTAKQLALKEGLLVGISSGXXXXXXIKLAKRPENAGKLIVAVFPSFGERYLS 306 +++S+EA++TAKQLAL+EGLLVGISSG +K+ KRPENAGKLI VFPSFGERYLS Sbjct: 305 EISSDEAVETAKQLALQEGLLVGISSGAAAAAAMKVGKRPENAGKLIAVVFPSFGERYLS 364 Query: 307 SALFNSVRHEAENL 320 +ALF ++R E E + Sbjct: 365 TALFQTIRDECEKM 378 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8605 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46873003 (101 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10641 (343 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226799765 (77 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24216 (426 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47659 449 e-128 >Vv47659 Length = 393 Score = 449 bits (1154), Expect = e-128, Method: Compositional matrix adjust. Identities = 213/371 (57%), Positives = 273/371 (73%), Gaps = 5/371 (1%) Query: 60 SGTEKNLSTQKKEKYAYIPDNFTSIEQVTDALRREGLESSNLIVGIDFTKSNEWTGKTSF 119 +GT + + + + YI DNF S++QVTDALR GLESSNLI+GIDFTKSNEWTG+ SF Sbjct: 23 AGTSMDPDYRHRGQLPYIADNFNSLDQVTDALRESGLESSNLILGIDFTKSNEWTGRHSF 82 Query: 120 KNRSLHAIGDEPNPYEKAISIVGKTLAPFDEDNLIPCFGFGDGTTHDEGVFSFHTDHSPC 179 +SLHAI + PNPYE+AISI+G+TL+PFDEDNLIPCFGFGD +THD+ VFSF+ DH C Sbjct: 83 HRKSLHAISNTPNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDKYVFSFYPDHRYC 142 Query: 180 HGFEEVLACYKRIVPNLRLSGPTSYGPVIEAAMDIVEKSGGQYHVLVIIADGQVTRSINT 239 GFEEVLA YK IVP L+LSGPTS+ P+I+AA+DIVE S GQYHVLVIIADGQV+ S++ Sbjct: 143 RGFEEVLARYKEIVPYLKLSGPTSFAPIIDAAIDIVEGSNGQYHVLVIIADGQVSGSLDG 202 Query: 240 SDKELSPQEEKTIKSIADASFYPLSIILVGVGDGPWEDMRKFDDKIPSRDFDNFQFVNFT 299 S SPQE+ T+ SI AS YPLSIILVGVGDGPW+ M+ FDD IP R FDNFQFVNF+ Sbjct: 203 SSGRFSPQEQATVNSIVAASRYPLSIILVGVGDGPWDAMKLFDDNIPQRSFDNFQFVNFS 262 Query: 300 EIMSKRATSTEKEAAFALAALMEIPIQYKAAIELSLLGRTAGNGNR---IVXXXXXXXXX 356 +IMS+ +++KE AFAL+ALMEIP QY+A + L + G R + Sbjct: 263 KIMSENMEASKKETAFALSALMEIPFQYRATLRLQSIDNNLVGGPRTRPLPPPKEVLDHD 322 Query: 357 XXXXXTREPSGLSAPGGDERSEL--VCPICLTNPKDLAFGCGHMSCRDCGPRLSACSICR 414 + LS ++ + + VCPICLTNPK++AFGCGH++C++CG +S C +CR Sbjct: 323 REALQHMMATTLSVEAVEQTAPVDQVCPICLTNPKNMAFGCGHLTCKECGESISLCPLCR 382 Query: 415 QPIRSRLRVFA 425 +PI +RL++++ Sbjct: 383 EPINTRLKLYS 393 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5971 (318 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3302 353 2e-99 >Vv3302 Length = 652 Score = 353 bits (907), Expect = 2e-99, Method: Compositional matrix adjust. Identities = 171/295 (57%), Positives = 219/295 (74%), Gaps = 1/295 (0%) Query: 2 KAMDDAGLEKRQIDEIVLVGGSTRIPKVQQLLKDYFDGKEPNKGVNPDEAVAYGAAVQGS 61 K + DA ++K + ++VLVGGSTRIPKVQQLL+D+F+GKE K +NPDEAVAYGAAVQ + Sbjct: 325 KCLRDAKMDKSGVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAA 384 Query: 62 ILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTV 121 ILSGEG E+ +D+LLLDV PL+LG+ET GGVMT LIPRNT IPTKK QVF+TY D Q V Sbjct: 385 ILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGV 444 Query: 122 SIQVFEGERSLTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVRAEDKGTGKS 181 IQV+EGER+ T+D LGKF+L+GIPPAPRG PQI V F++DANGILNV AEDK TG+ Sbjct: 445 LIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQK 504 Query: 182 EKITITNDKGRLSQEEIDRMXXXXXXXXXXXXXXXXRIDARNSLETYVYNMKNQINDKDK 241 KITITNDKGRLS+EEI++M +++A+N+LE Y YNM+N I D +K Sbjct: 505 NKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKD-EK 563 Query: 242 LADKLESDXXXXXXXXXXXXXXWLDDNQTAEKEDYDEKLKEVEAVCNPIISAVYQ 296 + KL + WLD NQ AE +++++K+KE+E++CNPII+ +YQ Sbjct: 564 IGAKLPPEDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKELESLCNPIIAKMYQ 618 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13617 (359 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26166 64 3e-12 >Vv26166 Length = 320 Score = 64.3 bits (155), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 41/135 (30%), Positives = 71/135 (52%), Gaps = 11/135 (8%) Query: 1 MQWY-AFHKEAPG-GVDSPNGKKERLLKIFEGWCDNVIDLLLATEEDAILRRDIYDRT-- 56 + W+ F+ +PG + P+ K++ ++ W +++++ T +D I+R + DR Sbjct: 141 VYWFICFNSPSPGPKITDPSVLKKQARELVRNWPSELLNIIDLTPDDTIIRTPLVDRWLW 200 Query: 57 PILT--WGKGHVTLLGDSVHAMQPNMGQGGCMAIEDGYQLAMELDKAWQKSSESGTPIDI 114 P ++ G V L+GD+ H M PN+GQG C A+ED LA +L A + ES + Sbjct: 201 PAISPPASSGGVVLVGDAWHPMTPNLGQGACCALEDAVVLAKKLSDALRLGPES-----V 255 Query: 115 NSSLRSYENSRRLRV 129 +LR Y + R R+ Sbjct: 256 EGALRLYGSERWPRI 270 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32239 (289 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12502 72 2e-14 >Vv12502 Length = 228 Score = 71.6 bits (174), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 36/72 (50%), Positives = 48/72 (66%) Query: 145 KKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEV 204 KK RLT Q LE +F+ + L P++K LA++L L+PRQV +WFQNRRAR K KQ E Sbjct: 86 KKRRLTAGQVQFLERNFEVENKLEPERKNQLAKELGLQPRQVAIWFQNRRARFKTKQLEK 145 Query: 205 DCEFLKKCCETL 216 D + LK ++L Sbjct: 146 DYDSLKASYDSL 157 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19169 (175 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 51097873 (70 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48938679 (124 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2703 (233 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18533 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv33766 101 5e-24 >Vv33766 Length = 134 Score = 101 bits (252), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 57/134 (42%), Positives = 76/134 (56%), Gaps = 8/134 (5%) Query: 1 MKKVVLKLELYDEKCKKKVMRAVSGLEGLDSISMDMKDKKLTATGDIDPVHLVGRLRKLC 60 MKKVVLKL+L+D+K K+K M+AVS L G++SI+ DMKDKKLT GD+DPV +V +LRK Sbjct: 1 MKKVVLKLDLHDDKAKQKAMKAVSSLSGVNSIATDMKDKKLTVVGDVDPVDIVSKLRKGW 60 Query: 61 RTEIVSVGPA--------XXXXXXXXXXXXXXXXXXXXXXMLELMKXXXXXXXXXXXXXX 112 T+I++VGPA + EL+ Sbjct: 61 HTDILTVGPAKEEKKEDGKKDEGKKDEKKDGDKKKDTEKQIQELVDAYKAYNPHLTRYYH 120 Query: 113 VRSSEEDPNACVIC 126 V+S+EE+PNACVIC Sbjct: 121 VQSAEENPNACVIC 134 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91011098 (133 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48384743 (152 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4436 (98 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv23966261 64 5e-13 >Vv23966261 Length = 59 Score = 64.3 bits (155), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Query: 45 YPDLGYLENAST-ETLIAGVAPVKMFYERSEMNYGAENGCKYGSNCSYSSC 94 YPDL + E A+T ET+IAGVAPVK +E SEM GAENG K GSNCS C Sbjct: 6 YPDLSFSEGATTTETIIAGVAPVKTHFEGSEMGVGAENGWKCGSNCSCDPC 56 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4423 (75 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7532 (295 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv65230 426 e-121 >Vv65230 Length = 281 Score = 426 bits (1096), Expect = e-121, Method: Compositional matrix adjust. Identities = 203/285 (71%), Positives = 236/285 (82%), Gaps = 15/285 (5%) Query: 11 VFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNE 70 VFLL LF +++V TASA NF+QDFD+T+GD RAKI NGGQLL+L+LD+ASGSGF+SK E Sbjct: 10 VFLL-LF--AVVVATASASNFYQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKE 66 Query: 71 YLFGRIDMQIKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNSTGEPYTLHTNVFSQGK 130 YLFGRIDMQ+KLV+GNSAGTVTAYYLSS+G THDEIDFEFLGN +G+PY LHTNVF+QGK Sbjct: 67 YLFGRIDMQLKLVAGNSAGTVTAYYLSSQGSTHDEIDFEFLGNLSGDPYILHTNVFTQGK 126 Query: 131 GNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIY 190 GNREQQF+LWFDPT+ FHTYSI+W ++ IIFLVDN+PIR+F N ES GVPFPKNQPMRIY Sbjct: 127 GNREQQFYLWFDPTRNFHTYSIIWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIY 186 Query: 191 SSLWNADDWATRGGLVKTDWTQAPFTASYRNFKXXXXXXXXXXXXXXXXXXXXLTEQSAW 250 SSLWNADDWATRGGLVKTDW++APFTA YRNF+ S + Sbjct: 187 SSLWNADDWATRGGLVKTDWSKAPFTAYYRNFRANSSTPTSSF------------PDSTF 234 Query: 251 KTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTECKRSRF 295 +TQ LD+ R RLRWVQ+ FM+YNYC+DLKRFPQG+P ECKRSRF Sbjct: 235 QTQELDSYSRRRLRWVQKNFMIYNYCTDLKRFPQGVPAECKRSRF 279 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226796664 (184 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6266261 70 3e-14 >Vv6266261 Length = 425 Score = 69.7 bits (169), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 48/116 (41%), Positives = 66/116 (56%), Gaps = 23/116 (19%) Query: 84 PKDWE--GKLDKVHQLFSRVPHYNKISKQYELDFRDRGRAGLRIRSSVKNFQL---TLEE 138 P+D E GK D+ L ++ P +++ + + L+FR GR + +SVKNFQL T Sbjct: 315 PRDEEDEGK-DRPLVLRNKPPRWHEQLQCWCLNFR--GRVTV---ASVKNFQLIAATQPA 368 Query: 139 NGKQT------------ILQLGRVGKLKYVMDYRYPLTGYQAFCICLASIDSKLCC 182 G T ILQ G+VGK + MDYRYPL+ +QAF ICL+S D+KL C Sbjct: 369 AGAPTPSQPPASDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLAC 424 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7935 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14207 156 3e-40 >Vv14207 Length = 366 Score = 156 bits (394), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 72/137 (52%), Positives = 95/137 (69%) Query: 27 VDAYVNVIGEAERIKRCKGRVFALHDEPEVSRVWLPFDDAPGLAMARAFGDFCLKEYGVI 86 +D N+ EAERI +CKGRVF L DEP V RVWLP +++PGLAM+RAFGD+C+K++G+I Sbjct: 216 IDFKPNLPQEAERIIQCKGRVFCLGDEPGVHRVWLPHEESPGLAMSRAFGDYCVKDFGLI 275 Query: 87 SIPEFSHRILTDRDQFIVLASDGVWDVLSNEEVVEIXXXXXXXXXXXXXXXDSAAREWKL 146 S+PE + R +T RDQF+VLA+DGVWDV+SN+E V+I + AAR WK Sbjct: 276 SVPEVTQRNITSRDQFVVLATDGVWDVVSNQEAVQIVSSTPNRAKSAKRLVECAARAWKR 335 Query: 147 KYPTSKMDDCAVVCLFL 163 K +DD + VCLF Sbjct: 336 KRRGIAVDDISAVCLFF 352 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22916 (286 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv48482 300 2e-83 >Vv48482 Length = 305 Score = 300 bits (768), Expect = 2e-83, Method: Compositional matrix adjust. Identities = 145/218 (66%), Positives = 180/218 (82%), Gaps = 5/218 (2%) Query: 74 KNKAIDITPELKGTSIFLVGMKSSMKTSLGKLLANVLRYYYFDSDSLVEEAAGGGSAAKL 133 K KA++I+P LKGTSIFLVGM S++KT++GKLLA+ LRYY+FDSDSLVEEA GG S AK Sbjct: 88 KKKAMEISPVLKGTSIFLVGMNSTIKTNVGKLLADALRYYHFDSDSLVEEACGGESVAKS 147 Query: 134 LREADTNGYRESETEVLKQLSSMGRLVVCAGDGAVQSSTNLALLRYGISIWIDVPLDLVA 193 L+E D G+R+SETEVLKQLSSMGRLVVCAGDG VQSSTNLALLR+GISIWIDVP+++VA Sbjct: 148 LKEQDEKGFRDSETEVLKQLSSMGRLVVCAGDGLVQSSTNLALLRHGISIWIDVPIEMVA 207 Query: 194 RGMIEDQSQLPALNVSASASYPE-----VLTHLSTMYEEVRGGYETADATVSIEKLAYQL 248 + MIE+ Q+P +S + SY E V L+ +YEE++GGY TADA+VS++K+A QL Sbjct: 208 KNMIEEGVQIPVTELSTAESYSETGDNQVFAQLAVVYEEMKGGYATADASVSLQKVASQL 267 Query: 249 GYDDFGDVTTEDVAFEVLMEMEKLTRVKKMMEASARPF 286 GYDD VTTED+A EVL E+++LTR+KKMME +ARPF Sbjct: 268 GYDDLDAVTTEDMAMEVLKEIQRLTRLKKMMEEAARPF 305 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13092 (156 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22698 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1254 (121 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv24737 72 3e-15 >Vv24737 Length = 86 Score = 72.0 bits (175), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 33/48 (68%), Positives = 40/48 (83%) Query: 73 IQLVLANPGPLVIDKIHASHVSTLIGEDRIFLTVAEAVSSCSPKLVEE 120 +QLVLANPG +VIDK+HAS + IGED+IFLTV +AV +CSPKL EE Sbjct: 38 VQLVLANPGQVVIDKLHASKFADDIGEDKIFLTVGDAVVTCSPKLAEE 85 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28706 (271 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32411 (183 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226762029 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31003 180 2e-47 >Vv31003 Length = 427 Score = 180 bits (457), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 97/168 (57%), Positives = 111/168 (66%), Gaps = 9/168 (5%) Query: 57 FTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGYQGHRE 116 FT +L T +FRSD LGEGGFG V+KGY+D +V VA+K L++ G QG RE Sbjct: 99 FTFHQLAVATDNFRSDCFLGEGGFGKVFKGYLDNPSQV------VAIKQLDRNGLQGIRE 152 Query: 117 WLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHL--FRKATVPLSWGTR 174 + EV L + HPNLVKLIGYC E D RLLVYE+M GSLENHL T PL W +R Sbjct: 153 FFVEVLTLSSVDHPNLVKLIGYCAEGDQRLLVYEYMPLGSLENHLHDLPPGTKPLDWNSR 212 Query: 175 MMIALGAAKGLAFLHNAE-RPVIYRDFKTSNILLDSDYATKLSDFGLA 221 M IA GAAKGL +LH+ PVIYRD K SNILL Y KLSDFGLA Sbjct: 213 MKIAAGAAKGLEYLHDKMYPPVIYRDLKCSNILLGEGYHPKLSDFGLA 260 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig11272 (412 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16991 633 0.0 >Vv16991 Length = 380 Score = 633 bits (1633), Expect = 0.0, Method: Compositional matrix adjust. Identities = 295/373 (79%), Positives = 333/373 (89%), Gaps = 3/373 (0%) Query: 34 IRDDKEMESTVAVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAK 93 + DDKE+ + VVDGN GHII TTIGG+NG+PKQTISYMAERVVG GSFG+VFQAK Sbjct: 1 MSDDKEI--SAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK 58 Query: 94 CLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYV 153 CLETGETVAIKKVLQD+RYKNRELQ MR +DHPNV+SLKHCFFSTT +DEL+LNLV+EYV Sbjct: 59 CLETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFSTTSRDELFLNLVMEYV 118 Query: 154 PETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIHRCIGVCHRDIKPQNLLVNPHTH 213 PET++RV+KHY+ QRMPLIYVKLYTYQIFR L+YIH GVCHRD+KPQNLLV+P TH Sbjct: 119 PETMYRVLKHYSNAKQRMPLIYVKLYTYQIFRGLAYIHSVPGVCHRDLKPQNLLVDPLTH 178 Query: 214 QVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQ 273 QVKLCDFGSAKVLVKGE NISYICSR+YRAPELIFGATEYT++ID+WS GCVLAELLLGQ Sbjct: 179 QVKLCDFGSAKVLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQ 238 Query: 274 PLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAV 333 PLFPGE+ VDQLVEIIKVLGTPTREEI+CMNP+YT+F+FPQIKAHPWHK+FHKRMPPEA+ Sbjct: 239 PLFPGENAVDQLVEIIKVLGTPTREEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAI 298 Query: 334 DLVSRLLQYSPNLRCTALDALVHSFFDDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAET 393 DL SRLLQYSP+LRCTAL+A H FFD+LR+PN RLPNGR LPPLFNFK EL G E Sbjct: 299 DLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPEL 357 Query: 394 LMKLVPEHARKQV 406 + KL+PEH R+Q+ Sbjct: 358 VNKLIPEHVRRQI 370 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48274410 (186 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17635 (130 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8715 (275 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31136 129 8e-32 >Vv31136 Length = 506 Score = 129 bits (323), Expect = 8e-32, Method: Compositional matrix adjust. Identities = 61/174 (35%), Positives = 99/174 (56%), Gaps = 1/174 (0%) Query: 1 MSNTHGSRSYLWLPFVPLVMILMVGTKLQVIITKMGLKLSERGEVVRGTPLVEPGDHLFW 60 + N G +Y W+ F+P +++L+VGTKL+ + T++ +++E+ + G +V P D FW Sbjct: 295 LLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHVAIEGDLVVRPSDDHFW 354 Query: 61 FNNPRLLLYIIHXXXXXXXXXXXXXXWTWYEFGLKSCFHEKLEDVVLRISMGVIIQILCS 120 F+ P+++L++I W W ++G SC +L ++ R+ +G +Q LCS Sbjct: 355 FHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGFIIPRLFIGAFVQFLCS 414 Query: 121 YVTLPLYALVTQMGSTMKPVIFNDRVATALKKW-HIAAKKHVKHKNASPASAPG 173 Y TLPLYA+V QMGS+ K IF + + L +W H A K KNA+ S G Sbjct: 415 YSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFKKNANGPSQVG 468 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig17769 (297 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv47574 210 3e-56 >Vv47574 Length = 207 Score = 210 bits (534), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 107/214 (50%), Positives = 139/214 (64%), Gaps = 40/214 (18%) Query: 63 LYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNA 122 L+KNYG+T+AGLRA+GY+ D D+YHSFVHGRLPYE IKPD LRSLL ++ RKII TN+ Sbjct: 4 LFKNYGSTLAGLRALGYNIDADDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILTNS 63 Query: 123 DKIHAAKALSRLGLEDIFEGIICFETLNP-IHKNTVSDDEDDIEFVGLXXXXXXXXXXQI 181 D+ HA K L RLGL+D F+ IICFET+NP + K+T Sbjct: 64 DRNHAIKVLDRLGLQDCFDQIICFETMNPNLPKST------------------------- 98 Query: 182 FDIIGHFATPNPTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRV 241 +L + P++ PS DA++ AL AN+NP RTLF +D+VRNI AGK + Sbjct: 99 --------------RLDEFPVILNPSLDAMKIALDAANVNPPRTLFLDDNVRNIAAGKAL 144 Query: 242 GLQTVLVGTSQRVKGADYALESIHNLREAIPELW 275 GL+TVLVG + + K ADY LE++HNL + IPE+W Sbjct: 145 GLRTVLVGKTMKTKEADYVLETVHNLAQVIPEIW 178 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 56200692 (60 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20523 (311 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv50787 430 e-122 >Vv50787 Length = 279 Score = 430 bits (1106), Expect = e-122, Method: Compositional matrix adjust. Identities = 206/255 (80%), Positives = 224/255 (87%) Query: 56 MTEETKNADTNGPKGXXXXXXXXXXXGWGYILGITFAVTNIPYLLDENNEAGGYAIAEIF 115 TEETK+AD NGP+G GWGYI+GITFAVT+I YLL N+AGGYAIAE+F Sbjct: 24 QTEETKSADVNGPRGIISAIGISVIVGWGYIIGITFAVTDISYLLSSTNDAGGYAIAEVF 83 Query: 116 YLAFKSRYGSGVGGIVCLGVVAVAIFFCGMSSVTSNSRMVYAFSRDGAMPLSPFWHKVNK 175 Y AFKSRYGSGVGGI+CLGVVAVAIFFCGM SVTSNSRM YAFSRDGAMP SP WHKVN Sbjct: 84 YQAFKSRYGSGVGGIICLGVVAVAIFFCGMGSVTSNSRMAYAFSRDGAMPFSPLWHKVNS 143 Query: 176 HEVPVNAVWLSAFISFCMALTSLGSLVAFNAMVSIATIGLYIAYALPIFFRVTMARKSFV 235 EVP+NAVWLSA ISFCMALTSLGSLVAF AMVSIATIGLYIAYALPIFFRVT+ARKSF+ Sbjct: 144 QEVPINAVWLSAAISFCMALTSLGSLVAFQAMVSIATIGLYIAYALPIFFRVTLARKSFI 203 Query: 236 PGPFNLGRYGVVVGWISVLWVATISVLFSLPVAYPITIETLNYTPVAVGGLLIITVLAWI 295 PGPFNLGRYG++VGW++VLWV TISVLFSLPVAYPIT ETLNYTPVAVGGLL + V +WI Sbjct: 204 PGPFNLGRYGILVGWVAVLWVITISVLFSLPVAYPITTETLNYTPVAVGGLLFLAVASWI 263 Query: 296 LSARHWFKGPITNIE 310 +SARHWFKGPITNI+ Sbjct: 264 ISARHWFKGPITNID 278 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14799 (428 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10975 222 8e-60 >Vv10975 Length = 393 Score = 222 bits (566), Expect = 8e-60, Method: Compositional matrix adjust. Identities = 114/266 (42%), Positives = 175/266 (65%), Gaps = 9/266 (3%) Query: 115 SEKFPFLITGFFFFMWYLLNVIFNILNKKVYNYFPYPYFVSVIHLLVGVVYCLVSWSVGL 174 SE L G +F W+ LNV+FNI NKKV N FPYP+ S + L G + L+SW+V + Sbjct: 94 SEAAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLATGSLMMLISWAVRI 153 Query: 175 PKRAPIDKEQLALLTPVAFCHALGHVMSNVSFAAVAVSFTHTIKALEPFFNASASQFVLG 234 + D + L PVA H +GHV + VS + VAVSFTH IK+ EP F+ S+F+LG Sbjct: 154 AEPPKTDLDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLG 213 Query: 235 HHIPLSLWLSLAPVVIGVSMASLTELSFNWLGFGSAMISNIAFTYRSIYSKKAMTG--MD 292 P+ ++ SL P++ G ++A++TEL+FN GF AMISN+AF +R+I+SK+ M G + Sbjct: 214 ETFPVPVYFSLLPIIGGCALAAVTELNFNMTGFMGAMISNLAFVFRNIFSKRGMKGKSVG 273 Query: 293 STNVYAYISIIALLVCIPPAILIEGPQLMQYGFKDAIAKVGLYKFVSDLFWIG---MFYH 349 N YA +S+++LL+ P AI +EGPQ+ G++ AI+++G + ++W+ +FYH Sbjct: 274 GMNYYACLSMLSLLILTPFAIAVEGPQMWAAGWQKAISQIG----PNFIWWVAAQSVFYH 329 Query: 350 LYNQLATNTLERVAPLTHAVGNVLKR 375 LYNQ++ +L++++PLT ++GN +KR Sbjct: 330 LYNQVSYMSLDQISPLTFSIGNTMKR 355 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26123 (177 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2610 (253 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2810 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv12295 62 4e-12 >Vv12295 Length = 66 Score = 62.0 bits (149), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 28/36 (77%), Positives = 31/36 (86%) Query: 97 ETGVVEPKKFGLLANWQREYTMEDILTQLKKEMAAP 132 ETGVVEP F +LA WQRE+TMEDILTQLKKEM +P Sbjct: 2 ETGVVEPSLFPMLATWQREHTMEDILTQLKKEMMSP 37 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 49633160 (95 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18031 (274 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv59326 264 1e-72 >Vv59326 Length = 213 Score = 264 bits (675), Expect = 1e-72, Method: Compositional matrix adjust. Identities = 132/187 (70%), Positives = 156/187 (83%), Gaps = 2/187 (1%) Query: 88 MLPNRASANSLSAPIKSSGGFRDSMDDKSKSNLVQIKGRFSVTSENLDLVKDIXXXXXXX 147 MLPNRASAN L APIKSS G+RDS+++KSK+NLV+IKGRFSVTSEN+DLVKDI Sbjct: 1 MLPNRASANRLGAPIKSSAGYRDSLEEKSKANLVRIKGRFSVTSENVDLVKDIPLCAVAR 60 Query: 148 XXXXXXXLKKSASVGDWVFESRQTPATVSPKEFNNSNVPASLLLPHLQNLFQQTSVQQDI 207 L+KSASVGDW+F+S+ P +PK+F+NSNVPASLL+PHLQNLFQQTS+QQD+ Sbjct: 61 RSSQGSPLRKSASVGDWMFDSK--PMLTTPKDFSNSNVPASLLMPHLQNLFQQTSLQQDL 118 Query: 208 IMNLLSSLQPAEAVEATQNGKLPPLPRSSENNGNVETAVSERERLLLVKVSELQARMNNL 267 I NLL+SLQ +E V+A+QNGKLPPLPR SENNGNV+ SERERLLL+KVSEL ARM NL Sbjct: 119 ITNLLNSLQSSEIVDASQNGKLPPLPRGSENNGNVDPGASERERLLLLKVSELHARMINL 178 Query: 268 SDELTAE 274 +DELTAE Sbjct: 179 TDELTAE 185 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14016 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9858 (377 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig15521 (360 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26966 (442 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46377 347 2e-97 >Vv46377 Length = 226 Score = 347 bits (890), Expect = 2e-97, Method: Compositional matrix adjust. Identities = 177/226 (78%), Positives = 193/226 (85%), Gaps = 2/226 (0%) Query: 219 MRMNAPRCLFGSASLKEIAILAGGCDSQGNILSSAELYNSETQTWEMLPSMNKPRKMCSG 278 M MN+PRCLFGSASL EIAILAGGCD +GNILSSAELYNS+T TW LPSMNKPRKMCSG Sbjct: 1 MNMNSPRCLFGSASLGEIAILAGGCDPRGNILSSAELYNSDTGTWVTLPSMNKPRKMCSG 60 Query: 279 VFMDDKFYVIGGIGGSDLKVLTCGEEYDLTARTWTEIPNMSPGRSGAA--RETDVPAGEA 336 +FMD KFYVIGGIG + LTCGE YDL RTW EIPNM PGR+G+A E A EA Sbjct: 61 IFMDRKFYVIGGIGVGNSNSLTCGEVYDLEMRTWREIPNMFPGRNGSAGVAEATPAAAEA 120 Query: 337 PPLVAVVNNELYAADYADMEVRKYDKERRVWLTVGRLPERAASMNGWGLAFRACGDQLIV 396 PPLVAVVNNELYAADYA+ EVRKYDK R +W+TVGRLPE+A SMNGWGLAFRACGD+LIV Sbjct: 121 PPLVAVVNNELYAADYAEKEVRKYDKARNLWVTVGRLPEQAVSMNGWGLAFRACGDRLIV 180 Query: 397 IGGPRALGEGFIEINAWVPGEGPPQWNLLARKQSGNFVYNCAVMGC 442 IGGPR LG G IE+N+W PGEGPPQW+LLARKQSG+FVYNCAVMGC Sbjct: 181 IGGPRVLGGGIIELNSWSPGEGPPQWDLLARKQSGSFVYNCAVMGC 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8633 (372 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27061 (297 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53186 81 2e-17 >Vv53186 Length = 276 Score = 80.9 bits (198), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 73/231 (31%), Positives = 116/231 (50%), Gaps = 27/231 (11%) Query: 25 IFDGHNGISAAIFTKENLLANVLSAIPQGTSRDEWLQALPRALVAGFVKTDIEF--QQKG 82 +FDGH G A + K NL N LS+ P ++++ A+ F KTD ++ ++KG Sbjct: 62 VFDGHGGSRTAEYLKNNLFKN-LSSHP------DFIKDTKSAIAEVFRKTDADYLNEEKG 114 Query: 83 ET--SGTTVTFVVIDDWTVTVASVGDSRCILDTQGGVVSLLTVDHXXXXXXXXXXXVTAS 140 + +G+T + V+ + VA+VGDSR + G + L T DH A Sbjct: 115 QARDAGSTASTAVLVGDRLLVANVGDSRVVACRAGSAIPLST-DHKPDRSDERQRIEDAG 173 Query: 141 GGEVGRLNIFGGN-EVGPLRCWPGGLCLSRSIGDTDVGEYIVPIPHVKQVKLSNAGGRLI 199 G I+ G VG G L +SR+ GD + Y+V P +++ ++ +I Sbjct: 174 G-----FVIWAGTWRVG------GVLAVSRAFGDKLLKAYVVADPEIQEEEIDGVD-FII 221 Query: 200 IASDGIWDALSSDMAAKSCRG-LPAELAAKLVVKEALRSRGLKDDTTCVVV 249 IASDG+W+ LS+ A + + AE A++ ++ EA +RG D+ TCVVV Sbjct: 222 IASDGLWNVLSNKEAVAIVQDIMDAEAASRKLIHEAY-ARGSSDNITCVVV 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7310 (583 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv46022 64 5e-12 >Vv46022 Length = 288 Score = 64.3 bits (155), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 51/200 (25%), Positives = 87/200 (43%), Gaps = 17/200 (8%) Query: 207 EPEADPERDQRTVFAYQMPLKAAERDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFY 266 EP P+ +F +P + F +AG V V +I D+ + RS+G G++ Sbjct: 83 EPSFSPDLK---LFVGNLPFNVDSAGLAGLFEQAGNVEMVEVIYDKITGRSRGFGFVTMS 139 Query: 267 DAMSVPMAIA-LSGQLLLGQPVMVKPS-----------EAEKNLVQSNATSXXXXXXXXX 314 V A +G L G+ + V E + T+ Sbjct: 140 TVEEVEAAAQQFNGYELEGRQLRVNSGPPPARRENSNFRGENTNFRGENTNFRGPRGGAN 199 Query: 315 XXXDRKLYVGNLHFNMTETHLREIFEPFGPVELVQLPLDLETGQCKGFGFVQFAHLEHA- 373 ++YVGNL + + + L +F G V ++ D ETG+ +GFGFV + E Sbjct: 200 LNSTNRIYVGNLSWGVDDLALETLFSEQGKVTEARVIYDRETGRSRGFGFVTYNSAEEVN 259 Query: 374 KAAQSLNGKLEIAGRTIKVS 393 +A +SL+G +++ GR+I+V+ Sbjct: 260 RAIESLDG-VDLNGRSIRVT 278 Score = 63.9 bits (154), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 35/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (2%) Query: 318 DRKLYVGNLHFNMTETHLREIFEPFGPVELVQLPLDLETGQCKGFGFVQFAHLEHAK-AA 376 D KL+VGNL FN+ L +FE G VE+V++ D TG+ +GFGFV + +E + AA Sbjct: 89 DLKLFVGNLPFNVDSAGLAGLFEQAGNVEMVEVIYDKITGRSRGFGFVTMSTVEEVEAAA 148 Query: 377 QSLNGKLEIAGRTIKVSS 394 Q NG E+ GR ++V+S Sbjct: 149 QQFNG-YELEGRQLRVNS 165 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31898 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26657 (284 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226761053 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4147 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv52403 183 1e-48 >Vv52403 Length = 221 Score = 183 bits (465), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 91/149 (61%), Positives = 112/149 (75%), Gaps = 1/149 (0%) Query: 5 KAVALMTGDSNVRGSLHFLQASNGGPTHIQGRISGLSPGLHGFHIHALGDTSNGCNSTGP 64 KAVA++ G S+V G + Q +G PT + RI+GL+PG HGFH+H GDT+NGC STG Sbjct: 71 KAVAVLKGTSSVEGVVTLSQEDDG-PTTVSVRITGLTPGNHGFHLHEFGDTTNGCMSTGA 129 Query: 65 HFNPLKKEHGAPSDKERHAGDLGNIVAGQDGVAEVSLQDWLIPLSGPNSILGRAVVVHAD 124 HFNP HGAP D RHAGDLGNIVA +GVAE ++ D IPLSGPN+++GRA+VVH Sbjct: 130 HFNPNGMTHGAPEDDVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNAVIGRALVVHEL 189 Query: 125 PNDLGKGGHELSKTTGNAGARVGCGIIGL 153 +DLGKGGHELS TTGNAG R+ CG++GL Sbjct: 190 EDDLGKGGHELSLTTGNAGGRLACGVVGL 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48271147 (126 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4675 (194 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414951 (138 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv32818 149 2e-38 >Vv32818 Length = 296 Score = 149 bits (377), Expect = 2e-38, Method: Compositional matrix adjust. Identities = 80/134 (59%), Positives = 87/134 (64%), Gaps = 6/134 (4%) Query: 1 MSGRFSRTIYVGNLPSDIKEWEVEDLFYKYGRIVDIELKIPPRPPCYSFVEFESSRDAED 60 MS R SRT+YVGNLP DI+E EVEDLFYKYG I I+LKIPPRPP Y+FVEFE SRDAED Sbjct: 1 MSSRASRTLYVGNLPGDIREREVEDLFYKYGPIAHIDLKIPPRPPGYAFVEFEESRDAED 60 Query: 61 AIRGRDGYNFDGCRLRVELAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRVI 120 AIRGRDGY+FDG RLRVELAH EYRV+ Sbjct: 61 AIRGRDGYDFDGHRLRVELAH------GGRGHSSSIDRHSHSSGRGGRGGASRRSEYRVL 114 Query: 121 VRNLPSSASWQDFE 134 V LPSSASWQD + Sbjct: 115 VTGLPSSASWQDLK 128 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22024 (301 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv31219 384 e-108 >Vv31219 Length = 252 Score = 384 bits (985), Expect = e-108, Method: Compositional matrix adjust. Identities = 197/237 (83%), Positives = 220/237 (92%), Gaps = 1/237 (0%) Query: 1 MRPIFCGNLDFDARQSDVERLFKRYGKVERVDIKSGFAFVYMDDERDAEYAIRRLDRTEF 60 M+PIFCGNL++DARQSDVERLF+RYGKV+RVD+KSGFAFVYMDDERDAE AIRRLDRT F Sbjct: 1 MKPIFCGNLEYDARQSDVERLFRRYGKVDRVDLKSGFAFVYMDDERDAEDAIRRLDRTVF 60 Query: 61 GRKGRRLRIEWTKHERGIRRPD-SRRPSANMKPSKTLFVINFDPVHTRTKDLERHFDPYG 119 GRKGR+LR+EWTK ERGIRRP SR+ SANMKPSKTLFVINFDP+HTRT+DLERHFD YG Sbjct: 61 GRKGRQLRVEWTKQERGIRRPGGSRKSSANMKPSKTLFVINFDPIHTRTRDLERHFDLYG 120 Query: 120 KITNIRIRRNFAFIQYESQEDATKALEATNTSKFMDRVISVEYAARDDDDDKRNGHSPDR 179 KI NIRIRRNFAFIQ+ESQEDATKAL+ATN SKFMDRVISVEYAARDDDDD+RNG+SP+R Sbjct: 121 KILNIRIRRNFAFIQFESQEDATKALDATNMSKFMDRVISVEYAARDDDDDRRNGYSPER 180 Query: 180 RGRDMSPERRSNDRGRSPSPYRRDRGSPDYGHGARVSSRTESRRSPDYERAASPVND 236 RGRDMSP+RRS+DRGRSPSPY RDR SPDYGHGA +SR+E R SP+Y+R SPVN+ Sbjct: 181 RGRDMSPDRRSHDRGRSPSPYHRDRASPDYGHGANANSRSEPRGSPNYDRDESPVNE 237 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig29068 (216 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48269463 (136 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27877 (427 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53186 83 7e-18 >Vv53186 Length = 276 Score = 83.2 bits (204), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 75/245 (30%), Positives = 119/245 (48%), Gaps = 27/245 (11%) Query: 57 RIHSDPSTTFSVFAIFDGHNGISAAIFTKENLLANVLSAIPQGISRDEWLLALPRALVAG 116 RI + F +FDGH G A + K NL N LS+ P +++ A+ Sbjct: 48 RISEVDGHMVAFFGVFDGHGGSRTAEYLKNNLFKN-LSSHP------DFIKDTKSAIAEV 100 Query: 117 FVKTDIEF--QQKGET--SGTTVTFVVIDGWTVTAASVGDSRCILDTQGGVVSLLTVDHX 172 F KTD ++ ++KG+ +G+T + V+ G + A+VGDSR + G + L T DH Sbjct: 101 FRKTDADYLNEEKGQARDAGSTASTAVLVGDRLLVANVGDSRVVACRAGSAIPLST-DHK 159 Query: 173 XXXXXXXXXXVTASGGEVGRLNVFGGNEVGPLRCWPGG-LCLSRSIGDTDVGEYIVPIPH 231 E R+ GG + GG L +SR+ GD + Y+V P Sbjct: 160 PDRSD-----------ERQRIEDAGGFVIWAGTWRVGGVLAVSRAFGDKLLKAYVVADPE 208 Query: 232 VKQVKLSNAGGRLIIASDGIWDALSSDMAAKSCRG-LPAELAAKMVVKEALRSRGLKDDT 290 +++ ++ +IIASDG+W+ LS+ A + + AE A++ ++ EA +RG D+ Sbjct: 209 IQEEEIDGVD-FIIIASDGLWNVLSNKEAVAIVQDIMDAEAASRKLIHEAY-ARGSSDNI 266 Query: 291 TCVVV 295 TCVVV Sbjct: 267 TCVVV 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22374 (352 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv18866260 85 2e-18 >Vv18866260 Length = 386 Score = 84.7 bits (208), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 80/269 (29%), Positives = 121/269 (44%), Gaps = 44/269 (16%) Query: 67 PGINLLKQFANVDCSYNLSPEELCTK----------ISL----CDALIVRSGTKVTREVF 112 PG + DC E+CT+ I+L CD +I + +F Sbjct: 25 PGTRWIDLLVQQDCRV-----EICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLF 79 Query: 113 ES---SGGRLKVVGRAGVGIDNVDLAAATEFGCLXXXXXXXXXXXXXEHGIALLTAMARN 169 + +GGR VG +NVD+ AA ++G E +L A AR Sbjct: 80 SALSRAGGR--AFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTETTAELAASLSMAAARR 137 Query: 170 VAQADASVKAG---KWERNKYVGVSLVGKTLAVMGFGKVGSEVARR-AKGLGMHVISHDP 225 + +AD ++AG W + +VG L G+T+ V+G G++GS AR +G M++I +D Sbjct: 138 IVEADEFMRAGLYDGWLPHLFVGNLLRGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDL 197 Query: 226 Y----------APADRARAIGVELVSF------DEALATADFISLHMPLTPATNKVLNDD 269 Y A +A G + V++ DE L AD ISLH L T ++N + Sbjct: 198 YQATRLEKFVTAYGQFLKASGEQPVTWKRAASMDEVLREADLISLHPVLDKTTYHLVNKE 257 Query: 270 TFAKMKKGVRIVNVARGGVIDEDALLRAL 298 + MKK ++N +RG VIDE AL+ L Sbjct: 258 RLSMMKKEAILINCSRGPVIDEVALVAHL 286 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8974 (206 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21132 (160 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6549 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2035 (132 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20244 (208 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8594 135 4e-34 >Vv8594 Length = 397 Score = 135 bits (341), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 7/207 (3%) Query: 4 VGIQTGFRSTGRRQSLRKTWMPSDTQGLQRLEEATGLAFRFVIGKTKEKAKMAE--LSKE 61 +GI T F S RR S+R+TWMP Q L +LE G+ RF+IG + + + + + E Sbjct: 132 IGINTAFSSRKRRDSIRETWMPKG-QKLLQLEREKGIVVRFMIGHSATSSSILDRAIDSE 190 Query: 62 VAKYDDFVLLDIEEEYCKLPYKTLAFFKAAYELYDADFYVKADDDIYLRPDRLSLLLAKE 121 +++ DF+ L+ E Y +L KT FF A +DA+FYVK DDD+++ L+ LA+ Sbjct: 191 ESQHKDFLRLEHIEGYHELTAKTKTFFSMAVAQWDAEFYVKVDDDVHVNLGMLASTLARH 250 Query: 122 RSHSQTYLGCMKKGPVFTDSNLKWYEPLSYLLGSE---YFLHAYGPIYXXXXXXXXXXXX 178 RS + Y+GCMK GPV + +K++EP + G E YF HA G IY Sbjct: 251 RSKPRVYIGCMKSGPVLSQKTVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDLATYISV 310 Query: 179 XRNNSFRMFSNEDVTIGAGMLAMNVNQ 205 + ++NEDV++GA + + V Sbjct: 311 NQ-PILHKYANEDVSLGAWFIGLEVEH 336 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23077 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv44542 115 9e-28 >Vv44542 Length = 97 Score = 115 bits (287), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 52/72 (72%), Positives = 63/72 (87%) Query: 115 SFYCRHGKAYLFSKVVNVYSGECEDRAMMTGLHTVADIFCVGCGSIVGWKYETAHEKGQK 174 SF+ +GKAYLF+KVVN+ G E++ MMTG++TVADIFCVGCGSIVGW+YETAHEK QK Sbjct: 11 SFHTVNGKAYLFNKVVNISVGVHEEKMMMTGMYTVADIFCVGCGSIVGWRYETAHEKAQK 70 Query: 175 YKEGKSVLERIK 186 YKEGKSVL+R + Sbjct: 71 YKEGKSVLQRYR 82 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28724 (449 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71824593 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2671 (187 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91012380 (127 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21775 (551 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv19744 156 7e-40 >Vv19744 Length = 229 Score = 156 bits (395), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 95/226 (42%), Positives = 139/226 (61%), Gaps = 1/226 (0%) Query: 322 MHDLRSATSGSAEPEAGWFDLFSSRYWKVVSVGAALFLLQQMAGINAVVYYSTSVFRSAG 381 M DL + G +L R+++VV +G+ LF LQQ++GINAV Y+S++VF+SAG Sbjct: 1 MADLHKSDRGDEIDAVKLSELLYGRHFRVVFIGSTLFALQQLSGINAVFYFSSTVFKSAG 60 Query: 382 ITSDVAASALVGLANVLGTAVASSLMDKQGRKSLLLTSFGGXXXXXXXXXXXFTWKALAP 441 + SD+A + VG+AN+ G+ A LMDK GRK+LL+ SF G + Sbjct: 61 VPSDLA-NVFVGIANLSGSITAMILMDKLGRKALLVWSFFGMAVAMSVQVAGASSFISGS 119 Query: 442 YSAPLSVAGTVLYVLSFSXXXXXXXXXXXXEIFASRIRAKAVSLSLGMHWISNFVIGLYF 501 + LSV+G +L+VL+F+ EIF +RIRAKA+++ + +HW+ NF +GL F Sbjct: 120 GAVFLSVSGMLLFVLTFALGAGPVPGLLLPEIFPNRIRAKAMAVCMSVHWVINFFVGLLF 179 Query: 502 LSLVTKFGIGTVYFGFAGVCLLAVLYIAGNVVETKGRSLEEIERAL 547 L L+ + G +Y F CL+AV+++ NVVETKGRSL+EIE AL Sbjct: 180 LRLLEQLGPQLLYSMFCTFCLMAVVFVKRNVVETKGRSLQEIEIAL 225 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46990835 (192 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv42089 218 5e-59 >Vv42089 Length = 271 Score = 218 bits (556), Expect = 5e-59, Method: Compositional matrix adjust. Identities = 106/155 (68%), Positives = 127/155 (81%) Query: 2 TALVTGGTKGIGYAIVEELAGLGAIVHTCARTEADLNDCLSQWEKKGFQVTGSVCDVVSK 61 TALVTGGT GIGYAIVEELAG+GA V+TC+RTE+ LN+ L W KGF V GSVCDV + Sbjct: 20 TALVTGGTLGIGYAIVEELAGMGAAVYTCSRTESKLNNLLRDWNAKGFDVRGSVCDVSDR 79 Query: 62 TQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAYHLCQLSH 121 QRE+LI KVSS F+GKLNILINNVG N K T+EYTA D+S LM+TN+ES YHLCQL++ Sbjct: 80 AQREQLIEKVSSGFNGKLNILINNVGTNFSKPTIEYTAADFSALMATNIESGYHLCQLAY 139 Query: 122 PLLKASGSANIVLLSSIAGVVSLNIGTIYSATKVS 156 PLLKASG+ +IV +SS+AGVVS G+IY+ATK + Sbjct: 140 PLLKASGAGSIVFISSVAGVVSTGTGSIYAATKAA 174 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig12116 (134 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3176 (234 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16600 154 1e-39 >Vv16600 Length = 219 Score = 154 bits (390), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 88/214 (41%), Positives = 127/214 (59%), Gaps = 10/214 (4%) Query: 1 MGESDVKVLGMAPSPFVMRARIALNLKSVDYEFLQETFGSKSELLLQSNPVHKKVPVLIH 60 MG+ ++ +L PS F MR R+AL K + YE+ +E +KS LLL+ NPVHK++PVLIH Sbjct: 1 MGD-EIILLDFWPSMFGMRVRLALAEKGLKYEYKEEDLKNKSPLLLEMNPVHKQIPVLIH 59 Query: 61 GDKPVCESLIIVEYIDEVWASGPSILPSDPYDRATARFWAAYISEKWYPSMKGIGLAQGE 120 KP+CESLIIV+YIDEVW +LPSDPY RA ARFWA Y+ +K Y + + +GE Sbjct: 60 NGKPICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKLYGLGRKVWSTKGE 119 Query: 121 EAKKAAIEQVTEGLALLE-EAFEKSSKGNVFFGGDEIGYLDIAFGCFLGWLRVNEKLHGI 179 E ++ A ++ E L LLE E EK +FGG++IG++D+A F W E Sbjct: 120 E-QETAKKEFIECLKLLEGELGEKP-----YFGGEKIGFVDVALVTFSCWFYAYESFGNF 173 Query: 180 KLLDQTKTPGLVKWADKFCAHAAVKDVMPETDKL 213 + + + P L+ W + +V + + K+ Sbjct: 174 SI--EAECPKLIAWTKRCKEKESVSSSLEDPHKV 205 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13156 (265 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25214 (220 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91042114 (149 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8056 (418 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50886902 (102 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22926 (251 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20635 (287 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5264 (188 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8751 (325 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53094 509 e-146 >Vv53094 Length = 331 Score = 509 bits (1312), Expect = e-146, Method: Compositional matrix adjust. Identities = 246/331 (74%), Positives = 277/331 (83%), Gaps = 6/331 (1%) Query: 1 MGRFHXXXXXXXXXXXXXXXXP--TSAQLKTNYYANICPNVESIVRDAVTKKFQQTFVTV 58 MGRF P SAQLK NYYANICPNVE+IVR V KF+QTFVTV Sbjct: 1 MGRFPLLAIAMWSLSLSVCVFPDTASAQLKQNYYANICPNVENIVRGVVNMKFKQTFVTV 60 Query: 59 PGTLRLFFHDCFVEGCDASVIVASTANNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQ 118 P TLRLFFHDCFV+GCDASVI++ST +N AEKD+PDNLSLAGDGFDTVIKAKA VD P Sbjct: 61 PATLRLFFHDCFVQGCDASVIISSTGSNTAEKDHPDNLSLAGDGFDTVIKAKAEVDKNPT 120 Query: 119 CKNKVSCADILALATRDVIGLSGGPSYSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNS 178 C+NKVSCADIL +ATRDVI LSGGPSY+VELGRLDGL STS SVNGKLP+ TFNL++LNS Sbjct: 121 CRNKVSCADILTMATRDVIALSGGPSYAVELGRLDGLRSTSASVNGKLPQPTFNLDKLNS 180 Query: 179 LFASHGLSQADMVALSGAHTLGFSHCNQFSNRIY----SNPVDPTLNKTYATQLQQMCPK 234 LFA++GLSQ DM+ALS AHTLGFSHC++F+NRIY NPVDPTL+KTYA QLQ MCPK Sbjct: 181 LFAANGLSQTDMIALSAAHTLGFSHCSKFANRIYNFSRENPVDPTLDKTYAAQLQSMCPK 240 Query: 235 NVDPDIAIDMDPTTPRKFDNVYFQNLVEGKGLFTSDQVLYTDSRSQPTVRTWAKNNAAFN 294 NVDP IAIDMDPTTP+KFDNVY+QNL +GKGLFTSD+VL+TDSRS+PTV TWA ++ AF Sbjct: 241 NVDPRIAIDMDPTTPKKFDNVYYQNLQQGKGLFTSDEVLFTDSRSKPTVNTWASSSTAFQ 300 Query: 295 QAFITAMTKLGRVGMKTGKNGNIRRDCSVFN 325 AF+ A+TKLGRVG+KTGKNGNIRRDCSVFN Sbjct: 301 TAFVQAITKLGRVGVKTGKNGNIRRDCSVFN 331 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32010 (202 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56446 147 1e-37 >Vv56446 Length = 240 Score = 147 bits (372), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 76/191 (39%), Positives = 116/191 (60%), Gaps = 6/191 (3%) Query: 1 MSKGSVYDFLHKHKGVFKLPSLLKVAIDVSKGMNYLHQNNIIHRDLKTANLLM---DEHE 57 M GS+ + L K++ L +A+DV+ GM YLH NI+H DLK+ NLL+ D H Sbjct: 42 MVNGSLRNSLQKNEKNLDKRKRLLIAMDVAFGMEYLHGKNIVHFDLKSDNLLVNLRDPHR 101 Query: 58 -VVKVADFGVARVQTQSGVMTAETGTYRWMAPEVIEHKP--YDHKADVFSFGIVLWELLT 114 + KV D G+++V+ Q + GT WMAPE++ K DVFSFGIV+WELLT Sbjct: 102 PICKVGDLGLSKVKCQPLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLT 161 Query: 115 GQIPYSSLTPLQAAVGVVQKSLRPTIPKTTHPRFAELLERCWQQDPTQRPPFSDIIEILQ 174 G+ PY+ L G+V +LRP++P+ P + L+ERCW +P++RP F++I L+ Sbjct: 162 GEEPYADLHYGAIIGGIVSNTLRPSVPEFCDPEWRALMERCWSSEPSERPSFTEIANQLR 221 Query: 175 NLAKEVGNEGE 185 ++A ++ +G+ Sbjct: 222 SMAAKIPPKGQ 232 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31581 (128 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv62388 158 4e-41 >Vv62388 Length = 185 Score = 158 bits (399), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 85/115 (73%), Positives = 87/115 (75%), Gaps = 6/115 (5%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 77 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 136 Query: 61 IQKESTLHLVLRLRGGIIEPSLMALARKYNQEKMICRKCYARLHPRAVNCRKKKC 115 IQKESTLHLVLRLRGG M + K K I + A L AV C Sbjct: 137 IQKESTLHLVLRLRGG------MQIFVKTLTGKTITLEAEAHLCREAVGGWSDSC 185 Score = 156 bits (394), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 76/77 (98%), Positives = 77/77 (100%) Query: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN Sbjct: 1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN 60 Query: 61 IQKESTLHLVLRLRGGI 77 IQKESTLHLVLRLRGG+ Sbjct: 61 IQKESTLHLVLRLRGGM 77 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28288 (344 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv56715 302 7e-84 >Vv56715 Length = 221 Score = 302 bits (773), Expect = 7e-84, Method: Compositional matrix adjust. Identities = 144/219 (65%), Positives = 170/219 (77%), Gaps = 9/219 (4%) Query: 32 MDASGRLGSTLVHRLLHRGYAVHAALQKHH---KCFDDELVKKKKLRVFRSDPFDYHSIV 88 MDAS LGSTLV RLL RGY VHAA+Q H + + +KL++F SDPFDY SI+ Sbjct: 1 MDASSTLGSTLVGRLLLRGYTVHAAVQNHAGEIQLLNGLSCDTQKLKIFHSDPFDYQSIM 60 Query: 89 DALKGCSALFYSFEPPSDHPTYDEFMAEAEVRAAHNVLEACAQTDTIHKVVFTSSVTAVI 148 DALKGCS LFY+FEPP D +YDE MA+ EVRAAHNV+EACAQT+TI KVVFTSSVTAV+ Sbjct: 61 DALKGCSGLFYTFEPPHDQTSYDELMADVEVRAAHNVIEACAQTETIEKVVFTSSVTAVV 120 Query: 149 WRDDRNXXXXXXXXXRGSDERNWSDVNFCRKFKLWHALSKTLAERTAWALAMDRGLNMVS 208 WRDDR DE +W+D+NF RKFKLWHA+SKTLAE++AWALAMDRG+NMVS Sbjct: 121 WRDDRKSIPSDL------DETHWTDINFSRKFKLWHAMSKTLAEKSAWALAMDRGVNMVS 174 Query: 209 INGGLLLGPDLTITDPYLKGTAEMYQDGLLVTVDLKFIV 247 +N GLL+ PDLTIT PYLKG AEMY+DG+ VTV + F+V Sbjct: 175 VNAGLLMAPDLTITHPYLKGAAEMYEDGVFVTVSVDFLV 213 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21541 (520 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv58117 572 e-165 >Vv58117 Length = 516 Score = 572 bits (1474), Expect = e-165, Method: Compositional matrix adjust. Identities = 312/500 (62%), Positives = 372/500 (74%), Gaps = 5/500 (1%) Query: 22 TRKNARLSVFAKRGGPLSAFRFGKSGDNGSVSDEGQADDSTNSSSFRLDFGKIPDVKALI 81 T KN L V+AKR GPLSAFR GK D S +E Q + S NS+ F +FGK+ DV +LI Sbjct: 21 TLKNPSLRVYAKRAGPLSAFRLGKQSDGPS--EESQENGSANSAPFSFNFGKVSDVSSLI 78 Query: 82 PVVSRPSLGLSFGNQRAKDPGTVFVAGATGQAGVRIAQALLREGFSVRAGVPELGAAQEL 141 PV+++PS GLSFG R KDPGTVFVAGATGQAG+RIAQALLREGFSVRAGV +LGAAQEL Sbjct: 79 PVMTKPSSGLSFG--RRKDPGTVFVAGATGQAGIRIAQALLREGFSVRAGVSDLGAAQEL 136 Query: 142 ARVASKYKIISNEESKRLNAVESVFQDAESIAKAIGNASKAVVTIGPAENGPTTEVTPFD 201 AR+ +KYKIISNEESKRLNAVES FQDAESIAKAIGNASK VVTIGP ENGPT EVTP D Sbjct: 137 ARLGAKYKIISNEESKRLNAVESSFQDAESIAKAIGNASKVVVTIGPGENGPTAEVTPLD 196 Query: 202 XXXXXXXXXXXXXXXXXIVYDGNSVGTSTYNVLDGISLFFNNLFSRSQPLSVSEFLQKVI 261 I+YD + +STYNV+DGIS FFNNLFSRSQPL+V+EFLQKV+ Sbjct: 197 ALQVIQAADLAGVGHVAIIYDESPFVSSTYNVIDGISTFFNNLFSRSQPLTVTEFLQKVV 256 Query: 262 EMDVSYTFIKTSLTEDFSPESSYNIVVSAEGSRAANDYKVAKSQIAALVADVFSNTSVAE 321 E DVSYT I+T+LTEDFSPESSYN+VVSAEGS ++NDYKVA SQIA+LVA+VFSNT+VAE Sbjct: 257 ETDVSYTLIRTNLTEDFSPESSYNVVVSAEGSVSSNDYKVATSQIASLVANVFSNTAVAE 316 Query: 322 NKVVEVYTDPSAPLRPVDQLFSTIPEDERRKAYAIMXXXXXXXXXXXXXXXXXXXXXXXX 381 NKVV+V+TDP AP +P +LFS IP+D RR+AYA Sbjct: 317 NKVVKVFTDPGAPSKPAVELFSAIPKDGRREAYAEALAKAKAEEEALKATEKAREAAEAA 376 Query: 382 XXXXXXXXXXXXXXXRSTNLAEDAQVKAEAAGASIDSLLNKAKNIGMGMSWKKFSTQVAD 441 R+ LA++A+ KAEAAGAS++ L+KAK++G G+SW+KFS+Q+A Sbjct: 377 KKLEQEVKKLSEQETRAATLADEAKEKAEAAGASVEVFLSKAKDLGSGLSWEKFSSQLAI 436 Query: 442 TVQN-SETPKVQIATVRGQAKARTLSPQKAVSKPVTTPKPVSLKRKEQPKPKAKQTDEKK 500 +VQ +E PKVQIATVRGQAKAR+L P+KAV K T P+P + K KE+PKPK KQ + K Sbjct: 437 SVQKPTEKPKVQIATVRGQAKARSLQPKKAVVKLPTFPRPPAFKPKEEPKPKGKQPESKA 496 Query: 501 EVRKVFGGLFTQETVYVDEE 520 EVRKVFGGLF QET+Y+D++ Sbjct: 497 EVRKVFGGLFKQETIYIDDD 516 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26818 (281 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv3467 341 1e-95 >Vv3467 Length = 229 Score = 341 bits (874), Expect = 1e-95, Method: Compositional matrix adjust. Identities = 168/224 (75%), Positives = 189/224 (84%), Gaps = 3/224 (1%) Query: 46 IATLLFLYITVLTVIGYKSQSEADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPA 105 +AT LFLYIT+LTV+G K C VGI GIAWAFGGMIF LVYCTAGISGGHINPA Sbjct: 1 MATFLFLYITILTVMGVKKSPT--MCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPA 58 Query: 106 VTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSY-YMKYGGGANELSAGYNKG 164 VTFGL LARK+SL RA+ YII QCLGAICG G+VK F+ S Y GGGAN +++GY KG Sbjct: 59 VTFGLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKG 118 Query: 165 TGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGIN 224 GLGAEI+GTFVLVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+VHLATIPITGTGIN Sbjct: 119 DGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGIN 178 Query: 225 PARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRA 268 PARS GAA+I+N++ AWDD WIFW+GPFIGAA+AA Y Q ++RA Sbjct: 179 PARSLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRA 222 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27340 (72 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24736 (340 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv35079 397 e-112 >Vv35079 Length = 267 Score = 397 bits (1019), Expect = e-112, Method: Compositional matrix adjust. Identities = 192/265 (72%), Positives = 214/265 (80%), Gaps = 6/265 (2%) Query: 74 KVELATKFGLRFVENKMEVGKNMEVQGDPAYVRAALESSLKRLGVDSIDLYYQHRIDTSV 133 +VELA+KFG+ + + K +V +GDPAYVRAA E+SLKRL VD IDLYYQHRIDT V Sbjct: 6 EVELASKFGIIYADGKRDV------RGDPAYVRAACEASLKRLEVDCIDLYYQHRIDTRV 59 Query: 134 PVEVTXXXXXXXXXXXXXXYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIP 193 P+EVT YIGLSEASASTIRRAHAVHPITAVQLEWSLW+RDVE+EI+P Sbjct: 60 PIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVP 119 Query: 194 TCRELGIGIVAYSPLGRGFFASGAKFVENLAHGDSRKNLPRFQPENVEHNKTLFERVSDL 253 TCRELGIGIVAYSPLGRGFF+SG K VENL++ D RKNLPRFQPEN+ HNK L+ERVS++ Sbjct: 120 TCRELGIGIVAYSPLGRGFFSSGTKLVENLSNNDFRKNLPRFQPENLGHNKILYERVSEI 179 Query: 254 AARKGCTPSQLALAWVHHQGNDVCPIPGTTKIANFDQNIAALSVKLTPEELAELESYASV 313 A RKGCTPSQLALAWVHHQGNDVCPIPGTTKI N QNI ALSVKLTPEE AELES AS Sbjct: 180 ATRKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLKQNIGALSVKLTPEETAELESIASA 239 Query: 314 DAVKGERYPNYYSTWSNSETPPLSS 338 D VKG+RY + TW + TPPL S Sbjct: 240 DGVKGDRYESTAFTWKTAHTPPLDS 264 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19569 (80 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6904 (421 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig28888 (401 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14022 451 e-128 >Vv14022 Length = 487 Score = 451 bits (1160), Expect = e-128, Method: Compositional matrix adjust. Identities = 221/382 (57%), Positives = 277/382 (72%), Gaps = 8/382 (2%) Query: 23 MLLIVLEVCDGG----ITSSYVRNXXXXXXXXXXXXVFQVPPGYNVPQQVHITQGDHEGK 78 + V C G ITS++VR+ VF VP GYN PQQVHITQGD++GK Sbjct: 20 ITFFVFMCCVGNGNARITSAFVRSEFPSVDIPLDNKVFAVPKGYNAPQQVHITQGDYDGK 79 Query: 79 GVIVSWVTPDEPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDT 138 VIVSWVT DEPG S V Y T +A+ T Y ++ Y SGYIHHC +D LEFDT Sbjct: 80 AVIVSWVTTDEPGPSKVKYGTSEKT-YDYTAEGTTTNYTFYKYQSGYIHHCLVDGLEFDT 138 Query: 139 KYYYEVGTGNTARRFWFVTPPRVGPDVAYTFGLIGDLGQTHDSNDTLTHYELNPAKGQTL 198 KYYY++G+GN++R FWF TPP + PD Y FG+IGDLGQT++S TL HY ++GQT+ Sbjct: 139 KYYYKIGSGNSSREFWFQTPPEIDPDAPYIFGIIGDLGQTYNSLSTLEHYMH--SEGQTV 196 Query: 199 LFVGDLSYADDYPFHDNN-RWDTWGRFVERNVAYQPWIWTAGNHEIDFVPELGESTPFKP 257 LF+GDLSYAD Y ++D RWDTWGRFVE++ AYQPWIW+AGNHEI+++P +GE PFK Sbjct: 197 LFLGDLSYADRYQYNDVGVRWDTWGRFVEQSAAYQPWIWSAGNHEIEYMPYMGEVLPFKS 256 Query: 258 YTNRYFVPYEASGSTSPLWYSIKRASAYIIVLSSYSAYGKYTPQYKWLEKELPKVNRTET 317 Y R+ PY AS S+SPLWY+I+RASA+IIVLSSYS + YTPQ+ WL +E +VNR +T Sbjct: 257 YLYRFPTPYAASKSSSPLWYAIRRASAHIIVLSSYSPFVTYTPQWLWLAEEFKRVNREKT 316 Query: 318 PWLIVLMHSPLYSSYVHHYMEGESFRVMYEEWFVEYEVDVVFAGHVHAYERSERISNVAY 377 PWLIVLMH P+Y+S H+MEGES R +E WF+ +VD+VFAGHVHAYERS RISN+ Y Sbjct: 317 PWLIVLMHVPIYNSNEAHFMEGESMRAAFESWFILNKVDIVFAGHVHAYERSYRISNIHY 376 Query: 378 NISNGLCTPLSDRSAPVYITIG 399 ++S+G P+ D SAPVYIT+G Sbjct: 377 SVSSGDPYPVPDESAPVYITVG 398 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10714 (163 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27549 (173 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24188 (264 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71814181 (125 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig19020 (188 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig32374 (96 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig651 (233 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4544 (232 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27666 163 3e-42 >Vv27666 Length = 612 Score = 163 bits (412), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 95/229 (41%), Positives = 130/229 (56%), Gaps = 13/229 (5%) Query: 3 WERDMESCITPLPETSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLW 62 W ME+CITP + + G L WP RA A PPR++ G + + +D ++W Sbjct: 388 WGVPMEACITPYSDHD--HKSRGSELAPWPARATAPPPRLADF---GYSKDIFEKDTEVW 442 Query: 63 KERVEHYKRIVP--ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMSTVPANSNQDTLGVI 120 +RVE Y ++ I+ RN+MDM A LG FAAAL VWVM+ VP + +TL +I Sbjct: 443 MQRVESYWNLLSPKITSDTLRNLMDMKANLGSFAAALKGKDVWVMNVVPED-GPNTLKLI 501 Query: 121 YERGFIGTYQDWCEAFSTYPRTYDLIHAGGVFS-IYQDRCDITLILLEMDRILRPEGTVV 179 Y+RG IGT +WCEAFSTYPRTYDL+HA VFS I + C +L+EMDRILRP G V+ Sbjct: 502 YDRGLIGTIHNWCEAFSTYPRTYDLLHAWTVFSDIEKKGCSAEDLLIEMDRILRPTGFVI 561 Query: 180 FRDTVEILVKIKAITDGMRWKSQIMDHESGPFNPEKILLAVKTYWTGEE 228 RD ++ +K + W++ + + G E + L K W E Sbjct: 562 IRDKPSVIEFVKKYLTALHWEA-VSNERDG---DELVFLIQKKIWLTSE 606 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 90997873 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5235 (166 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv51555 302 3e-84 >Vv51555 Length = 166 Score = 302 bits (773), Expect = 3e-84, Method: Compositional matrix adjust. Identities = 150/166 (90%), Positives = 154/166 (92%) Query: 1 MALVTTAEVCDAHSQLIGSGDLRVLEPAFQIYGRRQVFSGQIVTLKVFEDNVLVRGFLEE 60 MALVTTAEVCDA+ QLI SG+LR L+P FQIYGRR VFSG IVTLKVFEDNVL+R FLEE Sbjct: 1 MALVTTAEVCDANPQLIVSGELRALQPVFQIYGRRPVFSGPIVTLKVFEDNVLIREFLEE 60 Query: 61 KGNGRVLVVDGGGSKRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALAS 120 KGNGRVLVVDGGGS RCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRAL S Sbjct: 61 KGNGRVLVVDGGGSMRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALNS 120 Query: 121 HPMKANKKGIGEKQVPITIAGTRICDGEWLYADTDGILISRTELSV 166 HPMKANKKGIGEK VPI IAGTRI DGEWLYADTDGILISRTELSV Sbjct: 121 HPMKANKKGIGEKHVPIAIAGTRISDGEWLYADTDGILISRTELSV 166 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48380738 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26701 (179 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig4713 (252 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3814 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10310 (65 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10321 (269 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48414632 (167 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24364 (347 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv39875 97 3e-22 >Vv39875 Length = 372 Score = 97.4 bits (241), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 45/110 (40%), Positives = 74/110 (67%) Query: 5 SSKSRTWLERKNLSLSNLDSMRNVMELLDDMLQAVNPSDRLAIKDEVIEELVNGCRANQK 64 ++S T E LSL+ + + R +M++L +ML A++P ++ ++ EVI +LV+ CR ++ Sbjct: 172 GAESSTESEFPTLSLTEIQNARGIMDVLAEMLSALDPGNKEGLRQEVIMDLVDQCRTYKQ 231 Query: 65 KLIHMLTTTGDEELLARGLDLNDRMQSLLAKHDAIVSGLPVPTQATSFSP 114 +++H++ +T DE LL +GL LND +Q LLAKH+AI SG PVP + P Sbjct: 232 RVVHLVNSTADESLLCQGLALNDDLQRLLAKHEAIASGTPVPKEKPKTEP 281 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig18203 (221 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv61701 97 2e-22 >Vv61701 Length = 91 Score = 97.4 bits (241), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 47/91 (51%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Query: 130 HRIDGIDKDNFVYSYTLIEGDGLLSDKIEKVAYETKLVASPDGGSIVKSTSHYHAKGDVE 189 HR+D IDK+ F + YT+I+GD +L+D +E + +E +V +P GGSI K+TS YH KG E Sbjct: 3 HRVDAIDKEKFSFCYTVIDGD-VLTDGVESICHELTVVPAPGGGSIYKNTSKYHTKG-AE 60 Query: 190 IKEEQVKAGKEQASGLFKLVESYLLANPDAY 220 + EE VK GKE A FK +E Y+LA+PD Y Sbjct: 61 VCEEHVKGGKEDALATFKAIEGYVLAHPDGY 91 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22639 (298 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2967 66 8e-13 >Vv2967 Length = 262 Score = 65.9 bits (159), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 49/161 (30%), Positives = 76/161 (47%), Gaps = 30/161 (18%) Query: 116 YAWRYFIHHGVVTEECD-PYFDSTGCSHPGCEPAYPTPKCVKKCVDGNQIWKNSKRYSIS 174 YA+ + I++G + E D PY S G +C +Q KN++ +I Sbjct: 3 YAFEFIINNGGIDSEEDYPYKASDG-----------------RC---DQYRKNARVVTID 42 Query: 175 AYR-INSDPHSIMAEVYRNGPVEVAFTVY-EDFAHYKSGVYKHVKGDVLGGHAVKLIGWG 232 Y + + + + N PV VA +F Y+SG++ G L H V +G+G Sbjct: 43 GYEDVPENDEKSLEKAVANQPVSVAIEAGGREFQLYQSGIFTGRCGTALD-HGVTAVGYG 101 Query: 233 TTNDGEDYWLLANQWNRSWGDDGYFKIRR-----GTNECGI 268 T N G DYW++ N W SWG++GY ++ R T +CGI Sbjct: 102 TEN-GVDYWIVKNSWGASWGEEGYIRMERDLATSATGKCGI 141 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7976 (241 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv49361 316 2e-88 >Vv49361 Length = 246 Score = 316 bits (810), Expect = 2e-88, Method: Compositional matrix adjust. Identities = 159/247 (64%), Positives = 183/247 (74%), Gaps = 10/247 (4%) Query: 1 MASLGILVIGFLSLVSSVNGYYGGWSNAHATFYXXXXXXXXXXXXXXYGNLYSQGYGTNT 60 M +G+ ++GFLS+VSSV+G GW NAHATFY YGNLYS+GYGTNT Sbjct: 1 MTLVGLFLVGFLSMVSSVHGQ--GWINAHATFYGGGDASGTMGGACGYGNLYSEGYGTNT 58 Query: 61 AALSTALFNNGLTCGACYQIRCVNDPQWCLPGSIIVTATNFCPP--------GGWCDPPQ 112 AALSTALFNNGL+CG+CY+I+CVND +WCLPGSI++TATNFCPP GGWC+PP Sbjct: 59 AALSTALFNNGLSCGSCYEIKCVNDGKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPL 118 Query: 113 QHFDLSQPVFLRIAQYKAGXXXXXXXXXXXXXXXXXXXXXNGHSYFNLVLVTNVGGAGDV 172 HFDLSQPVF IAQY+AG NGHSYFNLVL+TNVGGAGDV Sbjct: 119 HHFDLSQPVFQHIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDV 178 Query: 173 QSVAIKGSRTRWQAMSRNWGQNWQSNSYLNGQSLSFIVTTSDGRRLVSYNVAPPNWSFGQ 232 +VAIKGSRT WQ+MSRNWGQNWQSN+YLNGQSLSF VTTSDG +VSYN P +WSFGQ Sbjct: 179 HAVAIKGSRTGWQSMSRNWGQNWQSNTYLNGQSLSFKVTTSDGHTIVSYNCVPAHWSFGQ 238 Query: 233 TYTGRQF 239 T++G QF Sbjct: 239 TFSGAQF 245 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6388 (317 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv8462 72 1e-14 >Vv8462 Length = 305 Score = 72.0 bits (175), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 34/57 (59%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Query: 226 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFER-SHDGQITEIIYKGTHDH 281 +DGY WRKYGQK VK S FPRSYY+CT+ C VKK ER S D I Y+G H H Sbjct: 162 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSIVITTYEGQHCH 218 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13086 (87 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig16962 (60 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig1073 (86 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv16735 157 3e-41 >Vv16735 Length = 391 Score = 157 bits (398), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 73/78 (93%), Positives = 75/78 (96%) Query: 6 PSPCSVFVDSYGTGKIPDKEILKIVKETFDFRPGMISINLDLKRGGNGRFLKTAAYGHFG 65 P P SVFVDSYGTGKIPDKEILKIVKE FDFRPGMI+INLDLKRGGNGRFLKTAAYGHFG Sbjct: 313 PEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFG 372 Query: 66 RDDPDFTWEVVKPLKWDK 83 RDDPDFTWEVVKPLKW+K Sbjct: 373 RDDPDFTWEVVKPLKWEK 390 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21210 (225 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv20032 249 3e-68 >Vv20032 Length = 153 Score = 249 bits (636), Expect = 3e-68, Method: Compositional matrix adjust. Identities = 115/150 (76%), Positives = 134/150 (89%) Query: 73 VSDKESDEFSVSGIDDVVTILQSDFENAYFVTGIFTSAIYTEDCVFEDPTIRFQGKDLYS 132 +S K+ DE VS IDDV+ IL+SD+ENAYFVTGIFTSAIY EDC+FEDPTI+F+GKDLYS Sbjct: 1 MSYKQGDELLVSSIDDVLLILKSDYENAYFVTGIFTSAIYDEDCIFEDPTIKFRGKDLYS 60 Query: 133 RNLKLLVPFFDSPSIGLEKIEKGIDSEANFVLATWKLRTYLKLPWRPLICIDGSTVYDLD 192 RNLKLLVPFFD PSI L+KIEKG +SE FVLA+WKLRTYLKLPWRPLI I GSTVYDL+ Sbjct: 61 RNLKLLVPFFDHPSIALQKIEKGSNSETKFVLASWKLRTYLKLPWRPLISIAGSTVYDLN 120 Query: 193 DKFKIVRHAESWNVSAIEAIGQLFTPTYGR 222 D+FKIVRHAESWN+SA++A+GQ+FTP+ R Sbjct: 121 DEFKIVRHAESWNISALQAVGQIFTPSLRR 150 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21059 (153 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7755 (332 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71813923 (97 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226783584 (106 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig31507 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv25533 133 2e-33 >Vv25533 Length = 159 Score = 133 bits (334), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 77/136 (56%), Positives = 98/136 (72%), Gaps = 7/136 (5%) Query: 24 SSASSGIFGAIFAPSSKDLVFGRESLRSEVTGKKLT--DDPLHFKPRDQPDGASKEIEGE 81 S +S+GIF +IF+ SSK V GRESLR ++T KK ++ + KP + A ++ EGE Sbjct: 29 SPSSTGIFASIFSTSSK--VLGRESLRPDLTKKKQDSGNEVWNAKP-GTTENALQQSEGE 85 Query: 82 SKSITNMDIISSIYRDQRVQQPCHFSSSIYYGGQDIYAHPQSTQNPEYNTPYKKDGTEDD 141 S+SI+N D S Y++QRVQ PCH SSSIYYGGQDIY HPQ++Q+ + KKD EDD Sbjct: 86 SQSISNRDT-GSFYQEQRVQ-PCHLSSSIYYGGQDIYFHPQNSQSSGMPSMLKKDSGEDD 143 Query: 142 SGSASRGNWWQGSLYY 157 +GSASRGNWWQGSLYY Sbjct: 144 TGSASRGNWWQGSLYY 159 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5841 (211 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9611 (337 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 71924193 (157 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10934 (353 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53186 82 1e-17 >Vv53186 Length = 276 Score = 82.4 bits (202), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 70/229 (30%), Positives = 119/229 (51%), Gaps = 27/229 (11%) Query: 55 DGHNGNAPSVYTRENLLKRVLGAIPRGLGREEWLQALPRALVAGFVKTDKDF--QSRGET 112 DGH G+ + Y + NL K L + P ++++ A+ F KTD D+ + +G+ Sbjct: 64 DGHGGSRTAEYLKNNLFKN-LSSHP------DFIKDTKSAIAEVFRKTDADYLNEEKGQA 116 Query: 113 --SGTTATFVIVDGWTVTVASVGDSRCILHTQGGAVSTLSVDHRLXXXXXXXXXXXXSGG 170 +G+TA+ ++ G + VA+VGDSR + G A+ LS DH+ Sbjct: 117 RDAGSTASTAVLVGDRLLVANVGDSRVVACRAGSAI-PLSTDHK-----------PDRSD 164 Query: 171 EVGRLSIVGGAEIAPLRCWPGG-LCLSRSIGDMDVGEFIVPIPYVKQVKLSNAGGRLIIA 229 E R+ GG I GG L +SR+ GD + ++V P +++ ++ +IIA Sbjct: 165 ERQRIEDAGGFVIWAGTWRVGGVLAVSRAFGDKLLKAYVVADPEIQEEEIDGVD-FIIIA 223 Query: 230 SDGIWDAISSEMAAHSCRG-LPAELAARQVVKEALRSRGLKDDTTCIVV 277 SDG+W+ +S++ A + + AE A+R+++ EA +RG D+ TC+VV Sbjct: 224 SDGLWNVLSNKEAVAIVQDIMDAEAASRKLIHEAY-ARGSSDNITCVVV 271 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig21070 (165 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig6614 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv54458 233 2e-63 >Vv54458 Length = 164 Score = 233 bits (595), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 113/155 (72%), Positives = 131/155 (84%) Query: 82 AIKGINRGIFGVPSAKKSQIEALVNQLESRNPTPDPLLNLQKVGGCWKLVYSTITILGSK 141 +I G +RG+FGVPSAKKS+IEALV LES+NPTP+P LNL KV G WKLVYSTITILGSK Sbjct: 9 SIPGSSRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKVNGWWKLVYSTITILGSK 68 Query: 142 RTKLGLRDFISLGDFFQNINIAKGKAVNVIKFDVRGLNLFNGRLTIEASFKKASNSRVDI 201 RTKLGLR+FI+LGDF Q I++ + KAVNVIKF+ RG N NG L IEASFK AS SRVDI Sbjct: 69 RTKLGLRNFITLGDFLQIIDVEEAKAVNVIKFNARGFNFLNGELKIEASFKIASKSRVDI 128 Query: 202 NYDNSMITPSQLMSVFRKNYDILLGIFNPEGWLEI 236 YD+S I P +LM+VF++NYD+LLGIFNPEGWLEI Sbjct: 129 KYDSSTINPDKLMNVFKQNYDLLLGIFNPEGWLEI 163 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig9008 (248 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig20723 (369 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv14913 390 e-110 >Vv14913 Length = 381 Score = 390 bits (1001), Expect = e-110, Method: Compositional matrix adjust. Identities = 212/389 (54%), Positives = 254/389 (65%), Gaps = 28/389 (7%) Query: 1 MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA 60 MK+ VKTLKG+HFEI V+P D V VKKNIE + G D YP QQ+LIH GKVLKD TTL Sbjct: 1 MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD 60 Query: 61 DNKVTEDGFLVVMLSKNKTS-GLAGXXXXXXXXXXXXXXXXXXXXXXRTEAPIQEP---- 115 +N+V E+ F+V+MLSKNK S G A + AP Q P Sbjct: 61 ENQVAENSFVVIMLSKNKVSAGGASTTSAAPTSQAQPVSSSPPTSNQPSTAP-QAPVVAL 119 Query: 116 ----PLQSTTSAPDTSSAHSDTYGQAASTLVAGTNLEQTIQQIMDMGGGNWDKETVTRAL 171 P + AP SS SD YGQAAS LVAG NLE TIQQI+DMGGG+WD++TV RAL Sbjct: 120 PEVIPEPAPAVAPSISS-DSDIYGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRAL 178 Query: 172 RAAYNNPERAVDYLYSSIPETTEVAVPVGNFPAS-----------QATDVAPVSGAPNSA 220 RAAYNNPERAV+YLYS IPE E P PAS Q S PN+ Sbjct: 179 RAAYNNPERAVEYLYSGIPEQAE-GPPAARPPASGLAVNLPTQAPQGPQTTVASSGPNAN 237 Query: 221 PLNMFPQETXXXXXXXXXXXXNFLKNNRQFQALRSMVQSNPQILQPMLQELGKQNPQLLR 280 PL++FPQ +FL+N+ QFQALR+MVQ+NPQILQPMLQELGKQNP L+R Sbjct: 238 PLDLFPQGLPSMGSNASAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMR 297 Query: 281 LIQEHHTEFLQLINEPVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAIERLEAMGFDRA 340 LIQEH +FL+LINEPVEG EG++ Q +P A+ +TP E+E+IERLEAMGFDRA Sbjct: 298 LIQEHQADFLRLINEPVEG-EGNVLGQLG----TVPQAVTITPEERESIERLEAMGFDRA 352 Query: 341 LVIEAFLACDRNEELAANYLLENAGDFED 369 LV+E F AC++NEELAANYLL++ +FE+ Sbjct: 353 LVLEVFFACNKNEELAANYLLDHMHEFEE 381 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10275 (245 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv17959 153 2e-39 >Vv17959 Length = 231 Score = 153 bits (387), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 88/189 (46%), Positives = 111/189 (58%), Gaps = 9/189 (4%) Query: 60 ELKDLTDNFGTKSLIGEGSYGRVYHGVLKSGPAAAIKKLD---SSKQPEREFLSQVSMVS 116 ELK TD+F + IGEG +G VY G L+ G A+K L S + EREF+S++S ++ Sbjct: 44 ELKIATDSFHPSNKIGEGGFGSVYKGQLRDGTTVAVKVLSVEIESMRGEREFVSELSALT 103 Query: 117 RLKHENAVELVGYCIDGPLRLLAYEYAPKGSLHDILHGRKGVKGAQPGPVLSWVQRVKIA 176 +KHEN V L G C++G R L Y+Y SL L G K Q W R I+ Sbjct: 104 DIKHENLVTLQGCCVEGASRFLVYDYMENNSLAQTLLGAK-----QNRMEFGWEARRDIS 158 Query: 177 VGAARGLEYLHEKAQPHIIHRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVL 236 +G RGL YLHE+ QPHIIHRDIK+ NILL + KI+DF LS D + + STRV Sbjct: 159 LGVGRGLAYLHEEIQPHIIHRDIKAANILLDQNLAPKISDFGLSKLFVDSRSHI-STRVA 217 Query: 237 GTFGYHAPE 245 GT GY APE Sbjct: 218 GTLGYLAPE 226 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig3200 (104 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2542 (204 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv53186 234 1e-63 >Vv53186 Length = 276 Score = 234 bits (596), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 111/191 (58%), Positives = 147/191 (76%), Gaps = 1/191 (0%) Query: 3 HPQFMTDTKLAISESYQQTDADFLDSERDTYRDDGSTASTAVLVGNHLYVANVGDSRTVI 62 HP F+ DTK AI+E +++TDAD+L+ E+ RD GSTASTAVLVG+ L VANVGDSR V Sbjct: 86 HPDFIKDTKSAIAEVFRKTDADYLNEEKGQARDAGSTASTAVLVGDRLLVANVGDSRVVA 145 Query: 63 SKAGKAIALSEDHKPNRSDERKRIENAGGVVMWAGTWRVGGVLAMSRAFGNRMLKQYVVA 122 +AG AI LS DHKP+RSDER+RIE+AGG V+WAGTWRVGGVLA+SRAFG+++LK YVVA Sbjct: 146 CRAGSAIPLSTDHKPDRSDERQRIEDAGGFVIWAGTWRVGGVLAVSRAFGDKLLKAYVVA 205 Query: 123 EPEIQDQVVDDDFEFLVLATDGVWDVLTNXXXXXXXXXXXXXXXXXRKLTAVAFCRGSAD 182 +PEIQ++ + D +F+++A+DG+W+VL+N RKL A+ RGS+D Sbjct: 206 DPEIQEEEI-DGVDFIIIASDGLWNVLSNKEAVAIVQDIMDAEAASRKLIHEAYARGSSD 264 Query: 183 NITCIVVKFRH 193 NITC+VV+F++ Sbjct: 265 NITCVVVRFKN 275 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig27931 (137 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv10510 147 5e-38 >Vv10510 Length = 138 Score = 147 bits (372), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 76/112 (67%), Positives = 89/112 (79%), Gaps = 2/112 (1%) Query: 26 SGLKSVSFSVTGKHFPSLSSR--PGRLQISCAAKPDTITKVCSIVKKQLALAEDVDVSAG 83 S LKSVS + GK F SL R P RL++SCAAKP+T+ KVC IV+KQLAL D +V+ Sbjct: 26 SSLKSVSMPIKGKSFQSLRLRTGPSRLRVSCAAKPETVNKVCDIVRKQLALPADSEVTGE 85 Query: 84 SKFSELGADSLDTVEIVMGLEEAFGITVEEENAQTIATVQDAADLIEDLVAK 135 SKF+ LGADSLDTVEIVMGLEE FGI+VEEE+AQ IATVQDAADLIE L++ Sbjct: 86 SKFATLGADSLDTVEIVMGLEEEFGISVEEESAQGIATVQDAADLIEQLISN 137 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91038482 (150 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10305 (196 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv6626 126 3e-31 >Vv6626 Length = 210 Score = 126 bits (316), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 79/202 (39%), Positives = 109/202 (53%), Gaps = 52/202 (25%) Query: 1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCS- 59 M RG+++++RIEN +RQVTF+KRRNGLLKKAYELSVLCDAEVA+IIFS +G+LYEF S Sbjct: 1 MVRGKIQMRRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSSS 60 Query: 60 ----------------------------------------------SFRNLLGEDLSHLN 73 S R LLG+ LS + Sbjct: 61 NMQSAIERYREHAKQVETNNPELEQYMQNLKQDAESMAKKIELLEVSQRKLLGQGLSSCS 120 Query: 74 TKELEHLEHQLETSLKQIRSRKTQFILDQLSDLQNREQMLVEANKALKRKLE---ETSVQ 130 E+ ++ QLE SLK IR+RK Q +Q+ +L+ RE+ L+E N L +K + S Q Sbjct: 121 LDEILEIDSQLEKSLKSIRARKAQIFQEQIEELKEREKQLLEENARLSQKDTRQWQLSAQ 180 Query: 131 APEGMAWEAAGHGPNNIQQTRL 152 EG+ + + P++ +T L Sbjct: 181 PSEGVTY--SQSSPSSEVETEL 200 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig13373 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig26517 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226758534 (147 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig24208 (81 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8595 (98 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig23179 (307 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig2796 (227 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig7160 (279 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22165 140 3e-35 >Vv22165 Length = 215 Score = 140 bits (352), Expect = 3e-35, Method: Compositional matrix adjust. Identities = 68/137 (49%), Positives = 92/137 (67%) Query: 1 MFGCKNVTMSNVHLIAPGDSPNTDGLHISTSSQIKVLNSVMATGDDCVSIGQGSHDITVK 60 + C N+T+ V + A GDS NTDG+H+ S+ + + ++++ TGDD +SIG GS I V+ Sbjct: 3 ILNCWNMTLQYVTINATGDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVE 62 Query: 61 NVTCGPGHGISIGSLGKYADELSVSQIYVSNCTFRNTTNGARIKTWAGESAGEATGIIYE 120 VTCGPGHGIS+G LGKY +E V + V NCT NT NG R+KTW AT + +E Sbjct: 63 KVTCGPGHGISVGRLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPVSVATDLHFE 122 Query: 121 DIIMDQVQNPIIIDQNY 137 DIIM+ V NPI+I+Q Y Sbjct: 123 DIIMNNVGNPILINQEY 139 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8160 (389 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv2674 687 0.0 >Vv2674 Length = 389 Score = 687 bits (1774), Expect = 0.0, Method: Compositional matrix adjust. Identities = 329/389 (84%), Positives = 351/389 (90%) Query: 1 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCKLTAFLGYKAGMTHIVRDV 60 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDP+ PC+LTAFLGYKAGMTHIVR+V Sbjct: 1 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPTNPCRLTAFLGYKAGMTHIVREV 60 Query: 61 EKPGSKLHKKETCEAVTIIEAPPMXXXXXXXXXKTPRGLRSLNTVWAQHLSEEVKRRFYX 120 EKPGSKLHKKETCEAVTIIE PPM KTPRGLRSLNTVWAQHLSEEVKRRFY Sbjct: 61 EKPGSKLHKKETCEAVTIIETPPMVVVGVVGYLKTPRGLRSLNTVWAQHLSEEVKRRFYK 120 Query: 121 XXXXXXXXXXXXXXXNYESEEGKKSIESQFEKLIKYATVIRVLAHTQIRKMKGLKQKKAH 180 YESE+GKK I++Q EK+ KY VIRVLAHTQIRKMKGLKQKKAH Sbjct: 121 NWCKSKKKAFTKYSKKYESEDGKKDIQAQLEKMKKYCNVIRVLAHTQIRKMKGLKQKKAH 180 Query: 181 LMEIQVNGGTIAQKVEFAKSFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240 LMEIQVNGG +A+KV++A FFEKQIPIDA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTR Sbjct: 181 LMEIQVNGGDVAKKVDYAYGFFEKQIPIDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240 Query: 241 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKAGQESHTAVT 300 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYK+GK GQESH+A+T Sbjct: 241 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKVGKTGQESHSAMT 300 Query: 301 EFDRTEKDITPIGGFPHYGVVKDDYILIKGCCVGPKKRVVTLRQSLLKQTSRLALEDIKL 360 EFDRTEKDITP+GGFPHYGVVKDDY+LIKGCCVGPKKRVVTLRQSLLKQTSR+A+E+IKL Sbjct: 301 EFDRTEKDITPMGGFPHYGVVKDDYLLIKGCCVGPKKRVVTLRQSLLKQTSRVAMEEIKL 360 Query: 361 KFIDTSSKFGHGRFQTTQEKQKYYGRLKA 389 KFIDTSSKFGHGRFQTTQEK K++GRLKA Sbjct: 361 KFIDTSSKFGHGRFQTTQEKAKFFGRLKA 389 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50353317 (85 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48273282 (88 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig14404 (116 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48405783 (112 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10695 (225 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv22966256 315 3e-88 >Vv22966256 Length = 306 Score = 315 bits (808), Expect = 3e-88, Method: Compositional matrix adjust. Identities = 162/249 (65%), Positives = 186/249 (74%), Gaps = 28/249 (11%) Query: 1 MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA 60 MP IA+G+P++TYHPDAL+ ALAEF TLIFVFAGEGSGMAF+KLTDD +TTP+GL+A Sbjct: 56 MPFLRIAIGQPQDTYHPDALKKALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA 115 Query: 61 AALAH--------------------------AFIGGNISLLRGLLYWIAQLLGATVACGL 94 AL H AF+GGNI+LLRG+LYWIAQLLG+ VAC L Sbjct: 116 EALGHGLGLFVAVSGAWNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL 175 Query: 95 LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGSVGTIAPIAIG 154 LK T+G TT+AF++S G VWNAFV EIVMTFGLVYTVYATAIDP+ G+VG IAP+AIG Sbjct: 176 LKFCTHGMTTSAFAISSGETVWNAFVLEIVMTFGLVYTVYATAIDPRNGNVGIIAPLAIG 235 Query: 155 FIVGANILAGGAFDGASMNPAVSFGPALVSWSWENHWVYWAGPLISAGIPGVIHHFAFIG 214 IV ANILAGGAFDGASMNPA+SFGPALVSW W NHWVYWAGPLI GI G ++ FI Sbjct: 236 LIVAANILAGGAFDGASMNPAMSFGPALVSWDWTNHWVYWAGPLIGGGIAGFVYETIFI- 294 Query: 215 NSRHDQPPP 223 R +P P Sbjct: 295 -DRTHEPLP 302 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig22927 (304 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv55978 72 1e-14 >Vv55978 Length = 230 Score = 72.0 bits (175), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 32/54 (59%), Positives = 42/54 (77%) Query: 249 MILAAIYPEKFQGEKGLNLMKLAKLPPDDMNAVNNMKLLGGAPDTKKCTGAFFS 302 MI A++YPEKF+G+KGL LM+LA+L P+DM VNNM+LL G+ TKK + FS Sbjct: 1 MIYASVYPEKFEGDKGLKLMQLARLSPEDMKVVNNMRLLEGSSATKKKSSGGFS 54 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 48401035 (119 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 226764053 (127 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 46598328 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig5417 (142 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig8059 (222 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv26961 132 4e-33 >Vv26961 Length = 285 Score = 132 bits (333), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 91/246 (36%), Positives = 128/246 (52%), Gaps = 37/246 (15%) Query: 11 RASEPEFFLQWGNRKRLRCVRVKGSEISAERFKFNGGMCRTITSSRIHRF--AVSTSGKD 68 R++ +F LQWGNRKRLRC++++ + SA K + R + + +T+ Sbjct: 43 RSTASDFVLQWGNRKRLRCMKIQVKDDSAPVHKTTVRVDRRVVRADKDSLNQPTTTAAAT 102 Query: 69 ISGF----------------QSNRLTRNSD-GALLRCSAGENRKSSSPEKEERYYTRRGS 111 +G+ R+ RNS+ + ++ + R SSP +++ RRG+ Sbjct: 103 SNGYFNLRHRPSSPQPPPPPPPQRVLRNSENSSAMKGQSNGVRGFSSPARDQ---DRRGN 159 Query: 112 V--------------GVDESCNGNGNGKVMMDGNNVEDRGLVWP-KLYITLSSKEKEEDF 156 E+ + + G E VWP K I L++KEKEEDF Sbjct: 160 HHNANNHHHNNDNKSASSETAHDSKKGGGGSSSAGSEAVPPVWPPKFVIALTNKEKEEDF 219 Query: 157 LAMKGCKLPQRPKKRAKLIQRSLLLVSPGAWLTDMCQERYEVREXXXXXXXXRGLKAMGS 216 +A+KG KLPQRPKKRAK IQR+L LVSPGAWL D+ ERYEVRE RGLKAMG+ Sbjct: 220 MAIKGSKLPQRPKKRAKFIQRTLNLVSPGAWLCDLTLERYEVREKKISKKKPRGLKAMGN 279 Query: 217 LETDSE 222 +E+DSE Sbjct: 280 MESDSE 285 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig25701 (180 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 91029556 (47 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Contig10658 (189 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Vv27467 69 8e-14 >Vv27467 Length = 181 Score = 68.6 bits (166), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 35/96 (36%), Positives = 47/96 (48%), Gaps = 3/96 (3%) Query: 30 VGGKDGWVVNPSQSYSLWAEKNRFNINDTLHFKYKKGSDSVLVVNKDDYFSCNTQNPIQK 89 VGG GW + YS WA F + D L F Y + SV V+K Y SC T NP + Sbjct: 24 VGGSSGW--DTGVDYSTWASGETFTVGDYLVFTYGS-THSVDEVSKSSYDSCATSNPTKS 80 Query: 90 LDGGDSDFTVDRSGPFYFISGQNGNCQKGQKLLVIV 125 GG + + +G YF+ G+C +G KL + V Sbjct: 81 YTGGSNTIALTTAGSLYFLCPTTGHCSQGMKLAITV 116 BLASTP 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 50890345 (105 letters) Database: grape.as.orf 1588 sequences; 373,712 total letters Searching..................................................done ***** No hits found ****** Database: grape.as.orf Posted date: Mar 27, 2017 5:37 AM Number of letters in database: 373,712 Number of sequences in database: 1588 Lambda K H 0.313 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1588 Number of Hits to DB: 245,282,098 Number of extensions: 10154548 Number of successful extensions: 30486 Number of sequences better than 1.0e-10: 1455 Number of HSP's gapped: 28616 Number of HSP's successfully gapped: 1650 Length of database: 373,712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 135 (56.6 bits)